Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D032703.491ON38838815240.0
Kpol_1017.73.491ON3783969251e-122
Skud_16.4433.491ON4204247371e-93
ZYRO0D10010g3.491ON3824097201e-91
KLTH0F14806g3.491ON3584036945e-88
Kwal_55.212273.491ON3764036931e-87
SAKL0F02794g3.491ON3974246584e-82
KLLA0E04621g3.491ON3894096505e-81
Ecym_12383.491ON3934195862e-71
Suva_16.4773.491ON4232705552e-66
Smik_16.4013.491ON4272785518e-66
TDEL0D055903.491ON3442765395e-65
YPR148C3.491ON4352815387e-64
NDAI0B058503.491ON4732995303e-62
NCAS0F035403.491ON4442675283e-62
TBLA0D029803.491ON4432855152e-60
KAFR0G036803.491ON4152664976e-58
KNAG0A079303.491ON4522774641e-52
AFR309C3.491ON3642804343e-49
CAGL0L08492g3.491ON3852664232e-47
SAKL0F08162g7.221ON3302541912e-15
KLTH0A03894g7.221ON3232641894e-15
TDEL0H022407.221ON3382391886e-15
KLLA0E04511g7.221ON3022561797e-14
ADL115W7.221ON3332451781e-13
KAFR0I019507.221ON3302671771e-13
Ecym_43777.221ON3332451735e-13
Kpol_1070.197.221ON3112511701e-12
CAGL0L00891g7.221ON3412601664e-12
Skud_9.1287.221ON3292041655e-12
YIL041W (GVP36)7.221ON3262351655e-12
Smik_9.1507.221ON3262351621e-11
ZYRO0D16522g7.221ON3582081621e-11
KNAG0D017607.221ON3422621593e-11
Suva_9.1597.221ON3252041575e-11
NDAI0A026607.221ON3642351551e-10
TPHA0B027507.221ON3632131532e-10
Kwal_47.181487.221ON3231051461e-09
TPHA0C012307.221ON3052581451e-09
Kpol_478.227.221ON3502471452e-09
NCAS0A133807.221ON329951424e-09
TBLA0D042007.221ON3312131362e-08
TBLA0B015807.221ON386611265e-07
NCAS0H022905.477ON86365722.6
KAFR0B031308.704ON84447695.8
NDAI0D044304.232ON80359686.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D03270
         (388 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   591   0.0  
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   360   e-122
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   288   1e-93
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   281   1e-91
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   271   5e-88
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   271   1e-87
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   258   4e-82
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   254   5e-81
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   230   2e-71
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   218   2e-66
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   216   8e-66
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   212   5e-65
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   211   7e-64
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   208   3e-62
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   207   3e-62
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   202   2e-60
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   196   6e-58
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   183   1e-52
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   171   3e-49
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   167   2e-47
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    78   2e-15
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    77   4e-15
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    77   6e-15
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    74   7e-14
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    73   1e-13
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    73   1e-13
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    71   5e-13
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    70   1e-12
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    69   4e-12
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    68   5e-12
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    68   5e-12
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    67   1e-11
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    67   1e-11
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    66   3e-11
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    65   5e-11
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     64   1e-10
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    64   2e-10
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    61   1e-09
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    60   1e-09
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    60   2e-09
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    59   4e-09
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    57   2e-08
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    53   5e-07
NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {O...    32   2.6  
KAFR0B03130 Chr2 complement(649445..651979) [2535 bp, 844 aa] {O...    31   5.8  
NDAI0D04430 Chr4 (1040300..1042711) [2412 bp, 803 aa] {ON} Anc_4...    31   6.7  

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/388 (82%), Positives = 319/388 (82%)

Query: 1   MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQL 60
           MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQL
Sbjct: 1   MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQL 60

Query: 61  GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED 120
           GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED
Sbjct: 61  GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED 120

Query: 121 ETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKXXXXXXXXXXXXX 180
           ETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTK             
Sbjct: 121 ETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKDENPEAGAEEEVE 180

Query: 181 XXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQL 240
                    LVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQL
Sbjct: 181 ADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQL 240

Query: 241 RRNVENSRLKFDTMRYDVKLXXXXXXXXXXXXVSXXXXXXXXXXXXXXXXXXXXXXXXXX 300
           RRNVENSRLKFDTMRYDVKL            VS                          
Sbjct: 241 RRNVENSRLKFDTMRYDVKLKEAKAEQEEAKEVSTDKEIEKKESETKEPETKGTEEKEPE 300

Query: 301 XXXXXXXXXVKENEGENEDEDYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQ 360
                    VKENEGENEDEDYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQ
Sbjct: 301 TKDTEEKDPVKENEGENEDEDYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQ 360

Query: 361 NFQLVYYRQCVQEIENNLKTISDLEILS 388
           NFQLVYYRQCVQEIENNLKTISDLEILS
Sbjct: 361 NFQLVYYRQCVQEIENNLKTISDLEILS 388

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  360 bits (925), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 200/396 (50%), Positives = 250/396 (63%), Gaps = 30/396 (7%)

Query: 1   MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQL 60
           MFS FS+DKLTDSISNVALKTQEN TNA++++N N+E  LNDPNTKLSI++++R+IQE+L
Sbjct: 1   MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL 60

Query: 61  GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED 120
           GT++D+ SKLP  Y +LE+KTD++EK LKRLL VT T+ TEGYDYPPNLTES+SDWW  D
Sbjct: 61  GTINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTND 120

Query: 121 ETT-----------ENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKXX 169
           +              NK+FLPRSFAQA++ A  D+    +     IKL            
Sbjct: 121 DNVTNTDENDENIQSNKSFLPRSFAQAISNASFDAASNVNSVTNTIKLN----------- 169

Query: 170 XXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHL 229
                                  L K F++L N + NIDNGK EMD +IVNEFN KL+ L
Sbjct: 170 -------HKDDEEEEEDDEEWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDL 222

Query: 230 LEVEFKEVAQLRRNVENSRLKFDTMRYDVKLXXXXXXXXXXXXVSXXXXXXXXXXXXXXX 289
           +  EFK V QLR++VENSRLKFDTMRY++K+                             
Sbjct: 223 INTEFKNVHQLRKSVENSRLKFDTMRYELKIKEWKRTXXXMEAEDKSDVSKKGTSKKETP 282

Query: 290 XXXXXXXXXXXXXXXXXXXXVKENEGENEDEDYKLLEQLEDEFVSNTSSAVEKMEELTDS 349
                                 E   EN D D KLLE+LEDEFVSNT +AVEKMEELTD+
Sbjct: 283 KKEASKKETPKKEINKKEDITNEGNTEN-DNDNKLLEKLEDEFVSNTQNAVEKMEELTDN 341

Query: 350 AKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385
           +KI++LVKL+QNFQLVYY+QC+QEIE+NLK ++ LE
Sbjct: 342 SKIINLVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  288 bits (737), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 178/424 (41%), Positives = 233/424 (54%), Gaps = 49/424 (11%)

Query: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61
           FS FSL+K+TDSI+  A KTQ+   NA+   N N    LNDP T+LSI++R+R++QE LG
Sbjct: 5   FSGFSLNKITDSIATAAHKTQDTLNNALASANVN----LNDPETRLSIKSRTRFVQESLG 60

Query: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAEDE 121
           T+ D ISKLP QY  LE K+DS+EK+ +R+LLV+ TF  EGYDYPPNLTESISDWW+ ++
Sbjct: 61  TVSD-ISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNK 119

Query: 122 -------TTENKN----------FLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNT 164
                   +EN N          FLPRSFAQA++KA  D +      +++ K     K+ 
Sbjct: 120 DGWFGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKKSE 179

Query: 165 GTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNK 224
             +                      L+   K F + S  + NID GK EMD+ ++ EFNK
Sbjct: 180 SNETAQDAEAQEEDEEDEEDEDLSNLI---KVFDSWSTCYKNIDEGKAEMDSTMIKEFNK 236

Query: 225 KLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLXXXX--------------XXXXXX 270
           KLE L+  +FK+V +LR+ VE+SRLKFDTMRY+VK                         
Sbjct: 237 KLEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSAN 296

Query: 271 XXVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKENEGENEDEDYKLLEQLE- 329
             +S                                   VKE+   N+  D   +E LE 
Sbjct: 297 APISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQG-DEPTIEDLEE 355

Query: 330 --------DEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTI 381
                   DEFVSNT++AVE MEE+TDS+ IL LVKLFQNFQLVY+RQCVQE+E NLK +
Sbjct: 356 NKLLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVL 415

