Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D032903.494ON28528513360.0
Kpol_1017.53.494ON28328311721e-163
YGR132C (PHB1)3.494ON28728411641e-162
Smik_6.2283.494ON28728311601e-161
SAKL0F02728g3.494ON28228311541e-160
KLTH0F14872g3.494ON28028311541e-160
Suva_7.4203.494ON28728311531e-160
CAGL0I10472g3.494ON28827911441e-159
Skud_7.4433.494ON28728411321e-157
TDEL0D056203.494ON27928111161e-155
NCAS0E007903.494ON32728411171e-154
NDAI0G009203.494ON29628411141e-154
KAFR0C019803.494ON28328511111e-154
Kwal_55.212403.494ON28325911101e-153
TBLA0D029503.494ON28228210931e-151
ZYRO0D09900g3.494ON28328510441e-143
KNAG0B007903.494ON28428310431e-143
Ecym_12353.494ON28328310411e-143
AFR313C3.494ON2832869841e-134
KLLA0D16302g3.494ON2262139591e-131
YGR231C (PHB2)5.98ON3102347222e-94
Smik_16.755.98ON3102347195e-94
Suva_7.5235.98ON3102347196e-94
TBLA0H022205.98ON3072317179e-94
SAKL0G15510g5.98ON3082347143e-93
ADL141W5.98ON3072317125e-93
Kpol_1050.615.98ON3102317111e-92
NDAI0D025305.98ON3162317111e-92
Skud_7.5655.98ON3102347092e-92
KAFR0B042505.98ON3102347082e-92
CAGL0L06490g5.98ON3132417065e-92
Kwal_27.127475.98ON3072357057e-92
ZYRO0B15136g5.98ON3102317041e-91
KLTH0C01672g5.98ON3072317031e-91
KNAG0A015805.98ON2882316992e-91
TPHA0A050905.98ON3102317013e-91
NCAS0F006005.98ON3132316962e-90
TDEL0G012105.98ON3092316943e-90
KLLA0E15731g5.98ON3082316911e-89
TPHA0I013002.117ON37950711.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D03290
         (285 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   519   0.0  
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   456   e-163
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   452   e-162
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   451   e-161
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   449   e-160
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   449   e-160
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   448   e-160
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   445   e-159
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   440   e-157
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   434   e-155
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     434   e-154
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     433   e-154
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   432   e-154
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   432   e-153
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   425   e-151
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   406   e-143
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   406   e-143
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   405   e-143
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   383   e-134
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   374   e-131
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   282   2e-94
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   281   5e-94
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   281   6e-94
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   280   9e-94
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   279   3e-93
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   278   5e-93
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   278   1e-92
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   278   1e-92
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   277   2e-92
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   277   2e-92
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   276   5e-92
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   276   7e-92
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   275   1e-91
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   275   1e-91
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   273   2e-91
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   274   3e-91
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   272   2e-90
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   271   3e-90
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   270   1e-89
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    32   1.9  

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  519 bits (1336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/285 (91%), Positives = 260/285 (91%)

Query: 1   MSTKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPW 60
           MSTKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPW
Sbjct: 1   MSTKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPW 60

Query: 61  LQKAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLP 120
           LQKAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLP
Sbjct: 61  LQKAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLP 120

Query: 121 SIGNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFT 180
           SIGNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFT
Sbjct: 121 SIGNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFT 180

Query: 181 KAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRR 240
           KAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYIS            IRR
Sbjct: 181 KAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRR 240

Query: 241 LEASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           LEASKEIAKTLSQSSNVTYLP             TPNSLLLNLGR
Sbjct: 241 LEASKEIAKTLSQSSNVTYLPSGSSSNGNNESAGTPNSLLLNLGR 285

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  456 bits (1172), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 226/283 (79%), Positives = 245/283 (86%), Gaps = 1/283 (0%)

Query: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62
           +K++D + K+A+P+GI VSGIQ++MYDVKGGSRAVIFDR+SGVKQ +IGEGTHFL PWLQ
Sbjct: 2   SKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQ 61

Query: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122
           KAI++DVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDV QLPTIYQNLGLDYDERVLPSI
Sbjct: 62  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSI 121

Query: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182
            NEVLKAIVAQFDAAELITQRE+VS++IR EL  RSNEFGI+LEDVSITHMTFG EFTKA
Sbjct: 122 SNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKA 181

Query: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLE 242
           VE KQIAQQDAERAKFLVE+AEQERQAAVIRAEGEAESAEYIS            IRRLE
Sbjct: 182 VELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLE 241

Query: 243 ASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           ASKEIA TLSQSSNVTYLP             TPN+LLLNLGR
Sbjct: 242 ASKEIAATLSQSSNVTYLP-NGHGNARGGSDGTPNTLLLNLGR 283

