Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D032603.487ON31431416570.0
Kpol_1017.93.487ON3103177761e-102
CAGL0I10582g3.487ON3193276672e-85
Smik_6.2233.487ON3133246435e-82
YGR127W3.487ON3123236341e-80
NDAI0G009703.487ON3323396186e-78
Skud_7.4383.487ON3133246132e-77
Suva_7.4153.487ON3133246123e-77
SAKL0F02882g3.487ON2983156017e-76
KAFR0C019303.487ON3133195592e-69
KNAG0B008403.487ON3133065559e-69
KLLA0E04687g3.487ON3063215487e-68
NCAS0E008403.487ON3363255491e-67
TDEL0D055503.487ON3103045262e-64
Kwal_55.212173.487ON3033135252e-64
KLTH0F14718g3.487ON3003175234e-64
Ecym_12423.487ON3113225105e-62
TBLA0D029903.487ON3183245002e-60
ZYRO0D10098g3.487ON2762634606e-55
AFR305W3.487ON3093204487e-53
Smik_4.22.16ON793138850.041
NCAS0G019702.82ON166898830.085
Skud_4.152.16ON790139810.16
NDAI0G01600singletonON34457770.35
KAFR0C033508.73ON87272741.0
KAFR0H008603.370ON57875741.1
NCAS0H015605.333ON281111711.5
Suva_8.1075.658ON88373712.1
TBLA0J007205.603ON81463712.2
CAGL0F06589g2.632ON46984702.5
SAKL0E12518g2.88ON39456702.7
Kpol_529.68.434ON107689703.0
YGL090W (LIF1)6.182ON42153676.9
NDAI0K023106.357ON67070668.1
Skud_15.3225.505ON31667668.4
Smik_6.538.46ON102653668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D03260
         (314 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   642   0.0  
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   303   e-102
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   261   2e-85
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   252   5e-82
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   248   1e-80
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   242   6e-78
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   240   2e-77
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   240   3e-77
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   236   7e-76
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   219   2e-69
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   218   9e-69
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   215   7e-68
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   216   1e-67
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   207   2e-64
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   206   2e-64
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   206   4e-64
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   201   5e-62
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   197   2e-60
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   181   6e-55
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   177   7e-53
Smik_4.2 Chr4 complement(4408..6789) [2382 bp, 793 aa] {ON} YDL2...    37   0.041
NCAS0G01970 Chr7 (352294..357300) [5007 bp, 1668 aa] {ON} Anc_2....    37   0.085
Skud_4.15 Chr4 complement(23550..25922) [2373 bp, 790 aa] {ON} Y...    36   0.16 
NDAI0G01600 Chr7 (349960..350994) [1035 bp, 344 aa] {ON}               34   0.35 
KAFR0C03350 Chr3 complement(683059..685677) [2619 bp, 872 aa] {O...    33   1.0  
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    33   1.1  
NCAS0H01560 Chr8 (300838..301683) [846 bp, 281 aa] {ON} Anc_5.33...    32   1.5  
Suva_8.107 Chr8 complement(197136..199787) [2652 bp, 883 aa] {ON...    32   2.1  
TBLA0J00720 Chr10 (167109..169553) [2445 bp, 814 aa] {ON} Anc_5....    32   2.2  
CAGL0F06589g Chr6 (648302..649711) [1410 bp, 469 aa] {ON} weakly...    32   2.5  
SAKL0E12518g Chr5 (1035137..1036321) [1185 bp, 394 aa] {ON} high...    32   2.7  
Kpol_529.6 s529 complement(10311..13541) [3231 bp, 1076 aa] {ON}...    32   3.0  
YGL090W Chr7 (343319..344584) [1266 bp, 421 aa] {ON}  LIF1Compon...    30   6.9  
NDAI0K02310 Chr11 complement(517057..519069) [2013 bp, 670 aa] {...    30   8.1  
Skud_15.322 Chr15 (580909..581859) [951 bp, 316 aa] {ON} YOR158W...    30   8.4  
Smik_6.53 Chr6 complement(99374..102454) [3081 bp, 1026 aa] {ON}...    30   8.5  

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/314 (100%), Positives = 314/314 (100%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60
           MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60