Query: 382 SDLE 385
           + LE
Sbjct: 416 NSLE 419

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  281 bits (720), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 172/409 (42%), Positives = 219/409 (53%), Gaps = 57/409 (13%)

Query: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61
           FS+FS   L DSI+N A +TQ+  +NA+ ++N      LNDP T+LSI+ R+RY++E LG
Sbjct: 5   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVN------LNDPQTRLSIKTRTRYLKETLG 58

Query: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA--- 118
            +D EISKLP QYV LE K+D++EK  KR+LLVT TF  EGYDYPPNL ES SDWW+   
Sbjct: 59  AVD-EISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSK 117

Query: 119 --------EDETTENK---------NFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSP 161
                   +DE  E+K           +PRSFAQA+AKA  +       ++++ K Q   
Sbjct: 118 EGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQID- 176

Query: 162 KNTGTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNE 221
                                        V L + F  LS  + NID GK+EMD  I  E
Sbjct: 177 ------------------------EDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIARE 212

Query: 222 FNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLXXXXXXXXXXXXVSXXXXXXX 281
           FN KLE LL  +FK++  LR  VENSRLKFDTMRY+++L             +       
Sbjct: 213 FNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLKEKEEKEENENTANADEGPSN 272

Query: 282 XXXXXXXXXXXXXXXXXXXXXXXXXXXXVKENEGENE-----DEDYKLLEQLEDEFVSNT 336
                                        K      E      ED KLLEQLEDEFVSNT
Sbjct: 273 KNQQEPTNEPAKEEEKPTPAEPAEAQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNT 332

Query: 337 SSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385
           S AVE M  + + ++IL L+KLFQN QLVYYRQCVQE+E +LK ++DLE
Sbjct: 333 SEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLE 381

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  271 bits (694), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 160/403 (39%), Positives = 222/403 (55%), Gaps = 72/403 (17%)

Query: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61
           F  FSL+KLT+SI+NVA KTQ+  + AI ++       L+DP  KLS++AR  Y+QE LG
Sbjct: 5   FGGFSLNKLTNSITNVAHKTQDTLSTAIANIQ------LDDPQAKLSLKARKHYLQETLG 58

Query: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED- 120
           T++D ISKLP QY  LE K DS+EK+ +R+L+VT T+  EGYDYPPNL+ES+SDWW+ + 
Sbjct: 59  TIED-ISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNK 117

Query: 121 ----------------ETTENKN--FLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPK 162
                           E  E+     +PRSFAQA++KA  DS       E    L+T  +
Sbjct: 118 EGLFGFVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDS------GEVMTALKTEEQ 171

Query: 163 NTGTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEF 222
               +                      + +L K F+A S    N+D  K EMD ++V EF
Sbjct: 172 KASAEEDEEDED---------------ITSLIKMFEAWSACQHNMDQSKAEMDALMVKEF 216

Query: 223 NKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLXXXXXXXXXXXXVSXXXXXXXX 282
           N KL   +E +FK    LR+ VE+SRLKFDTMRY++K+             +        
Sbjct: 217 NHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRYELKMAEEQGKTEEAAQQTESQKPQED 276

Query: 283 XXXXXXXXXXXXXXXXXXXXXXXXXXXVKENEGENEDEDYKLLEQLEDEFVSNTSSAVEK 342
                                          + ++ DE  KLLE+LEDEFVSNT+ AVE 
Sbjct: 277 EAEAS-------------------------KDSDSSDEAQKLLEKLEDEFVSNTTEAVET 311

Query: 343 MEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385
           M E+TDSA+I++LVKLF NFQL+YY+QCVQ +E ++ ++++LE
Sbjct: 312 MGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELE 354

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  271 bits (693), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 165/403 (40%), Positives = 222/403 (55%), Gaps = 54/403 (13%)

Query: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61
           F  FS +KLTD+++N A KTQ+  + AI ++       L+DP   LS++AR  Y+QE LG
Sbjct: 5   FGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQ------LDDPQAILSLKARKHYLQETLG 58

Query: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAEDE 121
           T++D ISKLP QY  LE K DS+EK  +R+L+VT TF  EGYDYPPNL+ES+SDWW+ ++
Sbjct: 59  TIED-ISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNK 117

Query: 122 -------TTENKN------------FLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPK 162
                  ++  K+             +PRSFAQA+AKA  DS  +   A ++ + Q S  
Sbjct: 118 EGLFGLMSSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVL-AALKDQEQQASAD 176

Query: 163 NTGTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEF 222
                                      +  L K F A S     ID GK EMD ++  EF
Sbjct: 177 EE--------------------DEDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEF 216

Query: 223 NKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLXXXXXXXXXXXXVSXXXXXXXX 282
           N+KL  L+E +FK  + LRR VE+SRLKFDTMRY+VKL             +        
Sbjct: 217 NQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRYEVKLTEQQSKQ------AMENEKAQF 270

Query: 283 XXXXXXXXXXXXXXXXXXXXXXXXXXXVKENEGENEDEDYKLLEQLEDEFVSNTSSAVEK 342
                                       KE +  N D   +LLE+LEDEFVSNT+ AVE 
Sbjct: 271 KESDLSSKEEGADANETSNEVGKSVTKTKEEQATN-DAAQELLEKLEDEFVSNTTEAVET 329

Query: 343 MEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385
           M E+TDSA++L+LVKLF NFQLVY+RQCVQ++E +L T+++LE
Sbjct: 330 MGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASLSTLNELE 372

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  258 bits (658), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 166/424 (39%), Positives = 218/424 (51%), Gaps = 73/424 (17%)

Query: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61
           FS+FSLDKLT+SIS+ A KTQ+  + AI ++       L+DP  KLS++ R  Y+QE LG
Sbjct: 5   FSSFSLDKLTNSISSAAHKTQDKLSTAIANIQ------LDDPQAKLSLKVRKHYLQETLG 58

Query: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA--- 118
            +DD ISKLP QY  LE K DS+EKI +R+L+VT TF  EGYDYPPNL+ESISDWW    
Sbjct: 59  AIDD-ISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANR 117

Query: 119 ------------------EDETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIK-LQT 159
                              +E  EN+ FLPRSFAQAL+KA  DS  +     R +K  Q 
Sbjct: 118 SGLLSFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVL----RTLKDEQK 173

Query: 160 SPKNTGTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIV 219
            P                            L+T+   F+A S     ID  K EMD+++ 
Sbjct: 174 EPPQD--------------EDEDEDEDINSLITM---FEAWSKCEQKIDQEKAEMDSLMA 216

Query: 220 NEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLXXXXXXXXXXXXVSXXXXX 279
            EFNKKL+ L+  +FK+V  LR+ VE SRLKFDT+RY++ L                   
Sbjct: 217 KEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRYELNL-----KEKEQQKAKAKEEE 271

Query: 280 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKENEGENEDEDYKLLEQLE---------- 329
                                         +K +E  +ED   K+ E +E          
Sbjct: 272 NEKVDVVEQNAPEEKAKTEGQETSEGKEHDLKADEKLSEDTASKIPESVENEEVDNEDPE 331

Query: 330 --------DEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTI 381
                   DEFVS+T+ AVE M E+TDS++IL LVKLF  FQL+Y+RQCVQE+E + K +
Sbjct: 332 HKLLEKLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKIL 391

Query: 382 SDLE 385
             L+
Sbjct: 392 DGLD 395

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  254 bits (650), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 161/409 (39%), Positives = 219/409 (53%), Gaps = 48/409 (11%)

Query: 1   MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQL 60
           MFS  SL+ +TDSISN A +TQE F++AI  ++      L+DP T+LSI  R   +QE L
Sbjct: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIH------LDDPETRLSILKRRHQLQETL 54

Query: 61  GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED 120
           GT+ D IS+LP QY  LE K+D++EKI KRLLLVT TF  EGYDYPPNLTES +DWW+ +
Sbjct: 55  GTVHD-ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGN 113

Query: 121 -------------------ETTENKNFLPRSFAQALAKAYSDSKLITD--KAERNIKLQT 159
                              ET EN   LPRSFAQAL+KA +DS LI    KAE     Q 
Sbjct: 114 KDSIFSFSKKKAEVSPEVKETAEN-GLLPRSFAQALSKAATDSALILKQLKAEETRTNQE 172

Query: 160 SPKNTGTKXXXXXXXXXXX---XXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDT 216
             +    +                         +  L KAF++ +    +ID  K EMD+
Sbjct: 173 ESQEGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDS 232