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  452 bits (1164), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 220/284 (77%), Positives = 245/284 (86%)

Query: 2   STKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWL 61
           S K++D + K+A+P+GI  SGIQY+MYDVKGGSR VIFDR++GVKQQV+GEGTHFL PWL
Sbjct: 4   SAKLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWL 63

Query: 62  QKAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPS 121
           QKAI++DVRTKPKSIATNTGTKDLQMVSLTLRVLHRP+V QLP IYQNLGLDYDERVLPS
Sbjct: 64  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPS 123

Query: 122 IGNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTK 181
           IGNEVLK+IVAQFDAAELITQREI+S KIR+ELS R+NEFGIKLEDVSITHMTFG EFTK
Sbjct: 124 IGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTK 183

Query: 182 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRL 241
           AVEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESAE+IS            IRRL
Sbjct: 184 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 243

Query: 242 EASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           EASK+IA+TL+ SSNV YLP             +PNSLLLN+GR
Sbjct: 244 EASKDIAQTLANSSNVVYLPSQHSGGGNSESSGSPNSLLLNIGR 287

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  451 bits (1160), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 217/283 (76%), Positives = 245/283 (86%)

Query: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62
           ++++D + K+A+P+GI  SGIQY+MYDVKGGSR VIFDR++GVKQQV+GEGTHFL PWLQ
Sbjct: 5   SRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122
           KAI++DVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V QLP IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182
           GNEVLK+IVAQFDAAELITQREI+S KIR+ELS R+NEFGIKLEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLE 242
           VEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESAE+IS            IRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 243 ASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           ASK+IA+TL+ SSNV YLP             +PNSLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGNSESSGSPNSLLLNIGR 287

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  449 bits (1154), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 223/283 (78%), Positives = 246/283 (86%), Gaps = 2/283 (0%)

Query: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62
           +K+ D L +IA+P+GIA S +QY+MYDVKGG+RAVIFDRLSGV+QQVIGEGTHFL PWLQ
Sbjct: 2   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 61

Query: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122
           +AIV+DVRTKPK+IATNTGTKDLQMVSLTLRVLHRP+V QLP IYQNLGLDYDERVLPSI
Sbjct: 62  RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 121

Query: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182
           GNEVLKAIVAQFDAAELITQREIVS +IR+ELS+R+ EF I+LEDVSITHMTFG+EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 181

Query: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLE 242
           VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESA+YIS            IRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 241

Query: 243 ASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           ASKEIA+TL+ SSNVTYLP             +PNSLLLNLGR
Sbjct: 242 ASKEIAQTLANSSNVTYLP--SNGAGGAEQQGSPNSLLLNLGR 282

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  449 bits (1154), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 218/283 (77%), Positives = 246/283 (86%), Gaps = 4/283 (1%)

Query: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62
           +++ D L KIA+PLG+A S +QY+MYDVKGGSRAVIFDRLSGV+QQV+GEGTHFL PWLQ
Sbjct: 2   SRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQ 61

Query: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122
           KA+++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDV +LPTIYQNLGLDYDERVLPSI
Sbjct: 62  KAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSI 121

Query: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182
           GNEVLKAIVAQFDAAELITQRE VS +IR+ELS+R++EF I+LEDVSITHMTFG+EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKA 181

Query: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLE 242
           VEQKQIAQQDAERA+++VE AEQERQA+VIRAEGEAESAEYIS            IRR+E
Sbjct: 182 VEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIE 241

Query: 243 ASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           ASKEIAKTL+ SSNVTYLP             +PNSLLLNLGR
Sbjct: 242 ASKEIAKTLANSSNVTYLP----SSHSASEQGSPNSLLLNLGR 280

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  448 bits (1153), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 215/283 (75%), Positives = 245/283 (86%)

Query: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62
           ++ +D + K+A+P+G+  SG+QY+MYDVKGGSR VIFDR++GVKQQV+GEGTHFL PWLQ
Sbjct: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122
           KAI++DVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V QLP+IYQNLGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182
           GNEVLK+IVAQFDAAELITQREI+S KIR+ELS R+NEFGIKLEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLE 242
           VEQKQIAQQDAERAKF+VE+AEQERQA+VIRAEGEAESAEYIS            IRRLE
Sbjct: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244

Query: 243 ASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           ASK+IA+TL+ SSNV YLP             +PNSLLLN+GR
Sbjct: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  445 bits (1144), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 220/279 (78%), Positives = 242/279 (86%), Gaps = 2/279 (0%)