Query: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK 120
           WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK
Sbjct: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK 120

Query: 121 QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISNDKE 180
           QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISNDKE
Sbjct: 121 QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISNDKE 180

Query: 181 RWHKISNGEKLMDEFLSKDIRDENSVIESCFKIASTSELTNEYLHSHDDILDLMTETVFV 240
           RWHKISNGEKLMDEFLSKDIRDENSVIESCFKIASTSELTNEYLHSHDDILDLMTETVFV
Sbjct: 181 RWHKISNGEKLMDEFLSKDIRDENSVIESCFKIASTSELTNEYLHSHDDILDLMTETVFV 240

Query: 241 PPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDDDVSKAGI 300
           PPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDDDVSKAGI
Sbjct: 241 PPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDDDVSKAGI 300

Query: 301 EKPINELNFEYNIL 314
           EKPINELNFEYNIL
Sbjct: 301 EKPINELNFEYNIL 314

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  303 bits (776), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 158/317 (49%), Positives = 217/317 (68%), Gaps = 11/317 (3%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSR-NETDPSKFG 59
           MCIL  +R HP+Y+LILISNRDEFLQR+T  +CWN+     +LCPYD+S+ NE + +K G
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKIG 60

Query: 60  TWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFL 119
           TWCGINEFGRVS++LNLK D++        KKSRG LP+KFLDN++ +S  +W+SY KF+
Sbjct: 61  TWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKFV 120

Query: 120 KQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEF-ISND 178
           K+YP +++TG FN F GDV+  +Y +IDS G T  +L   +      +VISN +F  SN 
Sbjct: 121 KEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDN----PYLVISNDKFGKSNG 176

Query: 179 K--ERWHKISNGEKLMDEFLSKDIRDENSVIESCFKIASTSELTNEYLHSHDDILDLMTE 236
           K  + W KI+  + L+      +  D+  +I  CF IAST+ L NE L    D+ +LMTE
Sbjct: 177 KSTKEWEKITLAKNLLKHLPLCETEDD--LIHKCFDIASTNTL-NEDLIKDVDVRELMTE 233

Query: 237 TVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDDDVS 296
           T+ VPP+ +    EK+ IGASLP+G++YGTRSQIVILVNK RT V+++ER+LY  DDDV+
Sbjct: 234 TILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNSDDDVT 293

Query: 297 KAGIEKPINELNFEYNI 313
              +  PI +L + + I
Sbjct: 294 TQKLSSPIQDLTYNFTI 310

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  261 bits (667), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 211/327 (64%), Gaps = 23/327 (7%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPS--KF 58
           MCILF TR HPDYELI+ISNRDEFL+RKT  +CW+  ++  +L PYDL+R     S   F
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWH--NDDFILSPYDLARIGAGQSNDTF 58

Query: 59  GTWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKF 118
           GTW G+N  GRV++VLNL++ +     + + ++SRG LP  FL++R+ N F DW++Y+KF
Sbjct: 59  GTWTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGN-FEDWDTYAKF 117

Query: 119 LKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISN------- 171
            K YPD+++TG FNLF GD K+  YALIDS G T  +     + GK  +VISN       
Sbjct: 118 CKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLF---SKPGKGYLVISNNIHDKLH 174

Query: 172 --SEFISNDKERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSELTNEYLHSHD 228
             S+ I++  E W KI  G+++M+EF+  +    +  VIE+CFK+AST+ + ++     D
Sbjct: 175 LQSQDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFD 234

Query: 229 DI--LDLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMER 286
            +  L +  ET++V P+ L  P E+  IG+ L  G++YGTRSQIV+LV+K +T   ++ER
Sbjct: 235 LVKSLGVTKETIYVQPL-LTPPHEE--IGSPLTAGQYYGTRSQIVLLVDKSKTKATFIER 291

Query: 287 VLYECDDDVSKAGIEKPINELNFEYNI 313
           ++Y  D D+S      P  EL +EY+I
Sbjct: 292 IIYSSDQDISLYSTSNPKEELRYEYDI 318