Query: 217 MIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLXXXXXXXXXXXXVSXX 276
           ++V EFN KL  L+E +FK+  +LR  V+++RL FDT+R+++KL             +  
Sbjct: 233 LMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKLKLQEKEVVASSEEAEK 292

Query: 277 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKENEGENEDEDYKLLEQLEDEFVSNT 336
                                                    ED D KL E+LED+FVS T
Sbjct: 293 KVATETPETPEKKTNEEPVDMAKT----------------EEDPDSKLFERLEDQFVSAT 336

Query: 337 SSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385
           S  VE + ELTDS++I+ LVKLF NFQL++Y+QCV+ +E +L+ ++ L+
Sbjct: 337 SETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLD 385

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  230 bits (586), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 149/419 (35%), Positives = 212/419 (50%), Gaps = 70/419 (16%)

Query: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETI-LNDPNTKLSIRARSRYIQEQL 60
           FSNFSLDK+  +I+  A KTQ+        L + I +I L+DP T LS+R R   +QE L
Sbjct: 5   FSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETL 64

Query: 61  GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED 120
           GT+ D ISKLP +Y  LE K D+ EK+  R+L+V+ TF  +GYDYPPNL ESISDWW   
Sbjct: 65  GTIKD-ISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGSS 123

Query: 121 ---------------------------ETTENKNFLPRSFAQALAKAYSDSKLITDKAER 153
                                      E   N+ ++P SFAQA++KA  DS  IT   E 
Sbjct: 124 SKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDS--ITILKEL 181

Query: 154 NIKLQTSPKNTGTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNE 213
           N +   +P N                          + +L    +A + + +NID  K +
Sbjct: 182 NEEQLVNPSNGA------------------ETEDEDVDSLMPILEAWAEAQSNIDEAKQQ 223

Query: 214 MDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLXXXXXXXXXXXXV 273
           MD  ++NEFNKKL+ L+  +F +V  LR+ VE SRLKFDT+RY++++             
Sbjct: 224 MDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFT 283

Query: 274 SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKENEG-----ENEDEDYK-LLEQ 327
           +                                   +  N G     + ED+ ++ LLE+
Sbjct: 284 T---------------IESQQVNDKDKENEDNLKPTIHNNTGIGSSSDEEDQKFRLLLEK 328

Query: 328 LEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLEI 386
            EDEFVSNT+ AV  M ++TDS  +  LVKLF NFQL+Y+++CVQE++ +L  I+ L +
Sbjct: 329 AEDEFVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTLTV 387

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  218 bits (555), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 162/270 (60%), Gaps = 23/270 (8%)

Query: 8   DKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLGTLDDEI 67
           +K+TDSI+  A KTQ+   +A+ + N N    LNDP T+LSI++R+R++QE LGT+ D I
Sbjct: 6   NKITDSIATAAHKTQDTLNSALANANVN----LNDPQTRLSIKSRTRFVQESLGTVSD-I 60

Query: 68  SKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA--------- 118
           SKLP QY  LE K+DS+EK+ KR+LLV+ TF  EGYDYPPNLTESISDWW+         
Sbjct: 61  SKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFGS 120

Query: 119 --------EDETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTK-XX 169
                   + ++  +  FLPRSFAQA++KA  D +      E+N K     K    K   
Sbjct: 121 KKTEHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQKKEAKKTTQ 180

Query: 170 XXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHL 229
                               L  L K F + S  + NID GK EMD+M+V EFNKKLE L
Sbjct: 181 ETAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLEKL 240

Query: 230 LEVEFKEVAQLRRNVENSRLKFDTMRYDVK 259
           +  +FK+V +LRR VE SRLKFDTMRY+ K
Sbjct: 241 INEDFKKVHELRRKVEESRLKFDTMRYEGK 270

 Score =  100 bits (250), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 59/66 (89%)

Query: 320 EDYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLK 379
           E+ KLLE+LEDEFVSNT++AVE MEE+TDS++IL LVKLFQNFQLVY+RQC QE+E NLK
Sbjct: 357 EENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLK 416

Query: 380 TISDLE 385
            ++ +E
Sbjct: 417 VLNGME 422

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  216 bits (551), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 132/278 (47%), Positives = 166/278 (59%), Gaps = 25/278 (8%)

Query: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61
           FS+FSL+K+TDSI+  A KT +   NA+     N    LNDP T+LSI++R+R++QE LG
Sbjct: 5   FSSFSLNKITDSIATAAHKTHDTLNNALA----NANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA--- 118
           T+ D ISKLP QY  LE K+DS+EK+ KR+LLV+ TF  EGYDYPPNLTESISDWW+   
Sbjct: 61  TISD-ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNK 119

Query: 119 -------EDETTENKN-------FLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNT 164
                  + E T  K        FLPRSFAQA++KA  D +      E + K +   K  
Sbjct: 120 DGWFGSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKKRE 179

Query: 165 GTKXXXXXXXX---XXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNE 221
            TK                         L  L K F + S  + NID GK EMD+M+V E
Sbjct: 180 STKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMMVKE 239

Query: 222 FNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVK 259
           FNKKLE L+  +FK V +LR+ VE SRLKFDTMRY+VK
Sbjct: 240 FNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVK 277

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 48/68 (70%), Positives = 60/68 (88%)

Query: 318 EDEDYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENN 377
           E E+ KLLE+LEDEFVSNT++AVE MEE+ DS++IL L+KLFQNFQLVY+RQCVQE+E N
Sbjct: 359 ESEENKLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEAN 418

Query: 378 LKTISDLE 385
           LK ++ LE
Sbjct: 419 LKVLNGLE 426

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  212 bits (539), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 120/276 (43%), Positives = 166/276 (60%), Gaps = 53/276 (19%)

Query: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61
            SNFSL+K+TD+++N A KTQ+   +AI +++        DP  KLS++AR+RY+QE LG
Sbjct: 5   LSNFSLNKITDTLANAAHKTQDTLNSAIANVS--------DPQAKLSLKARTRYLQETLG 56

Query: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA--- 118
           T+DD+ SKLP QY  LE K+D++EK  KR+LLVT TF  EGYDYPPNLTESISDWW+   
Sbjct: 57  TIDDK-SKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNK 115

Query: 119 -------EDETTENKN------FLPRSFAQALAKAYSDS-KLITDKAERNIKLQTSPKNT 164
                  + E T+N +      FLPRSF+QA++KA +D   + T+  E   + +      
Sbjct: 116 DGWFGTKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQEHGDEDEED---- 171

Query: 165 GTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNK 224
                                    +  + K F + S  + NID GK+EMD+MI  EFN 
Sbjct: 172 -----------------------EDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNT 208

Query: 225 KLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKL 260
           KLE ++  +FK+V   R+ VE SRLKFDT+RY++KL
Sbjct: 209 KLEKIINEDFKKVHASRKKVEESRLKFDTVRYEIKL 244

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 37/54 (68%), Positives = 46/54 (85%)

Query: 332 FVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385
           FVSNT++AVE M E+T+SA+IL L KLFQNFQLVY+RQCVQE+E +LK +  LE
Sbjct: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALE 340

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  211 bits (538), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 128/281 (45%), Positives = 163/281 (58%), Gaps = 28/281 (9%)

Query: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61
           FS FSL+K+TDSI+  A KTQ    + + +   N    LNDP T+LSI++R+R++QE LG
Sbjct: 5   FSGFSLNKITDSIATAAHKTQ----DTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA--- 118
           T+ D ISKLP QY  LE K+DS+EK+ KR+LLV+ TF  EGYDYPPNLTESISDWW+   
Sbjct: 61  TVSD-ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNK 119

Query: 119 --------------EDETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNT 164
                         +  +  +  FLPRSFAQA++KA  D +      E N K +   K  
Sbjct: 120 DGWFGSKKSESSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKKKE 179

Query: 165 GTKXXXXXXXXXXXX------XXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMI 218
             K                            L  L K F + S  + NID GK EMD+M+
Sbjct: 180 SIKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMM 239

Query: 219 VNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVK 259
           V EFNKKLE L+  +FK+V  LR+ VE SRLKFDTMRY+VK
Sbjct: 240 VKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVK 280

 Score =  107 bits (267), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 51/69 (73%), Positives = 62/69 (89%)

Query: 318 EDEDYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENN 377
           E ED KLLE+LEDEFVSNT++AVE MEE+TDS++IL L+KLFQNFQLVY+RQCVQE+E N
Sbjct: 367 ESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEAN 426