Query: 8   RLI-KIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIV 66
           RLI K+A+P+GIAVSG+QY+MYDV+GGSR VIFDRL GVK  V+GEGTHFL PWLQKAI+
Sbjct: 10  RLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAII 69

Query: 67  FDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEV 126
           +DVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDV QLP IYQNLGLDYDERVLPSIGNEV
Sbjct: 70  YDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEV 129

Query: 127 LKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQK 186
           LK+IVAQFDAAELITQREIVS KIR+ELS R+NEFGI+LEDVSITHMTFG EFTKAVEQK
Sbjct: 130 LKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQK 189

Query: 187 QIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKE 246
           QIAQQDAERA+FLVE+AEQERQA+VIRAEGEAESAEYIS            IRRLEASKE
Sbjct: 190 QIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKE 249

Query: 247 IAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           IA+TL+ S+N+TYLP             +PN+LLLNLGR
Sbjct: 250 IAQTLANSNNITYLP-SNHAGGDKDDKGSPNTLLLNLGR 287

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  440 bits (1132), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 216/284 (76%), Positives = 246/284 (86%)

Query: 2   STKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWL 61
           +++++D + K+A+P+GI  +GIQY MYDVKGGSR VIFDR++GVKQQV+GEGTHFL PWL
Sbjct: 4   ASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWL 63

Query: 62  QKAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPS 121
           QKAI++DVRTKPKSIATNTGT+DLQMVSLTLRVLHRP+V QLP+IYQNLGLDYDERVLPS
Sbjct: 64  QKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPS 123

Query: 122 IGNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTK 181
           IGNEVLK+IVAQFDAAELITQREI+S KIR+ELS R+NEFGIKLEDVSITHMTFG EFTK
Sbjct: 124 IGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTK 183

Query: 182 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRL 241
           AVEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESAE+IS            IRRL
Sbjct: 184 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 243

Query: 242 EASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           EASK+IA+TL+ SSNV YLP             +PNSLLLN+GR
Sbjct: 244 EASKDIAQTLANSSNVVYLPSQHSGNGSGDSSGSPNSLLLNIGR 287

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  434 bits (1116), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 212/281 (75%), Positives = 243/281 (86%), Gaps = 4/281 (1%)

Query: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62
           +++++ L ++A+PLGI VSG+QY+MYDV+GGSRAVIFDRLSGV++QV+GEGTHFL PWLQ
Sbjct: 2   SRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQ 61

Query: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122
           KAIV+D+RTKPK IATNTGTKD+QMVSLTLRVLHRPDV QLP IYQNLGLDYDERVLPSI
Sbjct: 62  KAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSI 121

Query: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182
           GNEVLKAIVAQFDAAELITQRE+VS +IR+ELS R++EFGI+LEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKA 181

Query: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLE 242
           VEQKQIAQQDAERAKFLVE+AEQ R+A+VIRAEGEAESAEYIS            IRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLE 241

Query: 243 ASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNL 283
           ASKEIA+TL+ SSN+TYLP             + NSLLLN+
Sbjct: 242 ASKEIAQTLAASSNITYLP----GKAHGNTEGSQNSLLLNI 278

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  434 bits (1117), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 210/284 (73%), Positives = 245/284 (86%), Gaps = 2/284 (0%)

Query: 2   STKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWL 61
            TK+L+ + ++A+PLGI  +G++Y+MYDVKGGSR VIFDRLSGV+++VIGEGTHFL PWL
Sbjct: 46  GTKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWL 105

Query: 62  QKAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPS 121
           QKA+++DVRTKPKSIATNTGTKDLQMVSLTLRVLHRP++++LP IYQNLGLDYDE+VLPS
Sbjct: 106 QKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPS 165

Query: 122 IGNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTK 181
           IGNEVLK+IVAQFDAAELITQREIVS +I+ ELS R++EFGI+LEDVSITHMTFG EFTK
Sbjct: 166 IGNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTK 225

Query: 182 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRL 241
           AVEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESAEYIS            IRRL
Sbjct: 226 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRL 285

Query: 242 EASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           EASK+IA+TL+ S N+TYLP             +PNSLLLN+GR
Sbjct: 286 EASKDIAQTLANSPNITYLP--GQQGGRGNDSGSPNSLLLNIGR 327

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  433 bits (1114), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 210/284 (73%), Positives = 240/284 (84%), Gaps = 2/284 (0%)

Query: 4   KVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQK 63
           K  + L K+A+P+G+ V+G+ Y+MYDVKGGSR VIFDRLSGVK  V+GEGTHFL PWLQK
Sbjct: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72

Query: 64  AIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIG 123
           A+++DVRTKPKSIATNTGTKDLQMVSLTLRVLHRP+V +LP IYQNLGLDYDE+VLPSIG
Sbjct: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132