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  252 bits (643), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 136/324 (41%), Positives = 203/324 (62%), Gaps = 22/324 (6%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60
           MCIL  TR+HPDYELILISNRDEFL RKT  +CW+  ++  +L PYDL+R   +  +FGT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWH--NDDFILSPYDLARTSKEGQEFGT 58

Query: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK 120
           W GIN+ G+++++LNLK+     E   ++ KSRG LP  FL N + N F DW+SYSKF  
Sbjct: 59  WSGINKEGKLATILNLKLGS---ERSTIKSKSRGLLPYIFLSNHEAN-FKDWDSYSKFGN 114

Query: 121 QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGK-DENGKSSVVISNSEFISND- 178
            Y  L+ TG FN F GDV +++Y +IDS G+T  +L     ++  S +VISN  F +   
Sbjct: 115 HYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSS 174

Query: 179 --KERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSELTNEYLHSHDDILDLMT 235
             ++ W K+      +++ +S +I  DE ++I SCF++AS S L      S  D+L ++ 
Sbjct: 175 IPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTV--SKPDVLQMLV 232

Query: 236 E------TVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLY 289
           +      T++VPP++       D++GAS+P G FYGTRSQIV+L++K+ T   ++ER++Y
Sbjct: 233 DPNVTMSTIYVPPLRRP---PGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIY 289

Query: 290 ECDDDVSKAGIEKPINELNFEYNI 313
             D+DV +  +  P  E  FE+ +
Sbjct: 290 SSDEDVRQYSVSAPKEEKRFEFEL 313

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  248 bits (634), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 136/323 (42%), Positives = 202/323 (62%), Gaps = 21/323 (6%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60
           MCIL  TR+HPDYELILISNRDEFL RKT  +CW+  +N  +L PYDL++   +   FGT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWH--NNDFILSPYDLAKTSAEKQIFGT 58

Query: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK 120
           W GIN+ G+++++LNLK+D    E  N + +SRG LP  FL   K + F DW++Y KF  
Sbjct: 59  WSGINKEGKLATILNLKLDN---EQNNTKSRSRGLLPFIFLSIHKAD-FEDWDNYKKFEG 114

Query: 121 QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGK-DENGKSSVVISNSEFISNDK 179
            Y  L+ TG FN F GDV K++Y +IDS G+T  +L     ++  S +V+SN +F  +  
Sbjct: 115 HYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSS 174

Query: 180 ---ERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSELTNEYLHSHDDILDLM- 234
              + W K+      ++  + ++I  DE  +I SCF++AS S L +    S+ D+L ++ 
Sbjct: 175 IPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTI--SNPDVLQMVD 232

Query: 235 ----TETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYE 290
                 T++VPP++      +D++GAS+P G +YGTRSQIV+LV+K+ T V ++ERVLY 
Sbjct: 233 PNVTMNTIYVPPLRRP---PRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYS 289

Query: 291 CDDDVSKAGIEKPINELNFEYNI 313
            D+DV K  +  P  E  F++ +
Sbjct: 290 SDEDVRKYSVTSPKEEKRFKFKL 312

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  242 bits (618), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 132/339 (38%), Positives = 195/339 (57%), Gaps = 35/339 (10%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSR--NETDPSKF 58
           MCIL  T +HPDYELILISNRDEFLQRKT  SCW+      +L PYD+++     D   F
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDF--ILSPYDMAKECKYNDKKVF 58

Query: 59  GTWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKF 118
           GTW GIN+ G++++VLNLK++++    + V  KSRG LP  +L +  E+SF +W+ Y  F
Sbjct: 59  GTWLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNF 118

Query: 119 LKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISND 178
            K+YP L+ TG FNLF GDVK+++Y ++DS G T   L+   +     +V+SN  F  N 
Sbjct: 119 TKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQ----YLVVSNDVFTCNG 174

Query: 179 K---------------------ERWHKISNGEKLMDEFLSKDI---RDENSVIESCFKIA 214
           +                     E W K+  G  L+   ++K I   +DE+++I  CFK++
Sbjct: 175 QLGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLS 234