Query: 378 LKTISDLEI 386
           LK ++ LEI
Sbjct: 427 LKVLNGLEI 435

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  208 bits (530), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 130/299 (43%), Positives = 169/299 (56%), Gaps = 51/299 (17%)

Query: 1   MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQL 60
           MFS+FSLDK+T+SI N A K       A   LNN I T   DP TKLSI++++R  QEQL
Sbjct: 1   MFSSFSLDKITNSIGNAAQK-------ATNTLNNAINTA-TDPQTKLSIKSQTRLFQEQL 52

Query: 61  GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWW--- 117
           GT+ D ISKLP QY  LE+KTDS+EK +KR+LLV+ TF  EGYDYPPNLTES SDWW   
Sbjct: 53  GTIHD-ISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNIT 111

Query: 118 ---------------AEDETTENKN-----------------FLPRSFAQALAKAYSDSK 145
                           +   T+N +                 FLPRSFAQA++K+  D  
Sbjct: 112 KKSSSHRKKQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMD-- 169

Query: 146 LITDKAERNIKLQTSPKNTGTK----XXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKALS 201
             TD  ++    +T+ K T  K                          +  L KAF++ S
Sbjct: 170 -CTDIYQQLSIQETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWS 228

Query: 202 NSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKL 260
           N + NID GK+EMD+M+  EFN KLE L+  EFK+V  LR+ V +SRLKFDT+R+++K+
Sbjct: 229 NCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKI 287

 Score =  105 bits (262), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 68/80 (85%), Gaps = 5/80 (6%)

Query: 311 KENEGENEDE-----DYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLV 365
           KE++ E +DE     ++KLLEQLEDEFVS+T+SAVE M E+T+S+ I+ L+KLFQNFQLV
Sbjct: 392 KEDDAEKQDEQDDSEEHKLLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLV 451

Query: 366 YYRQCVQEIENNLKTISDLE 385
           YYRQCVQEIE NLKT+++L+
Sbjct: 452 YYRQCVQEIEANLKTLNELD 471

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  207 bits (528), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 117/267 (43%), Positives = 157/267 (58%), Gaps = 27/267 (10%)

Query: 1   MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQL 60
           MFSNFSLDK+T+S++  A KT +  +NAIT           DP TKLS+R++ R  QE +
Sbjct: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAIT--------TATDPATKLSLRSQKRLFQESI 52

Query: 61  GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA-- 118
           GT+ D IS LP+QY  LE +TD++EK L+R+L+V+ TF  EGYDYPPNL+ES SDWW+  
Sbjct: 53  GTVHD-ISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLS 111

Query: 119 -----EDETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKXXXXXX 173
                E E  + K FLPRSFAQA++ +  D   I               N G        
Sbjct: 112 SKKKKEQEKEDKKGFLPRSFAQAISNSAEDCVEIYQHV-----------NDGDDEDKEEN 160

Query: 174 XXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVE 233
                           +  L K F + +  + NID GK EMD+M++ EFN KLE LL  E
Sbjct: 161 ANNEEENEEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEE 220

Query: 234 FKEVAQLRRNVENSRLKFDTMRYDVKL 260
           FK+V  LR+ V++SRLKFDT+RY++K+
Sbjct: 221 FKKVHTLRKRVKDSRLKFDTVRYELKV 247

 Score =  111 bits (278), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 53/71 (74%), Positives = 66/71 (92%)

Query: 316 ENEDEDYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIE 375
           E++ E++KLLEQLED FVS+T+SAVE MEE+TDS++I+ LVKLFQNFQLVYYRQCVQEIE
Sbjct: 374 EDDSEEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIE 433

Query: 376 NNLKTISDLEI 386
            NLKT+++LEI
Sbjct: 434 ANLKTLNELEI 444

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  202 bits (515), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 122/285 (42%), Positives = 164/285 (57%), Gaps = 48/285 (16%)

Query: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61
           FSNFSLDKL DS+ + A KTQ+  +NAI ++N +     NDP T+L++ ++  Y+QE +G
Sbjct: 30  FSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNID----WNDPQTRLTLLSKQHYLQESIG 85

Query: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED- 120
            ++ EISKLP QY  LE KTD++EKI+KR+L+VTNTF  EGYDYPPNL+ESIS+WW  D 
Sbjct: 86  QIN-EISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDP 144

Query: 121 -------ETTENKN--------------------FLPRSFAQALAKAYSDSKLITDKAER 153
                  + T +KN                    FLPRSF  A++KA SDS  I      
Sbjct: 145 LAFLRDNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNLNN 204

Query: 154 NIKLQTSPKNTGTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNE 213
           N KL+ +   T  +                      +  L K F + S    NID  K +
Sbjct: 205 NEKLEFAKTKTEDE---------------EYEDDEDIQLLIKVFDSWSLCNKNIDKSKFQ 249

Query: 214 MDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDV 258
            D +I+ +FNKKL  LL+VEFK V  LR  V+++RLKFDTMRY++
Sbjct: 250 RDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRYEI 294

 Score =  104 bits (259), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 48/73 (65%), Positives = 66/73 (90%), Gaps = 2/73 (2%)

Query: 312 ENEGENEDEDYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCV 371
           +N+ +NEDE  KLLE LEDEFVS+TS+AVE MEE+T+S+KILDL+KLFQNFQL++Y+QC+
Sbjct: 370 KNDSQNEDE--KLLEHLEDEFVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCI 427

Query: 372 QEIENNLKTISDL 384
           +E+E N+K ++DL
Sbjct: 428 KEVETNMKLLTDL 440

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  196 bits (497), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 114/266 (42%), Positives = 157/266 (59%), Gaps = 28/266 (10%)

Query: 1   MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQL 60
           MFSNF+ DK+T+SIS  A   Q+   + I         +  D  TKL  +  +R+ QE++
Sbjct: 1   MFSNFNFDKITNSISTAAQSAQQKINDTI---------LTPDVQTKLHFKKTARFWQEKV 51

Query: 61  GTLDD-EISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAE 119
           G + D EISKLP+ Y+ LE K D++EKILKRLL+VT T+  EGYDYPPNL+ES++DWW  
Sbjct: 52  GQIPDKEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWWWS 111

Query: 120 D-----ETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKXXXXXXX 174
           D     +  E  +F+  SF  A++KA  DSK I D  +   K Q  PK            
Sbjct: 112 DLKKSKKHQEKSSFMNNSFPMAISKAAFDSKSILDDLKE--KQQDLPKEGEE-------- 161

Query: 175 XXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEF 234
                           + L + F +LSN + NID  K EMD MIV EFN KLEHL+  +F
Sbjct: 162 ---PEEEVEEEDDDEFLNLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDF 218

Query: 235 KEVAQLRRNVENSRLKFDTMRYDVKL 260
           K+V++LR  V++SRL+FDT+R+++KL
Sbjct: 219 KKVSKLRTKVQDSRLEFDTLRHEIKL 244

 Score =  101 bits (252), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 50/77 (64%), Positives = 65/77 (84%), Gaps = 1/77 (1%)

Query: 310 VKEN-EGENEDEDYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYR 368
           VK N   E E E+YKLLE+LEDEFVSNT +AVE M ELT+++++++LVKLFQNFQL++Y+
Sbjct: 339 VKHNGSSEEETEEYKLLEKLEDEFVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYK 398

Query: 369 QCVQEIENNLKTISDLE 385
           QCVQEIENN+K +  LE
Sbjct: 399 QCVQEIENNMKFLDQLE 415

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  183 bits (464), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 111/277 (40%), Positives = 154/277 (55%), Gaps = 34/277 (12%)

Query: 1   MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQL 60
           MFSNFSLDKLT +I+N A   Q+   N I         +  D  TKL     +RY QE++
Sbjct: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTI---------LSPDAQTKLQFLKTTRYFQEKV 51

Query: 61  GTL-DDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAE 119
           GT+ +DEI+KLP+ Y  L+ K++++EK+LKRLL+VT TF  EGYDYPPN+TES++ WW E
Sbjct: 52  GTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNE 111

Query: 120 DETTENK-------NFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNT-------- 164
           DE  + K       + L RSFA A+ KA  DS+ I      ++K Q   + T        
Sbjct: 112 DENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYILS----DLKEQQKTRGTEEKKVKRE 167

Query: 165 -----GTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIV 219
                  +                      +  +  AF   SN + NID  K EMD+MIV
Sbjct: 168 EEAEAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQSKAEMDSMIV 227