Query: 124 NEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAV 183
           NEVLK+IVAQFDAAELITQREIVS +I+ ELS+R+NEFG++LEDVSITHMTFG EFTKAV
Sbjct: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192

Query: 184 EQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEA 243
           EQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESAE+IS            IRRLEA
Sbjct: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252

Query: 244 SKEIAKTLSQSSNVTYLPXXXXXXXXXX--XXXTPNSLLLNLGR 285
           SK+IA+TL+ S NVTYLP               +PNSLLLN+GR
Sbjct: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  432 bits (1111), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 211/285 (74%), Positives = 243/285 (85%), Gaps = 2/285 (0%)

Query: 1   MSTKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPW 60
           MST+ ++ + K+A+P G+ ++ + Y+MYDVKGGSR VIFDR+SGVK+ VIGEGTHFL PW
Sbjct: 1   MSTRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPW 60

Query: 61  LQKAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLP 120
           LQKAI++DVRTKPKSI+TNTGTKDLQMVSLTLR+LHRP+V +LP IYQNLGLDYDERVLP
Sbjct: 61  LQKAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLP 120

Query: 121 SIGNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFT 180
           SIGNEVLK+IVAQFDAAELITQREIVS +IR+E+S R+NEFGIKLEDVSITHMTFG EFT
Sbjct: 121 SIGNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFT 180

Query: 181 KAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRR 240
           KAVEQKQIAQQDAERA+FLVE+AEQERQA+VIRAEGEAESAE IS            IRR
Sbjct: 181 KAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRR 240

Query: 241 LEASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           LEASK+IA+TLS+SSN+TYLP              PNSLLLN+GR
Sbjct: 241 LEASKDIARTLSKSSNITYLP--GGKGREGDEKTPPNSLLLNIGR 283

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  432 bits (1110), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 207/259 (79%), Positives = 233/259 (89%)

Query: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62
           ++  D L KIA+PLG+A S +QY+MYDVKGGSRAVIFDRLSGV+QQV+GEGTHFL PWLQ
Sbjct: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61

Query: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122
           KA++FDVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDV +LP IYQNLGLDYDERVLPSI
Sbjct: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121

Query: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182
           GNEVLK+IVAQFDAAELITQRE VS +IR+ELS+R++EF I+LEDVSITHMTFG++FTKA
Sbjct: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181

Query: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLE 242
           VEQKQIAQQDAERA+F+VE AEQERQA+VIRAEGEAESAEYIS            IRR+E
Sbjct: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIE 241

Query: 243 ASKEIAKTLSQSSNVTYLP 261
           ASKEIAKTL+ SSNVTYLP
Sbjct: 242 ASKEIAKTLANSSNVTYLP 260

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  425 bits (1093), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 209/282 (74%), Positives = 238/282 (84%), Gaps = 4/282 (1%)

Query: 4   KVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQK 63
           K+ ++L KIA+PLG+ VS + Y+MYDVKGGSRAVIFDR+ GVKQ V+GEGTHFL PWLQK
Sbjct: 5   KIAEKLAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQK 64

Query: 64  AIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIG 123
           +++FD+RTKPK+I TNTGT+DLQMVSLTLR+LHRPD+ QLP IYQNLGLDYDERVLPSIG
Sbjct: 65  SVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIG 124

Query: 124 NEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAV 183
           NEVLK+IVAQFDAAELITQREIVS +IR+EL+ R+NEFGI+LEDVSITHMTFG EFTKAV
Sbjct: 125 NEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAV 184

Query: 184 EQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEA 243
           EQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESAE IS            IRRLE 
Sbjct: 185 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLET 244

Query: 244 SKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           SKEIA+TL+ S +VTYLP             + NSLLLNLGR
Sbjct: 245 SKEIAETLAGSPHVTYLP----GGGNQAEDASKNSLLLNLGR 282

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  406 bits (1044), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 210/285 (73%), Positives = 240/285 (84%), Gaps = 3/285 (1%)

Query: 1   MSTKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPW 60
           MS+++ + + K+A+PLGI  SGIQY+MYDV+GGSRAVIFDRLSGV+Q+V+GEGTHFL PW
Sbjct: 1   MSSRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPW 60

Query: 61  LQKAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLP 120
           LQKA+++DVRTKPKSIATNTGTKD+QMVSLTLRVLHRP V QLP IYQNLGLDYDERVLP
Sbjct: 61  LQKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLP 120

Query: 121 SIGNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFT 180
           SIGNEVLKAIVA++DAAELITQRE+VSN IR+ELS R++EF I+LEDVSITHMTFG EFT
Sbjct: 121 SIGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFT 180

