Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D032803.493ON1841847631e-104
Kpol_1017.63.493ON1871876099e-81
TDEL0D056103.493ON1751844908e-63
YPR149W (NCE102)3.493ON1731844682e-59
Smik_16.4023.493ON1731844631e-58
ZYRO0D09966g3.493ON1781854613e-58
Skud_16.4443.493ON1731844552e-57
SAKL0F02750g3.493ON1701844387e-55
CAGL0L08448g3.493ON1731844361e-54
KNAG0A079503.493ON1821844371e-54
KNAG0B008003.493ON1821854343e-54
TBLA0C044903.493ON1861514301e-53
CAGL0I10494g3.493ON1721854212e-52
TBLA0D029603.493ON1891554197e-52
KAFR0C019703.493ON1791854152e-51
NDAI0G009303.493ON1761844119e-51
Suva_16.4783.493ON1661844091e-50
NDAI0B058803.493ON1821844083e-50
NCAS0F035603.493ON1831574032e-49
KLLA0D16280g3.493ON1691843985e-49
NCAS0E008003.493ON1741843971e-48
Suva_7.4193.493ON1741843926e-48
YGR131W (FHN1)3.493ON1741843797e-46
Smik_6.2273.493ON1741203543e-42
KLTH0F14850g3.493ON1711853404e-40
Skud_7.4423.493ON1741843292e-38
Kwal_55.212383.493ON1701843292e-38
AFR312W3.493ON1681463162e-36
KAFR0G037003.493ON1861203023e-34
Ecym_12363.493ON1691842858e-32
TPHA0H003008.155ON269871740.40
TDEL0E00100singletonON47471720.63
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D03280
         (184 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   298   e-104
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   239   9e-81
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   193   8e-63
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   184   2e-59
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   182   1e-58
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   182   3e-58
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   179   2e-57
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   173   7e-55
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   172   1e-54
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   172   1e-54
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   171   3e-54
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   170   1e-53
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   166   2e-52
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   166   7e-52
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   164   2e-51
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   162   9e-51
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   162   1e-50
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   161   3e-50
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   159   2e-49
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   157   5e-49
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   157   1e-48
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   155   6e-48
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   150   7e-46
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   140   3e-42
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   135   4e-40
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   131   2e-38
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   131   2e-38
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   126   2e-36
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   120   3e-34
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   114   8e-32
TPHA0H00300 Chr8 (53718..61814) [8097 bp, 2698 aa] {ON} Anc_8.15...    33   0.40 
TDEL0E00100 Chr5 (374..1798) [1425 bp, 474 aa] {ON}   probable p...    32   0.63 

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  298 bits (763), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 152/184 (82%), Positives = 152/184 (82%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
           IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            KLIMSSINLFTNGALGSMSF               SPQIGVPN
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 181 ISQV 184
           ISQV
Sbjct: 181 ISQV 184

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  239 bits (609), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 137/187 (73%), Gaps = 3/187 (1%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML LADNI+R +NFCFFVIC+GL+GSLLAT+  HSSRVNYC+FVPPFA+VTD+FYG LAN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
           IW+TP AWPIILF FDFLNFAFTFTAGTVL+VG RTHSC N++Y+D+N I QGSTDRCRK
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXX---XXXXXSPQIG 177
                            K++MS+INL +NGA+G  +                   SPQ+G
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 178 VPNISQV 184
           VPNISQV
Sbjct: 181 VPNISQV 187

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  193 bits (490), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 99/184 (53%), Positives = 115/184 (62%), Gaps = 9/184 (4%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML + DN LR VNF F VI LGLVG L+++++ HSSRVN+C+F   F +VTD+FYG LAN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
           IW    AWP+ILF  DFLNFAFTF+A T LAVG RTHSC NQ YLDSNNITQGST RCR 
Sbjct: 61  IWEV-FAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            K+IMS I + TNG   S +                S Q+GVP 
Sbjct: 120 AQASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRT--------TLTSRRRKSAQVGVPT 171

Query: 181 ISQV 184
           ISQV
Sbjct: 172 ISQV 175

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  184 bits (468), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 97/184 (52%), Positives = 116/184 (63%), Gaps = 11/184 (5%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML LADNILR +NF F VI +GL+ SLL TQ++HSSRVNYC+F   + + TD+ YG  AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
            +  PLAWP++LF  DFLNF FTFTAGTVLAVG R HSC N SY+DSN ITQGS  RCR+
Sbjct: 61  -FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            K +MS  N+ +NGA GS SF               + Q+GVP 
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSF----------SKRRRTGQVGVPT 169