Query: 220 NEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRY 256
            EFN+KL  +LE++FK V +L   V++SRL+FDT+R+
Sbjct: 228 KEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 51/59 (86%)

Query: 330 DEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLEILS 388
           DEFVSN ++AVEKM ELTDS++++ LVKLFQN QLV+YRQCVQE+E ++K++ +LE  S
Sbjct: 391 DEFVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAES 449

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  171 bits (434), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 105/280 (37%), Positives = 150/280 (53%), Gaps = 48/280 (17%)

Query: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETI-LNDPNTKLSIRARSRYIQEQL 60
           F   SLDKL ++++N A KTQ+  +     L + I+ I ++DP T LS++ R R +QE L
Sbjct: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64

Query: 61  GTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED 120
           G+  D IS+LP QY  LE K D++E++ K++L+V+ TF  EGYDYPPN TESISDWW  +
Sbjct: 65  GSAKD-ISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW--N 121

Query: 121 ETTENKNFL-----------------------PRSFAQALAKAYSDSKLITDKAERNIKL 157
            +T+   FL                       P SFA AL +A   S+ I  + +   + 
Sbjct: 122 TSTKETRFLKFGKGGTDKQKEDKQKQAAGSSDPPSFAHALHRAAKGSQGIIQELKEQAEE 181

Query: 158 QTSPKNTGTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTM 217
           +                               + +L K F   +++  N+D  K EMD  
Sbjct: 182 EQE---------------------QEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQF 220

Query: 218 IVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYD 257
           +V EFN+KL+HLLEVEFK+   LRR VE SRL FDT++Y+
Sbjct: 221 MVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYE 260

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 50/64 (78%)

Query: 322 YKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTI 381
           Y  LE  EDEFVSNT+ AVE M  + D+ K++ LVKLFQNFQLVY+R+CVQE+E +L ++
Sbjct: 298 YAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQELEVSLNSL 357

Query: 382 SDLE 385
           + LE
Sbjct: 358 TSLE 361

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  167 bits (423), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 140/266 (52%), Gaps = 59/266 (22%)

Query: 23  ENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLGTLDDEISKLPQQYVELEIKTD 82
           E+ T +I++   ++    NDP TKLSI+A++R++QE +G   D ISKLP QYV LE K D
Sbjct: 7   ESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERD-ISKLPPQYVVLEKKCD 65

Query: 83  SVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAEDE----TTENKNFLPR------- 131
           S+EK+LKR+L+VT T+  EGYDYPPN++ES+S WW   E    +   KN +P+       
Sbjct: 66  SIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA 125

Query: 132 -------------------SFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKXXXXX 172
                              SFA A+A+A  DS+LI +  E   + +              
Sbjct: 126 GTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFESIETKDEDEKE------------ 173

Query: 173 XXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEV 232
                            +  L K FK  S+ F  I + K EMD M++ EFN KLE  L+ 
Sbjct: 174 ----------------DIDELVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQK 217

Query: 233 EFKEVAQLRRNVENSRLKFDTMRYDV 258
            F+++  LR  VE SRL FDTMRY+V
Sbjct: 218 NFQKIHTLRAKVEESRLNFDTMRYEV 243

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 34/59 (57%), Positives = 49/59 (83%)

Query: 321 DYKLLEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLK 379
           D +LLEQLEDEFVSNT+ AVE M E+++++++L L+KLFQ FQL Y++ CV+ +E +LK
Sbjct: 320 DGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLK 378

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/254 (27%), Positives = 113/254 (44%), Gaps = 21/254 (8%)

Query: 4   NFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARS--RYIQEQLG 61
           N    +L+ S+S  A + Q        DL+  +     D  T L   A+S  R +QE+LG
Sbjct: 11  NKKFQELSTSVSQKAQEAQ--LDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQRLVQERLG 68

Query: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAEDE 121
            + D IS+LPQ+Y+ELE + D +  + +  L VT  +  E YDYP N+ +S++++    +
Sbjct: 69  QVTD-ISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVNEF---SK 124

Query: 122 TTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKXXXXXXXXXXXXXX 181
           T  +K          L+ A S     TD+A+ NI +   P                    
Sbjct: 125 TVSSK-------LHELSHASS-----TDEAQ-NILISPGPAKDPKTLNYALSKVALTSSE 171

Query: 182 XXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLR 241
                     T+  A    S+    I   + + DT+I  +FNKKL   L  +  +  + R
Sbjct: 172 YLSKSGHEDETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKAR 231

Query: 242 RNVENSRLKFDTMR 255
           + VEN RL++D  R
Sbjct: 232 KEVENKRLQYDIAR 245

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 116/264 (43%), Gaps = 30/264 (11%)

Query: 2   FSNFS------LDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARS-- 53
           F+NF+      L +L+  +S  A   Q        DL++ +     D  T+L   A+S  
Sbjct: 3   FNNFADSVNKKLQELSSQVSQRAQDAQ--LDKKFRDLSSAVSQRTQDLTTQLPSFAQSTQ 60

Query: 54  RYIQEQLGTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESI 113
           R +QE+LG + D IS+LPQ+YVELE K D V  + +  L VT  +  E YDYP N+ +S+
Sbjct: 61  RLVQEKLGQVTD-ISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVRDSV 119

Query: 114 SDWWAEDETTENKNFLPRSFAQALAKAYSD-SKLITDKAERNIKLQTSP-KNTGTKXXXX 171
           ++                 F+  +A    D S+  +    +++ +   P K+  T     
Sbjct: 120 NE-----------------FSSVVAGKLHDLSRATSTNEAQSVLIAPGPHKDPKTLNYAL 162

Query: 172 XXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLE 231
                                +  A    S+    +   + + DT+I   FNKKL  +L 
Sbjct: 163 SKVALTSSEYLNKSVGGDDSEVSNALLKYSDVQAKVAQARLQQDTLIQTRFNKKLRDILA 222

Query: 232 VEFKEVAQLRRNVENSRLKFDTMR 255
            +  E  + R+NVE+ RL++D  R
Sbjct: 223 NDLNEAQKARKNVEHKRLQYDIAR 246

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 112/239 (46%), Gaps = 24/239 (10%)

Query: 24  NFTNAITDLNNNIETILNDPNTKLSI------RARSRYIQEQLGTLDDEISKLPQQYVEL 77
           NFTN++      + T ++    ++S       ++  R +QE+LG + D IS+LP++Y+EL
Sbjct: 6   NFTNSLNQKFQELSTAVSQRTQEISTNLPSLTQSTQRLVQERLGQVTD-ISQLPREYLEL 64

Query: 78  EIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAEDETTENKNFLPRSFAQAL 137
           E K D+++ I +  L VT+ +  E YDYP  +TES++D+    +   +K        Q L
Sbjct: 65  ERKVDTIKLIYENFLHVTSIYENESYDYPKYVTESVNDF---SKIVAHK-------VQEL 114

Query: 138 AKAYSDSKLITDKAERNIKLQTSP-KNTGTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKA 196
           + A S S+       +NI +  +P K   T                          +   
Sbjct: 115 SHASSASEA------QNILITPTPAKEPRTLNYALSKVSLISSEYLNHIGDHDEAQVASV 168

Query: 197 FKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMR 255
               S+    +   + + DTMI   FNK+L+  LE  FK+  + R++VE  RL++D  R
Sbjct: 169 LLKYSDLQAKVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKDVEYKRLQYDVAR 227

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%)

Query: 325 LEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIE 375
           +E LED+F   T  A   M+E+  +AK  + +K   N QL Y++     IE
Sbjct: 245 METLEDQFAQATEDATIIMQEVLSNAKFTEEIKEMANAQLTYHQTSASLIE 295

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 114/256 (44%), Gaps = 35/256 (13%)

Query: 2   FSNFS--LDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQ 59
           F +FS  + +L+ S+S  A + Q        DL  N+  + N         +  R +QE+
Sbjct: 5   FDSFSKKVQELSTSVSQKAQEAQ--LDQKFKDLKTNLPLLAN---------STQRMLQEK 53

Query: 60  LGTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAE 119
           LG + D IS+LP +YV+LE + ++++ I +  L VT  +  E YDYP N+ ES+ +    
Sbjct: 54  LGQVTD-ISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDE---- 108

Query: 120 DETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKXXXXXXXXXXXX 179
                        F++ +     D   +T++ +    L +SP+    K            
Sbjct: 109 -------------FSKLVGGKLHDLSKVTNREQAQNVLLSSPQMKEPKTLNYALSKVALT 155