Query: 181 KAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRR 240
           KAVE KQIAQQDAERAKFLVE+AEQ R+ +VIRAEGEAE+AE IS            IRR
Sbjct: 181 KAVELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRR 240

Query: 241 LEASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           LEASK+IA+TL+ SSNVTYLP             T  SLLLNLGR
Sbjct: 241 LEASKDIAQTLANSSNVTYLP---SQQSGGGQEGTSQSLLLNLGR 282

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  406 bits (1043), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 208/283 (73%), Positives = 237/283 (83%)

Query: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62
           +K ++ L K+A+P G+ +    YAMYDVKGGSR VIFDR+SGV+Q+V+GEGTHFL PWLQ
Sbjct: 2   SKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQ 61

Query: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122
           KAI++DVR+KPKSIATNTGTKDLQMVSLTLRVLHRP+V +LP IYQ+LGLDYDERVLPSI
Sbjct: 62  KAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSI 121

Query: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182
           GNEVLK+IVAQFDAAELITQRE+VS +IR ELS R+ EFGI+LEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKA 181

Query: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLE 242
           VEQKQIAQQDAERAKFLVE+AEQ RQA+VIRAEGEAESAE IS            IRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRLE 241

Query: 243 ASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           ASKEIA+TLS+SSNVTYLP             + N+LLLN+GR
Sbjct: 242 ASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  405 bits (1041), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 197/283 (69%), Positives = 235/283 (83%), Gaps = 1/283 (0%)

Query: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62
           ++ L+ +  IAVP+G+A+   Q  +YDV+GG+RAVIFDRLSGV+Q+V+GEGTHFL PWLQ
Sbjct: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61

Query: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122
           KA+++DVRTKPK+IATNTGTKDLQ+V+LTLRVLHRPDV  LP IYQ LGLDYDERVLPSI
Sbjct: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121

Query: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182
           GNEVLKAIVAQFDAAELITQRE+VS KIR+EL+ R++ F IKLEDV+ITHM FG EFTK+
Sbjct: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181

Query: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLE 242
           VE+KQIAQQ++ERAK+LV+ AEQER AAVIRAEG+AE+AEYIS            IRRLE
Sbjct: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241

Query: 243 ASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           ASK+IA+TL+ SSN+TYLP             TP+SLLLNLGR
Sbjct: 242 ASKKIAQTLAGSSNITYLP-SSSKGGSHDACGTPSSLLLNLGR 283

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  383 bits (984), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 198/286 (69%), Positives = 235/286 (82%), Gaps = 7/286 (2%)

Query: 3   TKVLDRLIKIAVPL---GIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFP 59
           +++ D L+++ +PL    +A S +Q++MYDV+GG+RA+IFDR+SGVK  V+GEGTHFL P
Sbjct: 2   SRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIP 61

Query: 60  WLQKAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVL 119
           WLQKAI+FDVRTKP++IATNTGTKDLQMVSLTLRVLHRPDV  L  IY+ LG DYDERVL
Sbjct: 62  WLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVL 121

Query: 120 PSIGNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEF 179
           PSIGNEVLKAIVAQF+A+ELITQRE+VS +IR EL+ R++EF I+LEDVSITHMTFGQEF
Sbjct: 122 PSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEF 181

Query: 180 TKAVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIR 239
           TKAVEQKQIAQQ+++RAKF+VERAEQER+AAVIRAEGEAE+AE+IS            IR
Sbjct: 182 TKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIR 241

Query: 240 RLEASKEIAKTLSQSSNVTYLPXXXXXXXXXXXXXTPNSLLLNLGR 285
           RLEASK IA+TL+ S NVTYLP              PNSLLLNLGR
Sbjct: 242 RLEASKGIAETLANSPNVTYLP----SKGQAADSGAPNSLLLNLGR 283

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  374 bits (959), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 178/213 (83%), Positives = 198/213 (92%)

Query: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62
           ++V D + +IA+P+G+ VS IQY+MYDV+GG RAVIFDRL GV+Q VIGEGTHFL PWLQ
Sbjct: 2   SRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQ 61

Query: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122
           K+I+FDVRTKPK+IATNTGTKDLQMVSLTLRVLHRPDV QLP IYQNLG+DYDERVLPSI
Sbjct: 62  KSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSI 121

Query: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182
           GNEVLKAIVAQFDAAELITQREIVS +IR ELS R++EF IKLEDVSITHMTFGQEFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKA 181

Query: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAE 215
           VEQKQIAQQDAERA+FLVE+AEQER+AAVIRAE
Sbjct: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  282 bits (722), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 179/234 (76%), Gaps = 1/234 (0%)