Query: 181 ISQV 184
           ISQV
Sbjct: 170 ISQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  182 bits (463), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 115/184 (62%), Gaps = 11/184 (5%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML LADNILR +NF F VI + L+ SLL TQ++HSSRVNYC+F   + + TD+ YG  AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
            +  PLAWP++LF  DFLNF FTFTAGTVLAVG R HSC N SY+DSN ITQGS  RCR+
Sbjct: 61  -FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            K +MS  N+ +NGA GS SF               + Q+GVP 
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSF----------SKRRRTGQVGVPT 169

Query: 181 ISQV 184
           ISQV
Sbjct: 170 ISQV 173

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  182 bits (461), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 98/185 (52%), Positives = 117/185 (63%), Gaps = 8/185 (4%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQ-HSSRVNYCIFVPPFALVTDTFYGALA 59
           ML L DNILR VNFCFFVI LGLVG L+ ++   H+SRVN+C+F   F +V D+FYG LA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCR 119
           NI+  P A+P+ILF  DFLNF FTFTA T LAVG RTHSCTN+ YLDSN ITQGST RCR
Sbjct: 61  NIF-VPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCR 119

Query: 120 KXXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVP 179
           +                 K++MS ++L +NGA GS S                   +GVP
Sbjct: 120 EAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSS------GFSSRRRRTQQANVGVP 173

Query: 180 NISQV 184
            ISQV
Sbjct: 174 TISQV 178

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  179 bits (455), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 116/184 (63%), Gaps = 11/184 (5%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML  ADNILR +NF F VI +GL+ SLL TQ+++SSRVN+C+F   + + TD+ YG  AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
            +  PLAWP++LF  DFLNF FTFTAGTVLAVG R HSC N+SY+DSN ITQGS  RCR+
Sbjct: 61  FFE-PLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQ 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            K +MS  N+ +NGA GS SF               + Q+GVP 
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSF----------SKRRRTGQVGVPT 169

Query: 181 ISQV 184
           ISQV
Sbjct: 170 ISQV 173

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  173 bits (438), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 118/184 (64%), Gaps = 14/184 (7%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML + DN LR VNF F VI LGL GSL+ATQ++HS RVN+ IF   FALVTD+FY   AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
           ++S   AWPI+L  +DFLNF FTF+A T LAVG RTHSCTN+SYL SNNITQGSTDRCRK
Sbjct: 61  LFS-AFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            KL++S IN+F++GA GS S                   +GVP 
Sbjct: 120 AQATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSGS-------------GSRRANVGVPT 166

Query: 181 ISQV 184
           ISQV
Sbjct: 167 ISQV 170

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  172 bits (436), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 112/184 (60%), Gaps = 11/184 (5%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML + DN+LR VNF F VIC+GL+  L+AT+++HSSRVNYC+F   + + TD+ YG  AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
            +   LAWP+ILF  DFLNFAF  TAG VLAVG R HSC N  Y ++N I QGS  RCR+
Sbjct: 61  FFEI-LAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            K+IMS +N+F+NGA G+                  + ++GVP+
Sbjct: 120 SQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGT----------KFIRRRRNNAEVGVPS 169

Query: 181 ISQV 184
           +SQV
Sbjct: 170 VSQV 173

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  172 bits (437), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 90/184 (48%), Positives = 109/184 (59%), Gaps = 2/184 (1%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML LAD  LR VNF F VIC+GL+ +LL TQ+ HSSR+NYC+F   + + TD+FYG +AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
            W  PL+WP++L   DFLNF FT TAG VLAVG R HSC N +Y + N I QGS +RCR+
Sbjct: 61  FWE-PLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            K IMS +N+FTNG  GS                   PQ GVPN
Sbjct: 120 AQAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQ-GVPN 178

Query: 181 ISQV 184
           IS V
Sbjct: 179 ISTV 182

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  171 bits (434), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 110/185 (59%), Gaps = 4/185 (2%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           MLG+ADN+LR +NFCF VICL  + +L+ TQ  H SRVNYC+F   + + TD  YG LAN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
            W  PLAWP+ILF  DFLNFAFT TAG VLAVG R HSC N  Y + N+I QGS +RCR 
Sbjct: 61  FWE-PLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQI-GVP 179
                            K++MS INL +NGA  + S                 P+  GVP
Sbjct: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTAS--SKFGRRRRHGGGVGVPETSGVP 177