Query: 180 XXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQ 239
                       +L       S+S T I   + + DTMI  +FNK ++  LE + +   +
Sbjct: 156 SSEHVEDE----SLANFLAKYSDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTK 211

Query: 240 LRRNVENSRLKFDTMR 255
            R+ VE  RL++D +R
Sbjct: 212 ARKLVEQKRLQYDVVR 227

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 111/245 (45%), Gaps = 22/245 (8%)

Query: 15  SNVALKTQE-NFTNAITDLNNNIETILNDPNTKLSIRARS--RYIQEQLGTLDDEISKLP 71
           S V  K QE      + DL+ ++     D  + L   A++  R +QE+LG + D IS++P
Sbjct: 19  STVQQKAQEAQLDKKLKDLSLSVSQRTQDLTSNLPSLAQTTQRRVQERLGQVTD-ISQMP 77

Query: 72  QQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAEDETTENKNFLPR 131
           ++YVELE + D  + I    L V+  + +E YDYP ++++S++D+    +T   K     
Sbjct: 78  EEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVNDF---SKTVTGK----- 129

Query: 132 SFAQALAKAYSDSKLITDKAERNIKLQTSP-KNTGTKXXXXXXXXXXXXXXXXXXXXXXL 190
              Q L KA       T +  ++I +   P +N  T                       +
Sbjct: 130 --VQELTKA------TTTEEAQSILISPGPARNPKTLNYALSKVALTSSEYLSKSGSDDV 181

Query: 191 VTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLK 250
           VT     K  S+    I   + + DT+I   FN++L   L  +F E  Q R+ V+  RL+
Sbjct: 182 VTADILLK-YSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQ 240

Query: 251 FDTMR 255
           +D  R
Sbjct: 241 YDIAR 245

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 115/267 (43%), Gaps = 58/267 (21%)

Query: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61
           F+N    +  +  ++V+ +TQE        L+NN+ T+          ++  R +QE+LG
Sbjct: 7   FTNSFTKRFQELSTSVSQRTQE--------LSNNLPTL---------AQSTQRLVQEKLG 49

Query: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTES--------- 112
            + D IS+LPQ+Y+ELE K DS++ I +  L VT+ +  E YDYP  + +S         
Sbjct: 50  QVTD-ISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIKDSVNDFSKTMA 108

Query: 113 --ISDWWAEDETTENKNFL--PRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKX 168
             I+D       +E +N L  P          Y+ SK+    +E   ++ ++P  +    
Sbjct: 109 AKITDLSHASSASEAQNILISPGPIRDPKTLNYALSKVSLTASEVINQVGSTPNESA--- 165

Query: 169 XXXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEH 228
                                   L       SN  + I   + + DT+I  +FNK L  
Sbjct: 166 ------------------------LSSKLLEFSNVQSKIAQARLQQDTLIQTKFNKALRD 201

Query: 229 LLEVEFKEVAQLRRNVENSRLKFDTMR 255
            L     +  + R+ V+N RL++D  R
Sbjct: 202 DLSTSLAKANKFRKEVQNKRLQYDVAR 228

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 113/245 (46%), Gaps = 22/245 (8%)

Query: 15  SNVALKTQE-NFTNAITDLNNNIETILNDPNTKLSIRARS--RYIQEQLGTLDDEISKLP 71
           S+V  K QE N      DL+  +     D  + L   A++  R +QE+LG + D IS++P
Sbjct: 19  SSVQQKAQEANLDKRFKDLSMTVTQKTQDLTSTLPSIAQTTHRMVQEKLGQITD-ISQMP 77

Query: 72  QQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAEDETTENKNFLPR 131
           ++YV +E + D +  I +  L VT  + +E YDYP +++ES+++     +T   K     
Sbjct: 78  EEYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVSESVNEI---SKTVTGK----- 129

Query: 132 SFAQALAKAYSDSKLITDKAERNIKLQTSP-KNTGTKXXXXXXXXXXXXXXXXXXXXXXL 190
              Q L KA S     T++A+ NI +   P K+  T                        
Sbjct: 130 --IQELTKATS-----TEEAQ-NILISPGPAKDPKTLNYALSKVSLTSSEYLSKSGSDSN 181

Query: 191 VTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLK 250
           VT     K  S+    I   + + D +I   FNK+L+  L  EF   A+ R+ V+N RL+
Sbjct: 182 VTADILLK-YSDIQAQIAQARLQQDMLIRTRFNKQLKEKLNNEFAAAARARKEVDNKRLQ 240

Query: 251 FDTMR 255
           +D  R
Sbjct: 241 YDIAR 245

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 116/251 (46%), Gaps = 48/251 (19%)

Query: 24  NFTNAITDLNNNIETILNDPNTKLS------IRARSRYIQEQLGTLDDEISKLPQQYVEL 77
           +FTN+++     + T +++   + S        +  R +QE+LG + D IS+LPQ+Y+EL
Sbjct: 5   SFTNSLSQKFQELSTAVSEKTQEFSTSIPTLAESTQRLVQEKLGNVTD-ISQLPQEYIEL 63

Query: 78  EIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDW---WAEDET--------TENK 126
           E + D+++ + +  L +T  +  E YDYP  +++S++D+   +A   T         E +
Sbjct: 64  ERQVDTIKLVYEHFLQITAIYENESYDYPKYVSDSVNDFSKVFANKVTELSHATSAQEAQ 123

Query: 127 NFL--PRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKXXXXXXXXXXXXXXXXX 184
           N L  P    +     Y+ SK+  + +E   +L  +  N G                   
Sbjct: 124 NILVTPGPAKEPRTLNYALSKVALNSSESLAQL--ADPNEG------------------- 162

Query: 185 XXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNV 244
                   +  A    S+    I   +   DT+I  +FNK+L   LE++  + ++ R++V
Sbjct: 163 -------PVADALLKFSDVQAKIAQTRLHQDTLIQTKFNKQLREKLELDIGKASKARKDV 215

Query: 245 ENSRLKFDTMR 255
           +  RL++D  R
Sbjct: 216 QYKRLQYDVAR 226

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 119/260 (45%), Gaps = 38/260 (14%)

Query: 2   FSNFSLDKLTDSISNVALKTQENFTNAIT----DLNNNIETILNDPNTKLSIRARSRYIQ 57
            SNF      +S +N   +  ++F+N ++    +L+ NI T+          ++  R +Q
Sbjct: 1   MSNF------NSFANSLRENLQSFSNTVSQKTHELSTNIPTL---------AQSTQRMVQ 45

Query: 58  EQLGTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWW 117
           E+LG + D IS+LPQ+Y+ELE K D+++ + +  L VT  +  E YDYP  ++ES++++ 
Sbjct: 46  EKLGQVTD-ISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEF- 103

Query: 118 AEDETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSP-KNTGTKXXXXXXXXX 176
                  +KN   +   Q L+KA S ++       +NI +   P K   T          
Sbjct: 104 -------SKNMAAK--VQELSKATSATEA------QNILVAPGPVKEPKTLNYAMSKVAL 148

Query: 177 XXXXXXXXXXXXXL-VTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFK 235
                        +   L K     S+  T +   + + DT I  +FNK +   L     
Sbjct: 149 NASEYLNHSFDDPMDAKLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIA 208

Query: 236 EVAQLRRNVENSRLKFDTMR 255
              + R++V++ RL++D  R
Sbjct: 209 RANKARKDVQSKRLQYDVAR 228

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%)

Query: 325 LEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQ 372
           +E LED+F   T  A   M+E+  SA  L  +K     QL YY Q  +
Sbjct: 246 METLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAK 293

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 90/204 (44%), Gaps = 20/204 (9%)

Query: 54  RYIQEQLGTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESI 113
           R +QE+LG + D IS+LP++Y ELE K D+++ I    L VT  +    YDYP  + ES+
Sbjct: 37  RMVQERLGQVTD-ISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESV 95

Query: 114 SDWWAEDETTENKNFLPRSFAQALAKAYSDSKLITDKAE-RNIKLQTSP-KNTGTKXXXX 171
           ++                 F++++A   ++    T  +E +NI +   P K   T     
Sbjct: 96  NE-----------------FSRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYAL 138

Query: 172 XXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLE 231
                                L  A    S+    I   + + DT+I  +FNKKL   L 
Sbjct: 139 SKVSLNSSECLNKMFPAEEQPLASALLQFSDVQAKIAQTRIQQDTLIQTKFNKKLRERLS 198