Query: 23  IQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGT 82
           I  A+++V GG RA+++ R+ GV  ++  EGTHF+FPWL   I++DVR KP+++A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 83  KDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 142
           KDLQMV++T RVL RPDV QLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 143 REIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVER 202
           RE VS  IRE L  R+++F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 203 AEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           A QE+Q  V+RA+GEA+SAE I             ++RL+ +++IAK L+ S N
Sbjct: 234 ARQEKQGMVVRAQGEAKSAELIG-EAIKKSRDYVELKRLDTARDIAKILASSPN 286

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  281 bits (719), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 179/234 (76%), Gaps = 1/234 (0%)

Query: 23  IQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGT 82
           I  A+++V GG RA+++ R+ GV  ++  EGTHF+FPWL   IV+DVR KP+++A+ TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGT 113

Query: 83  KDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 142
           KDLQMV++T RVL RPDV QLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 143 REIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVER 202
           RE VS  IRE L  R+++F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 203 AEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           A QE+Q  V++A+GEA+SAE I             ++RL+ +++IAK L+ S N
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIG-EAIKKSRDYVELKRLDTARDIAKILASSPN 286

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  281 bits (719), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 179/234 (76%), Gaps = 1/234 (0%)

Query: 23  IQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGT 82
           +  A+++V GG RA+++ RL+GV  ++  EGTHF+FPW+   I++DVR KP+++A+ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGT 113

Query: 83  KDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 142
           KDLQMV++T RVL RPDV QLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 143 REIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVER 202
           RE VS  IRE L  R++ F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++
Sbjct: 174 REKVSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 203 AEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           A QE+Q  V++A+GEA+SAE I             ++RL+ +++IAK L+ S N
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTARDIAKILANSPN 286

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  280 bits (717), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 136/231 (58%), Positives = 176/231 (76%), Gaps = 1/231 (0%)

Query: 26  AMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGTKDL 85
           ++++V GG RA+++ RLSGV  ++  EGTHF+ PWLQ  I++DVR KP+++A+ TGTKDL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 86  QMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 145
           QMV++T RVL RPD+  LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 146 VSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVERAEQ 205
           VS  IRE L  R+ +F I L+DVSIT MTF  EFT AVE KQIAQQDA+RA FLV+RA Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 206 ERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           E+Q  V++A+GEA+SAE I             ++RL+ SK+IAK L+ SSN
Sbjct: 235 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDISKDIAKILATSSN 284

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  279 bits (714), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 181/234 (77%), Gaps = 1/234 (0%)

Query: 23  IQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGT 82
           +  A+++V GG RA+++ R+ G++Q++  EGTHF  PWL+  IV+DVR KP+++A+ TGT
Sbjct: 55  VNSALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGT 114

Query: 83  KDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 142
           KDLQMV++T RVL RP+V QLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 115 KDLQMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 174

Query: 143 REIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVER 202
           RE VS  IRE L  R+++F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++
Sbjct: 175 RERVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 234

Query: 203 AEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           A QE+Q  V++A+GEA+SAE I             ++RL+ ++EIA+ LS+S N
Sbjct: 235 ARQEKQGMVVKAQGEAQSAELIG-EAIKKSKDYVELKRLDTAREIAEILSKSPN 287

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  278 bits (712), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 131/231 (56%), Positives = 179/231 (77%), Gaps = 1/231 (0%)

Query: 26  AMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGTKDL 85
           ++++V GG RA+++ RLSGV+Q V GEGTHF+ PWL+  +++DVR+KP+++++ TGT DL
Sbjct: 57  SLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGTNDL 116

Query: 86  QMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 145
           QMV++T RVL RPDVQ LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQRES 176

Query: 146 VSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVERAEQ 205
           VS  IR+ L  R++ F I L+DVSIT+MTF  EFT AVE KQ+AQQDA+RA F VE+A+Q
Sbjct: 177 VSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEKAKQ 236

Query: 206 ERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           E+Q+ +++A+GEA+SAE I             ++RL+ ++EIA  L+ S N
Sbjct: 237 EKQSMIVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIAGILAASPN 286

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  278 bits (711), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 177/231 (76%), Gaps = 1/231 (0%)

Query: 26  AMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGTKDL 85
           A+++V GG RA+++ R+ GV  ++  EGTHF+ PWL+  +V+DVR KP+++A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 86  QMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 145
           QMV++T RVL RPDV QLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 146 VSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVERAEQ 205
           VS  IRE L  R+  F + L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 206 ERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           E+Q  V++A+GEA+SAE I             ++RL+ ++EIA  L++S N
Sbjct: 240 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIADILAKSPN 289

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  278 bits (711), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 177/231 (76%), Gaps = 1/231 (0%)