Query: 180 NISQV 184
           +ISQV
Sbjct: 178 SISQV 182

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  170 bits (430), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 81/151 (53%), Positives = 102/151 (67%), Gaps = 1/151 (0%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQ-HSSRVNYCIFVPPFALVTDTFYGALA 59
           ML    N+LR +NFCF VI  G++G L+ ++ + HS RVNYC+F  PFALVTD+FY   A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCR 119
           N W +P AWPI+L+ FDFLNF FTFTAGTVL+VG RTHSC N+ YL SN ITQGST+RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 120 KXXXXXXXXXXXXXXXXXKLIMSSINLFTNG 150
                             +L+ SS+ ++ NG
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENG 151

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  166 bits (421), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 111/185 (60%), Gaps = 14/185 (7%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML +ADN+LR VN  F +IC+GL  SL+ T+ +HSSRVN+C+F   + + TD+ YG  AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSN-NITQGSTDRCR 119
            +  PLAWP++LF  DFLNF FTFTAGTVLAVG R HSC N+ YL+    I QGS  RCR
Sbjct: 61  FFE-PLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119

Query: 120 KXXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVP 179
           +                 K+IMS +++ +NGA G+                    ++GVP
Sbjct: 120 QAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGA------------KLRRKHHTEVGVP 167

Query: 180 NISQV 184
           +ISQV
Sbjct: 168 SISQV 172

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  166 bits (419), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 83/155 (53%), Positives = 102/155 (65%), Gaps = 1/155 (0%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQN-QHSSRVNYCIFVPPFALVTDTFYGALA 59
           ML L DN+ R  NFCFFVI  G++G+LL T++  HSSRVNYC+F P + LV+D+FYG LA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCR 119
           N+   P A+P ILF FDFLNF FTFTAGTVLAVG RTHSCTN+ Y   N I QGS  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 120 KXXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGS 154
           +                 K++++ +  FT G LG 
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQ 155

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  164 bits (415), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 92/185 (49%), Positives = 109/185 (58%), Gaps = 7/185 (3%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQN-QHSSRVNYCIFVPPFALVTDTFYGALA 59
           MLG+ADNILR +N  F +I + L  +L+ TQN  H+SRVNYC+F   F L  D+ YG  A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCR 119
           N +   LAWP++LF  DFLNFAFTF+A T LAVG R HSC NQSYLDSN I +GS  RCR
Sbjct: 61  NFFQV-LAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCR 119

Query: 120 KXXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVP 179
           +                 K+IMS INLF NGA  S S                +   GVP
Sbjct: 120 EAQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGS-----SRFISRRKKHATDVGGVP 174

Query: 180 NISQV 184
           NISQV
Sbjct: 175 NISQV 179

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  162 bits (411), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 114/184 (61%), Gaps = 8/184 (4%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML +ADN+LR +N  F VIC+GL  +LL TQ  H+SR+NYC+F   + L+TD+F+G LAN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
            +   L++P ILF  DFLNF+FTF AGTVLA G R+HSC NQSYLD N ITQGS +RCR+
Sbjct: 61  FFEF-LSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            KL MS+I++  NGA  +                  + ++GVP+
Sbjct: 120 SQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSN-------TFTSRRRRRNGAAEVGVPS 172

Query: 181 ISQV 184
           ISQV
Sbjct: 173 ISQV 176

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  162 bits (409), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 110/184 (59%), Gaps = 18/184 (9%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML   DNILR +NF F VI +GL+ SLL TQ+ +SSR+NYC+F   +A+VTD+ YG  AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
            +  PLAWP+ILF  DFLNF FTFTA        R HSC NQ+YL SN+ITQGS +RCR+
Sbjct: 61  FFE-PLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCRE 112

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            K +MS  N+ +NGA GS SF               + Q+GVP 
Sbjct: 113 AQAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSF----------SKRRRTGQVGVPT 162

Query: 181 ISQV 184
           ISQV
Sbjct: 163 ISQV 166

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  161 bits (408), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 82/184 (44%), Positives = 111/184 (60%), Gaps = 2/184 (1%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML   DNILR +N  F V+ +  + +LL TQ  +SSR+N+C+F   F L+TD+F+G   N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
           ++    +WPI+LF FDFLNF FTFTAGTVLAV  R HSC N+ Y++SN+ITQGS +RCR 
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            K+IMS IN+ +NG  GS ++               + ++GVP 
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTW--AGSRSKRRTNRSGANEVGVPT 178