Query: 232 VEFKEVAQLRRNVENSRLKFDTMR 255
            E  +  + R++V + RL++D  R
Sbjct: 199 FEIGKADKCRKDVHSMRLRYDVAR 222

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 104/235 (44%), Gaps = 22/235 (9%)

Query: 25  FTNAITDLNNNIETILNDPNTKLSIRARS--RYIQEQLGTLDDEISKLPQQYVELEIKTD 82
           F ++++     I T +++   +L   A+S  R +QE+LG + D IS+LP++Y ELE K D
Sbjct: 6   FASSLSKKLQEISTSVSEKTQELPSLAQSTQRMVQERLGQVTD-ISQLPREYTELEDKVD 64

Query: 83  SVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAEDETTENKNFLPRSFAQALAKAYS 142
           +++ I    L VT  +    YDYP  + ES+++                 F++++A   +
Sbjct: 65  TIKLIYNHFLGVTAIYENGSYDYPKYINESVNE-----------------FSRSVASKLT 107

Query: 143 DSKLITDKAE-RNIKLQTSP-KNTGTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKAL 200
           +    T  +E +NI +   P K   T                          L  A    
Sbjct: 108 ELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMFPTEEQPLASALLQF 167

Query: 201 SNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMR 255
           S+    I   + + DT+I  +FNK L   L  E  +  + R++V + RL++D  R
Sbjct: 168 SDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 104/235 (44%), Gaps = 22/235 (9%)

Query: 25  FTNAITDLNNNIETILNDPNTKLSIRARS--RYIQEQLGTLDDEISKLPQQYVELEIKTD 82
           F ++++     I T +++   +L   A+S  R +QE+LG + D IS+LP++Y ELE K D
Sbjct: 6   FASSLSKKLQEISTSVSEKTQELPSLAQSTQRMVQERLGQVTD-ISQLPREYTELEEKVD 64

Query: 83  SVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAEDETTENKNFLPRSFAQALAKAYS 142
           +++ I    L VT  +    YDYP  + ES+++                 F++++A   +
Sbjct: 65  TIKLIYNHFLGVTAIYENGSYDYPKYINESVNE-----------------FSRSVASKLT 107

Query: 143 DSKLITDKAE-RNIKLQTSP-KNTGTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKAL 200
           +    T  +E +NI +   P K   T                          L  A    
Sbjct: 108 ELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLNKMLPTEEQPLASALLQF 167

Query: 201 SNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMR 255
           S+    I   + + DT+I  +FNK L   L  E  +  + R++V + RL++D  R
Sbjct: 168 SDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKTRKDVHSMRLRYDVAR 222

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 87/208 (41%), Gaps = 16/208 (7%)

Query: 48  SIRARSRYIQEQLGTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPP 107
            I    RY+QE+LG   D IS++PQ+Y++L  K D+++ I    L VT  +  E YDYP 
Sbjct: 31  GIPVTHRYMQEKLGHATD-ISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPK 89

Query: 108 NLTESISDWWAEDETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTK 167
            + ESI+++     T  +K        Q L+ A S       +A   +      K+  T 
Sbjct: 90  YINESINEF---SRTVGSK-------IQELSHASS-----AHEAHSILSAPGPSKDPKTL 134

Query: 168 XXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLE 227
                                    L       S+  + +   +   D+++   FN KL 
Sbjct: 135 NYALSRVSLVSSECMEHLSTHDDALLASYLMKYSDIQSRVAQARLHQDSLVQTHFNAKLR 194

Query: 228 HLLEVEFKEVAQLRRNVENSRLKFDTMR 255
             ++   K   ++RR+VEN RL +D  R
Sbjct: 195 EEIDGNLKRAHRVRRDVENKRLTYDASR 222

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 108/262 (41%), Gaps = 43/262 (16%)

Query: 2   FSNF--SLDK-LTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQE 58
           F++F  SL+K L D  S+V+ KTQE F+  +  L    +                R +QE
Sbjct: 4   FNSFASSLNKTLYDFGSSVSQKTQE-FSRDLPSLAQTTQ----------------RLVQE 46

Query: 59  QLGTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA 118
           +LG + D IS+LPQ+Y+ELE + D+++ + +  L VT  +  E YDYP  + +S+++W  
Sbjct: 47  KLGQVTD-ISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVRDSVNEW-- 103

Query: 119 EDETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKL-----QTSPKNTGTKXXXXXX 173
                          ++ +A   S+ + ++  AE    +     +T PK           
Sbjct: 104 ---------------SRTVATRVSELRHVSSAAEAQHVIAAPTQETEPKTLHYALSKVAL 148

Query: 174 XXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVE 233
                              L       S     +   + E D  +  +FN+KL   L  E
Sbjct: 149 NGSQLVDNLDAPRTPRETQLSSGLLEFSGVEAELAQARLEQDAAVKAQFNEKLRGQLSGE 208

Query: 234 FKEVAQLRRNVENSRLKFDTMR 255
               A  R+ V   RL++D  R
Sbjct: 209 IARAAAARKEVFQKRLQYDVAR 230

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 88/204 (43%), Gaps = 20/204 (9%)

Query: 54  RYIQEQLGTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESI 113
           R +QE+LG + D IS+LP++Y ELE K D+++ I    L VT  +    YDYP  + ES+
Sbjct: 37  RMVQERLGQVTD-ISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESV 95

Query: 114 SDWWAEDETTENKNFLPRSFAQALAKAYSDSKLITDKAE-RNIKLQTSP-KNTGTKXXXX 171
           ++                 F+ +LA   ++    T  ++ +NI +   P K   T     
Sbjct: 96  NE-----------------FSSSLASKLTELTHATSASQAQNILVAPGPIKEPKTLNYAL 138

Query: 172 XXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLE 231
                                L  +    S+    I   + + DT+I  +FNKKL   + 
Sbjct: 139 SKVALNSSECLNKMFPTEEQPLASSLLQFSDVQAKIAQARIQQDTLIQTKFNKKLRERVS 198

Query: 232 VEFKEVAQLRRNVENSRLKFDTMR 255
            E  +  + R+ V + RL++D  R
Sbjct: 199 FEIGKADKCRKEVHSMRLRYDVAR 222

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 102/235 (43%), Gaps = 47/235 (20%)

Query: 41  NDPNTKLSIRARSRYIQEQLGTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFAT 100
           N P+     ++  R +QE+LG + D IS+LP++Y++LE K D+++ +    L VTNTF  
Sbjct: 32  NMPDINSLAQSTQRMVQERLGQVTD-ISQLPEEYLQLERKIDTIKSVYDNFLSVTNTFEH 90

Query: 101 EGYDYPPNLTESISDWW------------------AEDETTENKNFL--PRSFAQALAKA 140
           + YDYP    ES+ ++                   A+   T N N +  P++   AL+KA
Sbjct: 91  QSYDYPNVARESVIEFSKSAVSKVEELSHATSASEAQQILTNNSNQIKEPKTLNYALSKA 150

Query: 141 YSDSKLITDKAERNIKLQTSPKNTGTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKAL 200
                LI+ + + N +  T   N                             +       
Sbjct: 151 ----SLISSE-QLNKQFSTDDDNNSNS---------------------DFKLVSSILLKF 184

Query: 201 SNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMR 255
           S+    I   + + D +I  +FN  L + L   F+   ++R++V+N RL++D  R
Sbjct: 185 SDIQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQYDVAR 239

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 90/213 (42%), Gaps = 48/213 (22%)

Query: 54  RYIQEQLGTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESI 113
           R ++E+LG   D IS LPQ+YVELE K D++++I +  L VT  +  E YDYP    ES 
Sbjct: 37  RLMKEKLGQAKD-ISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESF 95

Query: 114 SDWWAEDETTE-----------NKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPK 162
             W   D   E           NK  +P++   AL   +     +T  A   +KL   P 
Sbjct: 96  --WEFTDSVGEKFSALNISEHNNKVKIPKTLNYALHNVF-----LT--ANEKVKLLHEPL 146

Query: 163 NTGTKXXXXXXXXXXXXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEF 222
           +                            +L +   +LS +  +I   +   D+++ +  
Sbjct: 147 DN---------------------------SLSETLASLSETEADIAEARLHQDSLVKSRI 179

Query: 223 NKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMR 255
           N +L+  L   F+  A+ R+ V + R  +D  +
Sbjct: 180 NYQLKEELSQNFERAAKYRKAVHHKRFNYDVAK 212

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 60/105 (57%), Gaps = 4/105 (3%)