Query: 26  AMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGTKDL 85
           A+++V GG RA+++ R+SGV  ++  EGTHF  PW++  I++DVR KP+++A+ TGTKDL
Sbjct: 62  ALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASLTGTKDL 121

Query: 86  QMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 145
           QMV++T RVL RP+V QLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 122 QMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 181

Query: 146 VSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVERAEQ 205
           VS  IRE L  R+N F I L+DVSIT MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 182 VSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 241

Query: 206 ERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           E+Q  V+RA+GEA+SAE I             ++RL+ ++EIA+ L++S N
Sbjct: 242 EKQGMVVRAQGEAKSAELIG-DAIKKSKDYVELKRLDTAREIARILAKSPN 291

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  277 bits (709), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 176/234 (75%), Gaps = 1/234 (0%)

Query: 23  IQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGT 82
           +  A+++V GG RA+++ R+ GV  ++  EGTHF+FPWL   I++DVR KP+++A+ TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 83  KDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 142
           KDLQMV++T RVL RPDV QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQ 173

Query: 143 REIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVER 202
           RE VS  IRE L  R+  F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++
Sbjct: 174 REKVSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 203 AEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           A QE+Q  V++A+GEA+SAE I             ++RL+ +++IAK L+ S N
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIG-EAIKKSRDYVELKRLDTARDIAKILANSPN 286

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  277 bits (708), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 180/234 (76%), Gaps = 1/234 (0%)

Query: 23  IQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGT 82
           +Q ++++V GG RA+++ R++GV  ++  EGTHF+ PWL+  IV+DVR KP+++A+ TGT
Sbjct: 53  LQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGT 112

Query: 83  KDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQ 142
           KDLQMV++T RVL RPDV+ LP IY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQ
Sbjct: 113 KDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 172

Query: 143 REIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVER 202
           RE VS  IRE L  R+++F I L+DVSIT MTF  EFT+AVE KQIAQQDA+RA F+V++
Sbjct: 173 REKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDK 232

Query: 203 AEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           A QE+Q  V++A+GEA+SAE I             ++RL+ ++EIA+ L+ S N
Sbjct: 233 ARQEKQGMVVKAQGEAKSAELIG-EAIKKSRDYVELKRLDTAREIARILANSPN 285

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  276 bits (706), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 134/241 (55%), Positives = 180/241 (74%), Gaps = 1/241 (0%)

Query: 16  LGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKS 75
           LG        A+++V GG RA+++ R+ GV Q++  EGTH + PW++  IV+DVR KP++
Sbjct: 49  LGAGALFFNNALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKPRN 108

Query: 76  IATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFD 135
           +A+ TGTKDLQMV++T RVL RP+V QLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+
Sbjct: 109 VASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFN 168

Query: 136 AAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAER 195
           A++LITQRE VS  IR+ L  R++ F I L+DVSIT+MTF  EFT+AVE KQIAQQDA+R
Sbjct: 169 ASQLITQREKVSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDAQR 228

Query: 196 AKFLVERAEQERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSS 255
           A F+V++A QE+Q  V++A+GEA+SAE I             ++RL+ +K+IAK L+ S 
Sbjct: 229 AAFIVDKARQEKQGMVVKAQGEAKSAELIG-DAIKKSRDYVELKRLDTAKDIAKILANSP 287

Query: 256 N 256
           N
Sbjct: 288 N 288

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  276 bits (705), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 179/235 (76%), Gaps = 1/235 (0%)

Query: 26  AMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGTKDL 85
           ++++V GG RA+++ RL+GV+ ++  EGTHF  PWL+  IV+DVR KP+++A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 86  QMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 145
           QMV++T RVL RPDV QLPT+++ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 146 VSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVERAEQ 205
           VS  IRE L  R+++F + L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 206 ERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSNVTYL 260
           E+Q  V++A+GEA+SAE I             ++RL+ ++EIA  LS S N   L
Sbjct: 237 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIATILSSSPNKVIL 290

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  275 bits (704), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 133/231 (57%), Positives = 176/231 (76%), Gaps = 1/231 (0%)

Query: 26  AMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGTKDL 85
           A+++V GG RA+++ R+ GV  ++  EGTH L PW +  +V+DVR KP+++A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 86  QMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 145
           QMV++T RVL RPDV QLP IY+ LGLDYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 146 VSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVERAEQ 205
           VS  IRE L  R++ F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+RA Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 206 ERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           E+Q  V++A+G+A+SAE I             ++RL+ ++EIA+ LS+S N
Sbjct: 240 EKQGLVVKAQGDAKSAELIG-EAIRKSKDYVELKRLDTAREIAQILSRSPN 289