Query: 215 STSELTNEYLHSHDDILDLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILV 274
           ST  +T E          L  ET+ VPP++ +     D++G SLP+G++YGTRSQIVIL+
Sbjct: 235 STCSVTVEDHCKFHQNSTLPNETILVPPLRCK---ITDDVGTSLPIGEYYGTRSQIVILI 291

Query: 275 NKERTTVRYMERVLYECDDDVSKAGIEKPINELNFEYNI 313
            +    V++ E V+Y  D D+       P   + F++ +
Sbjct: 292 KRGTYEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  240 bits (613), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 133/324 (41%), Positives = 198/324 (61%), Gaps = 22/324 (6%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60
           MCIL  TR+HPDYELILISNRDEFL RKT  +CW+  ++  +L PYDL++   +   FGT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWH--NDDFILSPYDLAKTSKEKQIFGT 58

Query: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK 120
           W GIN  G+++++LNLK+D  +     ++ KSRG LP  FL   K + F +W++Y KF  
Sbjct: 59  WSGINREGKLATILNLKLDGQR---DTIKSKSRGLLPFTFLSTHKAD-FQNWDNYDKFEM 114

Query: 121 QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGK-DENGKSSVVISNSEFI---S 176
            Y  L  TG FN F GDV +++Y LIDS G+T  +LD     N  S + +SN EF    S
Sbjct: 115 NYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPS 174

Query: 177 NDKERWHKISNGEKLMDEFLSKDI-RDENSVIESCFKIASTSELTNEYLHSHDDILDLMT 235
             ++ W K+      +++ +  +I  DE ++I +CF++AS S +      S  + L ++ 
Sbjct: 175 ISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGT--ASKPNALQMLA 232

Query: 236 E------TVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLY 289
           +      T++VPP  L  P + D++GAS+P G +YGTRSQIV+LV+K  + V ++ER+LY
Sbjct: 233 DPNVIMNTIYVPP--LRRPPD-DDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILY 289

Query: 290 ECDDDVSKAGIEKPINELNFEYNI 313
             D+DV+   +  P  E  FE+ +
Sbjct: 290 SSDEDVNHYSVATPKEEKRFEFKL 313

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  240 bits (612), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 133/324 (41%), Positives = 198/324 (61%), Gaps = 22/324 (6%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60
           MCIL  TR+HP YELILISNRDEFL+RKT  +CW+  ++  +L PYD+++   +   FGT
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWH--NDDFILSPYDVAKTSMEKQIFGT 58

Query: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK 120
           W GIN+ G+++++LNLKMD+ +      + KSRG LP  FL + K   F DW+ Y+KF K
Sbjct: 59  WSGINKEGKLATILNLKMDDQR---SCTKSKSRGMLPFTFLTSHKAR-FQDWDDYNKFEK 114

Query: 121 QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGK-DENGKSSVVISNSEF---IS 176
            Y  L  TG FN F GDV ++ Y +IDS G T  +L      +  S +VISN ++    S
Sbjct: 115 HYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSS 174

Query: 177 NDKERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSELTNEYLHSHDDILDLMT 235
             ++ W K+      ++  +  +I  DE ++I +CF++AS S L +  L    D+L ++ 
Sbjct: 175 ISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKP--DLLQMLV 232

Query: 236 E------TVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLY 289
           +      T++VPP++       D++GAS+P G +YGTRSQIV+LV+K+ + V ++ERVLY
Sbjct: 233 DPNVTMNTIYVPPLRRP---PGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLY 289

Query: 290 ECDDDVSKAGIEKPINELNFEYNI 313
             D+DVS      P  E  FE+ +
Sbjct: 290 SSDEDVSHYSASAPKEEKRFEFEL 313

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  236 bits (601), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 205/315 (65%), Gaps = 19/315 (6%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60
           MCIL  T +HP Y LILISNRDEF +R+T  +C +  S+  ++ P+D+S   T    FGT
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVH--SDDFIVSPFDMSIT-TKGRNFGT 57

Query: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVR-KKSRGYLPVKFLDNRKENSFNDWNSYSKFL 119
           WCG+N+ G+V+ +LNL++       KNV   +SRG +P+KFL   K+  FN+W+SY KF 
Sbjct: 58  WCGVNKDGKVAVILNLRIASCG-NPKNVECPQSRGIVPMKFLAG-KDVDFNNWDSYEKFS 115