Query: 181 ISQV 184
           ISQV
Sbjct: 179 ISQV 182

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  159 bits (403), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 100/157 (63%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML   DN LR  N  F V+ +  + +LL+TQN  SSRVNYC+F   F L+TD+F+G  AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
           +     +WPIILF FDFLNF FTFTAGTVLAVG R HSC N+ YL+SN I QGS  RCR 
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSF 157
                            K+IMS+I++ +NGA GS SF
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSF 157

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  157 bits (398), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 105/184 (57%), Gaps = 15/184 (8%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML + DN LRGVNF F +I LGLVG+L+ATQ+  SSRVN+ IF   F +V D+ Y  +AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
             S  LAWPIIL   DFLN+ FTF+A T LAVG R  SCTN S+   N I +GS DRCRK
Sbjct: 61  FIS-ALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            K I+S +N  T+GA G+ S                  Q+GVP 
Sbjct: 120 AQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSS--------------NRKTQVGVPT 165

Query: 181 ISQV 184
           ISQV
Sbjct: 166 ISQV 169

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  157 bits (397), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 109/184 (59%), Gaps = 10/184 (5%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           MLG+ADN+LR +N  F VIC+GL  +LL T+  ++SR+NYC+F   + L TD+ YG  AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
            +   LA P + FC DFLNFAFTF AGTVLA G R HSC ++ Y++SN ITQG  +RCR+
Sbjct: 61  FFDI-LALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            KLIMS+IN+  NGA                     + +IGVP+
Sbjct: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQ---------HIGRRRRRNAAEIGVPS 170

Query: 181 ISQV 184
           ISQV
Sbjct: 171 ISQV 174

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  155 bits (392), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 79/184 (42%), Positives = 110/184 (59%), Gaps = 10/184 (5%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML +ADNI+R +N  F +I +GLV  L+++Q +HSSRVN+C+F   + L+TD+FYG LAN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
           +WS+ L +P+I+F  DFLNF FTF AGT LAVG R HSC+N++YLD+N ITQGS  RC +
Sbjct: 61  LWSS-LTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            K+++S         + +M                   Q+G+P 
Sbjct: 120 AKAAVVFFYFSCILFLIKVVVS---------IAAMVQNGGFGFGNSFGRRRARRQMGIPT 170

Query: 181 ISQV 184
           ISQV
Sbjct: 171 ISQV 174

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  150 bits (379), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 77/184 (41%), Positives = 104/184 (56%), Gaps = 10/184 (5%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML  ADN++R +N  F +I +GL+  L+ TQ +HSSRVN+C+F   + LVTD+ YG LAN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
            W T L +P IL   DFLNF FTF A T LAVG R HSC N++YL+ N I QGS+ RC +
Sbjct: 61  FW-TSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            K+ ++++ +  NG  GS +                  Q+G+P 
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNT---------GFSRRRARRQMGIPT 170

Query: 181 ISQV 184
           ISQV
Sbjct: 171 ISQV 174

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  140 bits (354), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 84/120 (70%), Gaps = 1/120 (0%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML  ADN++R +N  F +I +GL+  L++TQ +HSSRVN+C+F   + LVTD+ YG LAN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
            WS+ L +P IL   D LNF FTF A T LAVG R HSC N++YL+ N ITQ S+ RC +
Sbjct: 61  FWSS-LTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  135 bits (340), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 88/185 (47%), Positives = 106/185 (57%), Gaps = 15/185 (8%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSS-RVNYCIFVPPFALVTDTFYGALA 59
           ML + DN LR +NF F VI LGL GSL AT   H++ +VN+ IF   F L+ D+ Y   A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCR 119
           N  S  LAWP+++  FDFLNF FTF A T LAV  RTHSCTNQ YLDSN +TQGSTDRCR
Sbjct: 61  NFVSA-LAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCR 119

Query: 120 KXXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVP 179
           K                 KL +S +NL + GA G+ S                +  +GVP
Sbjct: 120 KAQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGS-------------SRRTGNVGVP 166

Query: 180 NISQV 184
            ISQV
Sbjct: 167 TISQV 171

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  131 bits (329), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 103/184 (55%), Gaps = 10/184 (5%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML  ADN++R V+  F +I +GL+G L+ TQ   SSRVN+C+F   + L+TD+FYG LAN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
            WS+ L +P IL   DFLNF FTF A T LAVG R HSC N++YL+ NNITQGS+ RC +
Sbjct: 61  FWSS-LTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            K+ +S   +  NG  G                     Q+GVP 
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFG---------FNTGYGRRRARRQMGVPT 170