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  275 bits (703), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 178/231 (77%), Gaps = 1/231 (0%)

Query: 26  AMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGTKDL 85
           ++++V GG RA+I+ RL+GV+ ++  EGTHF  PW +  IV+DVR KP+++A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 86  QMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 145
           QMV++T RVL RP+V QLPT+++ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 146 VSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVERAEQ 205
           VS  IRE L  R+++F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 206 ERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           E+Q  V++A+GEA+SAE I             ++RL+ ++EIA  LSQS N
Sbjct: 237 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIATILSQSPN 286

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  273 bits (699), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 175/231 (75%), Gaps = 1/231 (0%)

Query: 26  AMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGTKDL 85
           A+++V GG RA+++ R+ GV  ++  EGTHF+ PWL+  IV+DVR KP+++A+ TGTKDL
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 86  QMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 145
           QMV++T RVL RPDV QLPT+Y+ LG DYD+RVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 146 VSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVERAEQ 205
           VS  IRE L  R++ F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 206 ERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           E+Q  V++A GEA+SAE I             ++RL+ +KEIA  L+ S N
Sbjct: 215 EKQGMVVKAVGEAKSAELIG-EAIKKSKDYVELKRLDTAKEIATILAASPN 264

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  274 bits (701), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 128/231 (55%), Positives = 178/231 (77%), Gaps = 1/231 (0%)

Query: 26  AMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGTKDL 85
           A+++V GG RA+++ R+ GV  ++  EGTHF+ PW++  +++DVR KP+++A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 86  QMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 145
           QMV++T RVL RP+V QLPTIY+ LG DYDERVLPSI NEVLKA+VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 146 VSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVERAEQ 205
           VS  IR+ L +R+ +F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 206 ERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           E+Q  V++A+GEA+SAE I             ++RL+ +K+IA  L++S N
Sbjct: 238 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAKDIADILAKSPN 287

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  272 bits (696), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 176/231 (76%), Gaps = 1/231 (0%)

Query: 26  AMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGTKDL 85
           ++++V GG RA+++ R+SGV  ++  EGTHF+ PW++  I++DVR KP+++A+ TGTKDL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 86  QMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 145
           QMV++T RVL RP+V+ LP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 146 VSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVERAEQ 205
           VS  IRE L  RS+ F I L+DVSIT MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 206 ERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           E+Q  V+RA+GEA+SAE I             ++RL+ ++EIA  L++S N
Sbjct: 239 EKQGMVVRAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIATILAKSPN 288

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  271 bits (694), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 177/231 (76%), Gaps = 1/231 (0%)

Query: 26  AMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGTKDL 85
           A+++V GG RA+++ R+ GV  ++  EGTH + PWL+  +V+DVR KP+++A+ TGTKDL
Sbjct: 59  ALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGTKDL 118

Query: 86  QMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 145
           QMV++T RVL RP+V+QLPTIY+ LG DY ERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQREK 178

Query: 146 VSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVERAEQ 205
           VS  IRE L  R++ F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 179 VSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 206 ERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           E+Q  V++A+GEA+SAE I             ++RL+ ++EIA+ L++S N
Sbjct: 239 EKQGMVVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIAQILARSPN 288

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  270 bits (691), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 126/231 (54%), Positives = 178/231 (77%), Gaps = 1/231 (0%)

Query: 26  AMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPKSIATNTGTKDL 85
           A+++V GG RA+++ R++GV+ ++  EGTHF+ PW++  +V+DVR KP+++++ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 86  QMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQFDAAELITQREI 145
           QMV++T RVL RP+V+ LP IY+ LG+DYDERVLPSI NEVLKA+VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 146 VSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAERAKFLVERAEQ 205
           VS  IRE L  R+  F I L+DVSIT+MTF  EFT +VE KQIAQQDA++A F+V++A Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 206 ERQAAVIRAEGEAESAEYISXXXXXXXXXXXXIRRLEASKEIAKTLSQSSN 256
           E+Q  +++A+GEA+SAE I             ++RL+ ++EIA  LS+S N
Sbjct: 238 EKQGMIVKAQGEAKSAELIG-EAIKKSKDYVELKRLDTAREIASILSRSPN 287

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 81  GTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAI 130
           G +   +  +  + L R D+   P +Y++L L+    VLP  GN +LK +
Sbjct: 274 GCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGNRILKEL 323

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,530,924
Number of extensions: 825465
Number of successful extensions: 2692
Number of sequences better than 10.0: 55
Number of HSP's gapped: 2748
Number of HSP's successfully gapped: 55
Length of query: 285
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 177
Effective length of database: 41,097,471
Effective search space: 7274252367
Effective search space used: 7274252367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)