Query: 120 KQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISNDK 179
             YP +EKTG+FNLF GD  K EY LI S  +T    DG  +N    +V+SN + IS+ K
Sbjct: 116 HHYPGIEKTGNFNLFYGDCSKGEYKLISSLSETT---DGF-QNDDGYMVVSN-DLISS-K 169

Query: 180 ERWHKISNGEKLMDEFLSKDIRD-ENSVIESCFKIASTSELTNEYLHSHDDILDLMTETV 238
           ++W KIS  + L+   +   + D ++S+++ CFK+AS S  + + +  H+ + +   ET+
Sbjct: 170 KKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVKHESVTN---ETI 226

Query: 239 FVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDDDVSKA 298
           +VPP+ +EN  + D    S+P GK+YGTRSQIVILV+K++  + ++ERVLY CD+DV K 
Sbjct: 227 YVPPLLVENGQDLD---VSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKY 283

Query: 299 GIEKPINELNFEYNI 313
           G + P  ++ FE++I
Sbjct: 284 GPKNPKEQIEFEFDI 298

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  219 bits (559), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 125/319 (39%), Positives = 199/319 (62%), Gaps = 19/319 (5%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSK-FG 59
           MCILF TRSH +YELILISNRDE+L RKT  +CW+  ++  +L PYD+SR E   +K FG
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWH--NDNFILSPYDMSREENHGNKIFG 58

Query: 60  TWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFL--DNRKENSFNDWNSYSK 117
           TW G+N+ G+++++LNL+   +    + V+ +SRG +P  FL  D   E+SF +W ++ K
Sbjct: 59  TWLGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEK 118

Query: 118 FLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISN 177
           F  +YP L+ +G FN F GD+K+  Y +IDS G T ++LD  + N    ++ISN  +   
Sbjct: 119 FKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRN----MIISNDLYQHK 174

Query: 178 D----KERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSELTNEYLHSHDDILD 232
           D    K  W KI  G + +++FL +  R +E+ V+  CF++AS   + +      +   +
Sbjct: 175 DEYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNKE 234

Query: 233 LMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECD 292
           L  ET++VPP+K+      ++IG +   GK+YGTR+QIV+LV+K+R  V  +E  ++  D
Sbjct: 235 LAAETIYVPPLKV---CPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSD 291

Query: 293 DDVSK-AGIE-KPINELNF 309
           +++ K +G+  K +  L+F
Sbjct: 292 EEIYKYSGLNPKEVQRLDF 310

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  218 bits (555), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 124/306 (40%), Positives = 190/306 (62%), Gaps = 26/306 (8%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKF-- 58
           MCIL  TR HPDY+L+LISNRDEF +R T  + W+  S   +L PYD+++   DP K   
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWH--SGDYILSPYDMTKGLYDPGKCVR 58

Query: 59  GTWCGINEFGRVSSVLNLKMDENKVEDKN---VRKKSRGYLPVKFLDNRKENSFNDWNSY 115
           GTW G+N  GRVS+VLNLK++   +   +   V+++SRG +P  FL +R     + W+S+
Sbjct: 59  GTWMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDR--GFIDQWDSF 116

Query: 116 SKFLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISN---S 172
            KF  +YPDLEK+G FNLFIGD+++Q+Y ++DS G T  +L   +E    ++V+SN    
Sbjct: 117 EKFRDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVL---NETTGMNMVVSNDTYK 173

Query: 173 EFISNDKERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSELTNEYLHSHDDI- 230
           EF  ND   W+K+  G+  + E ++  +  D++S I+ CF  AS   +      SH+DI 
Sbjct: 174 EFNENDISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEK----SHEDIS 229

Query: 231 --LDLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVL 288
              ++++ T+FVPP+K +    + ++G +   G ++GTRSQ+V LV+K+R  V   ER+L
Sbjct: 230 KTPEVISNTIFVPPLKCQ---PQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERIL 286