Query: 15  SNVALKTQE-NFTNAITDLNNNIETILNDPNTKLSIRARS--RYIQEQLGTLDDEISKLP 71
           S V+ + QE        DL+  +     D  T+L   A+S  R +QE+LG + D IS+LP
Sbjct: 19  SQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQRLMQEKLGQVTD-ISQLP 77

Query: 72  QQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDW 116
           Q YVELE K D ++ + +  L VT  +  E YDYP N+ +S++++
Sbjct: 78  QDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVNEF 122

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 207 IDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMR 255
           I   +   DT+I  +FNKKL   L  +     + R+NVEN RL++D  R
Sbjct: 198 IAQARLHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRLQYDIAR 246

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 325 LEQLEDEFVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQ 372
           +E LEDEF   T  AV  M+++ +S+++L  ++     Q  YY+Q  +
Sbjct: 264 MESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAEYYKQSAE 311

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 117/258 (45%), Gaps = 62/258 (24%)

Query: 24  NFTNAITDLNNNIETILN----DPNTKLSIRARS--RYIQEQLGTLDDEISKLPQQYVEL 77
           +F +++T     + T+++    D  T +   A S  R +QE+LG + D IS+LPQ+Y+EL
Sbjct: 5   DFASSLTQKFQELSTVVSERTQDLGTSIPSIASSTQRLVQEKLGNVTD-ISQLPQEYLEL 63

Query: 78  EIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA------ED-----ETTENK 126
           E + D+++ + +  L +T+ +  E YDYP  +++S++D+        ED        E +
Sbjct: 64  EKEIDTIKLVYEHFLKITSIYDNESYDYPKYVSDSVNDYSKLFQSKIEDLSRATSAEEAQ 123

Query: 127 NFL--------PRSFAQALAK-AYSDSKLITDKAERNIKLQTSPKNTGTKXXXXXXXXXX 177
           N L        PR+   AL+K A + S+ +    + N+    S                 
Sbjct: 124 NILVTPGPITEPRTLNYALSKVALTSSESLNQLQDPNVSAVAS----------------- 166

Query: 178 XXXXXXXXXXXXLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEV 237
                         TL K     S+  T I   + + DT+I  + NK ++  L    ++ 
Sbjct: 167 --------------TLLK----FSDMQTKIAQQRLQQDTLIQTKVNKVIKEKLSSLIEKA 208

Query: 238 AQLRRNVENSRLKFDTMR 255
            + RR+V+  RL++D  R
Sbjct: 209 TKSRRDVQYKRLQYDVAR 226

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 107/247 (43%), Gaps = 48/247 (19%)

Query: 16  NVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLGTLDDEISKLPQQYV 75
           +V  K QE  T    +L + I T+          ++  R ++E+LG +DD IS LPQ+Y+
Sbjct: 9   SVGKKFQE-LTTKTQELTSTIPTV---------AQSTHRMVKEKLGQVDD-ISPLPQEYL 57

Query: 76  ELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAEDETTENKNFLPRSFAQ 135
           +LE+K D+ + + +  L +T+ +  E YDYP   +ES++++    ++  NK +    F+ 
Sbjct: 58  DLELKIDTYKSVYEHFLKITSIYERESYDYPKEFSESVNEFT---DSIGNKMY---EFSN 111

Query: 136 ALAKAYSDSKLITDKAERNIKLQTSPKNTGTKXXXXXXXXXXXXXXXXXXXXXXLVTLGK 195
            ++   S     + K  R +    S  + G                              
Sbjct: 112 GVSTEGS-----SGKTPRTLNYAVSKVSMGASEQFQKLHDTDD----------------- 149

Query: 196 AFKALSNSFTNIDNGKNEM-------DTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSR 248
             K ++N  TN+ N +  +       D  I  +FN +L   +    +  ++ R+ V + R
Sbjct: 150 --KRIANLLTNVGNAEASIAEARLLQDHSIQAKFNFQLREEIAQSIERASKYRKEVYHKR 207

Query: 249 LKFDTMR 255
           LK+D  R
Sbjct: 208 LKYDIAR 214

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 61/95 (64%), Gaps = 3/95 (3%)

Query: 24  NFTNAITDLNNNIETILNDPNTKLSIRARS--RYIQEQLGTLDDEISKLPQQYVELEIKT 81
           +F+  +++L++ +     + +T L   A+S  R +QE+LG + D IS+LP++Y+ELE+K 
Sbjct: 10  SFSKTLSELSSTVSQKTQELSTNLPNLAQSTQRMVQERLGQVTD-ISQLPEEYLELEMKL 68

Query: 82  DSVEKILKRLLLVTNTFATEGYDYPPNLTESISDW 116
           DS+++I    L V++ +  + YDYP    ES+ ++
Sbjct: 69  DSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEF 103

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 195 KAFKALSNSFTNIDN-------GKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENS 247
           +AFK+ +++  N  N        + + D +I  +FN  L H L     +  ++R+ V++ 
Sbjct: 162 EAFKSSASALLNFSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSK 221

Query: 248 RLKFDTMR 255
           RL++D  R
Sbjct: 222 RLQYDIAR 229

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 95/213 (44%), Gaps = 20/213 (9%)

Query: 50  RARSRYIQEQLGTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNL 109
           + + R  QE+LG + D IS++P++Y++LE + D+++  ++ LL VT  +    YD+P + 
Sbjct: 37  QVQQRLAQEKLGQITD-ISQMPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYST 95

Query: 110 TESISDWWAEDETTENKNFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKXX 169
            ES+ DW          +    S  Q L++A S S     +A   +K    P+N G +  
Sbjct: 96  QESVQDW----------SRAIGSRVQELSRASSAS-----EAGNLLKSPVGPEN-GPRTL 139

Query: 170 XXXXXXXXXXXXXXXXXXXXLV---TLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKL 226
                                     L     A S++   +   +   DT +  +FNK+L
Sbjct: 140 NYALSQASLAVSTLTSSNMPGPNGEGLSSGLIAYSDTQAKLAQIRIAQDTQVQTKFNKQL 199

Query: 227 EHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVK 259
             +L     +  + R++V+  R+ +D  R +++
Sbjct: 200 REILNNPIAKANKYRKDVQYKRVLYDIARTNLQ 232

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 41/61 (67%), Gaps = 1/61 (1%)

Query: 56  IQEQLGTLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISD 115
           +QE+ G + D IS LPQ+Y++LE + DS++ +    L +T  +  E YDYP ++ +SI++
Sbjct: 1   MQEKFGQVTD-ISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITE 59

Query: 116 W 116
           +
Sbjct: 60  F 60

>NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {ON}
           Anc_5.477 YOR141C
          Length = 863

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 6/65 (9%)

Query: 18  ALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLGTLDDEISKLPQQYVEL 77
           +++   NFT A     NN E +LNDPNT + I   S ++  ++G   DE+ +L    V L
Sbjct: 224 SVRETSNFTTAN---GNNDEILLNDPNTTIVIHPGSSFL--KVGFALDEVPELIPNCVAL 278

Query: 78  EIKTD 82
             KTD
Sbjct: 279 P-KTD 282

>KAFR0B03130 Chr2 complement(649445..651979) [2535 bp, 844 aa] {ON}
           Anc_8.704 YPL174C
          Length = 844

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 32  LNNNIETILNDPNTKLSIRARSRYIQEQLGTLDDEISKLPQQYVELE 78
           L N +E I   P   L IR + + + + LGTL  EIS++  +Y E+E
Sbjct: 753 LKNALEDISAMPEPHLQIRNKEKTLTKDLGTLHREISRMI-KYAEIE 798

>NDAI0D04430 Chr4 (1040300..1042711) [2412 bp, 803 aa] {ON}
           Anc_4.232
          Length = 803

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 35/59 (59%), Gaps = 5/59 (8%)

Query: 192 TLGKAFKALSNSFTNIDNGKNEMDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLK 250
            L K  K++S +  NID    E+   + NE  K L+ L+E + K+V +L+R++  +RLK
Sbjct: 648 ALVKTLKSISTTIDNIDGKTTEV---LDNERGKDLDTLIEKQLKDVEELQRSI--ARLK 701

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,509,640
Number of extensions: 1556454
Number of successful extensions: 8884
Number of sequences better than 10.0: 114
Number of HSP's gapped: 9148
Number of HSP's successfully gapped: 171
Length of query: 388
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 277
Effective length of database: 40,753,473
Effective search space: 11288712021
Effective search space used: 11288712021
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)