Query: 181 ISQV 184
           ISQV
Sbjct: 171 ISQV 174

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  131 bits (329), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 104/184 (56%), Gaps = 14/184 (7%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML + DN LR  NF F +I LGL GSL AT++ ++ +VN+ +F   F L+ DT Y   AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
             S  LAWP+++  FDFLNF FTF A T LAV  R HSCTN  Y+D+N +TQGS+DRCRK
Sbjct: 61  FISA-LAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRK 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            KL +S +N+F+ GA  + S                S  +GVP 
Sbjct: 120 AQASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSS-------------GRKSANVGVPT 166

Query: 181 ISQV 184
           ISQV
Sbjct: 167 ISQV 170

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  126 bits (316), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 81/146 (55%), Gaps = 1/146 (0%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML + DN LR VNF F +I LGL GSL+  Q    SRVN+ +F   FALVTD+FY  +AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
             S   AWPII    D LN  FTF A T L      HSC+N+ +LD N I++ STDRCRK
Sbjct: 61  FIS-AFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINL 146
                            K + S +N+
Sbjct: 120 VQASSTFLFFSFFIFLAKAVFSGLNI 145

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  120 bits (302), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 85/120 (70%), Gaps = 2/120 (1%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQH-SSRVNYCIFVPPFALVTDTFYGALA 59
           ML +ADN LR VNFCF VI +  +  LL T+  H S+RVNYC+F   F ++TD+ YG  A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCR 119
           N +   LAWPIILF FDFLNF F FTAGTVLAVG R H+C N++Y +SN I +GS  RCR
Sbjct: 61  NFFE-QLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  114 bits (285), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 91/184 (49%), Gaps = 15/184 (8%)

Query: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60
           ML + DN LR  NF F +I L L GSL+  QN+  SRVN+ +F   FAL+ D+ Y  LAN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120
             S  LAWPI+L   D LN  FTF A T L      HSC+N  +L  N+I++G   RCRK
Sbjct: 61  FIS-ALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRK 119

Query: 121 XXXXXXXXXXXXXXXXXKLIMSSINLFTNGALGSMSFXXXXXXXXXXXXXXXSPQIGVPN 180
                            K ++S +N+ + GA  S S                    GVP 
Sbjct: 120 VQASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGS--------------GRKTGGGVPT 165

Query: 181 ISQV 184
           ISQV
Sbjct: 166 ISQV 169

>TPHA0H00300 Chr8 (53718..61814) [8097 bp, 2698 aa] {ON} Anc_8.155
           YGL195W
          Length = 2698

 Score = 33.1 bits (74), Expect = 0.40,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 31  QNQHSSRVNYCIFVPPFALVTDTFYGAL--ANIWSTPLAWPIILFCFDFLNFAFTFTAGT 88
           QNQH  R+ YC        +T+ F   +   +I S  L+  + +   D+ + + + T GT
Sbjct: 184 QNQHRRRIRYCSLQSTTKTLTECFKSKIFSNDIASERLSLMLEVLISDYTSLSLSST-GT 242

Query: 89  VLAVGTRTHSC 99
           +  +G+ T SC
Sbjct: 243 IFLLGSITKSC 253

>TDEL0E00100 Chr5 (374..1798) [1425 bp, 474 aa] {ON}   probable
           pseudogene; NNN added at 2 sites to avoid internal stop
           codons
          Length = 474

 Score = 32.3 bits (72), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 2/71 (2%)

Query: 47  FALVTDTFYGALANIWS--TPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSY 104
           F  +TD+     +NI++  +P  +P     F    F F FT+  +L +  +  +CT Q+ 
Sbjct: 302 FQYLTDSGLATKSNIFNFRSPPFFPAYCCVFHAFLFQFLFTSSELLKISDKEEACTRQTS 361

Query: 105 LDSNNITQGST 115
           +  N  + G+T
Sbjct: 362 ISRNLSSLGTT 372

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.139    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,193,696
Number of extensions: 523304
Number of successful extensions: 1509
Number of sequences better than 10.0: 35
Number of HSP's gapped: 1457
Number of HSP's successfully gapped: 35
Length of query: 184
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 81
Effective length of database: 41,670,801
Effective search space: 3375334881
Effective search space used: 3375334881
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 62 (28.5 bits)