Query: 289 YECDDD 294
           +  D D
Sbjct: 287 HTSDLD 292

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  215 bits (548), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 122/321 (38%), Positives = 185/321 (57%), Gaps = 25/321 (7%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60
           MCILF TR+HPDY+LIL+SNRDEF +RKT  +CWN   +  +L PYD++  E     +GT
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNH--DGFILSPYDMAI-EKKGQGYGT 57

Query: 61  WCGINEFGRVSSVLNLKMDENKVEDK---NVRKKSRGYLPVKFLDNRKENSFNDWNSYSK 117
           W GIN  GR++ +LNLK+D     +    N   +SRG +P++FL       F++W+S+ K
Sbjct: 58  WLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEK 117

Query: 118 FLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEF--- 174
           F  Q+ +L +TG F LF GD K  EY +ID    +    +  +      +VISN  F   
Sbjct: 118 FNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKMEH-----MVISNDIFHCA 172

Query: 175 ISNDKERWHKISNGEKLMDEFLSKDIRD--ENSVIESCFKIASTSELTNEYLHSHDDILD 232
           +     RW+K   G  L+D  L+K+     +  +++ CF++     L+N   +  +D+  
Sbjct: 173 VGEHTSRWNKTEYGYVLLDA-LAKNTTGIAKEELLQKCFEL-----LSNHTFNEGEDVDS 226

Query: 233 LMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECD 292
           + T +++VPP+++      D IG SLP+G +YGTRSQIVILV+K+   V Y E V+YE D
Sbjct: 227 VTTSSIYVPPLRITKGA--DAIGTSLPIGDYYGTRSQIVILVDKD-NRVTYEEHVIYESD 283

Query: 293 DDVSKAGIEKPINELNFEYNI 313
           +D        P   + F++N+
Sbjct: 284 EDCETYSFMDPKEVIQFQFNM 304

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  216 bits (549), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 130/325 (40%), Positives = 190/325 (58%), Gaps = 26/325 (8%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRN-ETDPSK-F 58
           MCIL  T +HP YELILISNRDEF +RKT  SCW+  ++  +L P+D++++ E    K F
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWH--NDDFILSPFDMAKSCELHEKKIF 74

Query: 59  GTWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKF 118
           GTW GIN   +++++LNLK++      + V+ +SRG +P  FL +  ++ FN W++Y KF
Sbjct: 75  GTWIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFL-SEHDSDFNKWDTYEKF 133

Query: 119 LKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFIS-- 176
             +Y  L KTG FN F GD    EY +IDS G T ++L     +G   + +SN  F +  
Sbjct: 134 DGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVL-----SGDPYLTVSNDMFATGG 188

Query: 177 --------NDKERWHKISNGEKLMDEFL--SKDIRDENSVIESCFKIASTSELTNEYLHS 226
                   N    W KI  G+ L+ + +  SK + DE+ +IE CFK+AST  +  +    
Sbjct: 189 ITVERASNNRIAEWRKIKFGKILLQDLVEESKSL-DEDMLIEKCFKLASTCSVQPKENTK 247

Query: 227 HDDILDLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMER 286
            +    L  ET+FVPP++ E     D+IG SL VGK+YGTRSQIVIL++K    V+ +E 
Sbjct: 248 FNQNSTLPMETIFVPPLECE---VNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEH 304

Query: 287 VLYECDDDVSKAGIEKPINELNFEY 311
           +LY  D+D+       P    +FE+
Sbjct: 305 ILYTSDNDIQHYSSTNPKEVKSFEF 329

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  207 bits (526), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 121/304 (39%), Positives = 176/304 (57%), Gaps = 23/304 (7%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60
           MCIL  T  HP Y+L+L+SNRDE+  RK + + W E +   +LCP D   + +     GT
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNF--MLCPLDKGLDSSG-EDLGT 57

Query: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK 120
           W G N  G++ +VLNLK+  +      V  +SRG +PV FL +R  N F DW++Y KF  
Sbjct: 58  WIGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGAN-FKDWDTYDKFCH 116

Query: 121 QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFI--SND 178
           Q+  LE T  FN F GD    +Y +IDS G T ++L   +E     +V+SN  F   SN 
Sbjct: 117 QFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEK---YIVVSNDIFQGESNK 173

Query: 179 KERWHKISNGEKLMDEFLSKDIR-----DENSVIESCFKIASTSELTNEYLHS--HDDIL 231
              W KIS    L D+ L   +R     DE+  I+ CF IAS +   +++ H   +   +
Sbjct: 174 NRVWDKIS----LADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAV 229

Query: 232 DLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYEC 291
           +L  +TVFVPP+K       D +GAS+P+G++YGTRSQ VILV+K+R+ + Y+ER++++ 
Sbjct: 230 ELSMQTVFVPPLKTSC---DDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDS 286

Query: 292 DDDV 295
           D D 
Sbjct: 287 DLDA 290

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  206 bits (525), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 121/313 (38%), Positives = 184/313 (58%), Gaps = 19/313 (6%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60
           MCIL  + +HP Y LILISNRDEF++R+T  +C N      V+ P D++  + +    GT
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDD--YVVSPLDMTLKDNNEPNLGT 58

Query: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK 120
           WCG N  GR++ +LNL+   N  + K  R  SRG + +++L +++  S  DWNSY+KF  
Sbjct: 59  WCGANRNGRIAVILNLRTG-NTNQTKTKRIVSRGNVTMRYLTDKQPAS--DWNSYAKFAS 115

Query: 121 QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISNDKE 180
           + PD+ K+  FN+F GD K  +Y  IDS G +  +L  ++      +VISN    S  K 
Sbjct: 116 KCPDI-KSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNP----YLVISNDSIESATK- 169

Query: 181 RWHKISNGEKLMDEFLSKDIRD-ENSVIESCFKIASTSELTNEYLHSHDDILDLMTETVF 239
            W KI   EKLM + +   + D E+ ++  CF +AS  +   +Y   H D   + +  +F
Sbjct: 170 -WPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASHKQ---DYNVDHMDKEKVTSSNIF 225

Query: 240 VPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDDDVSKAG 299
           VPP  LE P  +D +GAS+P G+FYGTRSQIV+LV+KE  ++R++E VLY+ D + +   
Sbjct: 226 VPP--LEVPKSED-LGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFC 282

Query: 300 IEKPINELNFEYN 312
              P   ++++ N
Sbjct: 283 AANPKKCVSYKIN 295

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  206 bits (523), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 120/317 (37%), Positives = 178/317 (56%), Gaps = 24/317 (7%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60
           MCIL  + +HP Y LI ISNRDEF +RKT+ +C N      +L P D +    +    GT
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDY--ILSPLDTALRSNNKPALGT 58

Query: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKS---RGYLPVKFLDNRKENSFNDWNSYSK 117
           WCG+N  GRV+ +LNL+   NK   K +  KS   RG +P+K+L +R  ++  DWNS+ K
Sbjct: 59  WCGVNRKGRVAVILNLR---NKEPAKRIPVKSPISRGSVPMKYLMDRGPST--DWNSFEK 113

Query: 118 FLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISN 177
           F+ +YP + +   FN+F GD    EY  IDS G +   L       K ++V+SN    S+
Sbjct: 114 FVSKYPQITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALTA----NKPNLVLSNDHIDSS 168

Query: 178 DKERWHKISNGEKLMDEFLSKDIRD-ENSVIESCFKIASTSELTNEYLHSHDDILDLMTE 236
              RW K+   + L+ E +     D E  +IE CF +AS +E        + D  +    
Sbjct: 169 S--RWPKVQKADILLQELVQSSQHDSEEELIEKCFALASNTEPAEI---DNSDKEEFTCS 223

Query: 237 TVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDDDVS 296
           ++F+PP+++    EK ++GASLP G+FYGTRSQIVILV +   T+ + ERVL++ D +V 
Sbjct: 224 SIFIPPVEIP---EKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVP 280

Query: 297 KAGIEKPINELNFEYNI 313
               + P  +L F  ++
Sbjct: 281 LHSEKHPKEKLQFNLHV 297

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  201 bits (510), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 120/322 (37%), Positives = 183/322 (56%), Gaps = 21/322 (6%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLS--RNETDPSK- 57
           MCIL  T  HPDY+LILISNRDEF +R+T  +CW++  +  +L PYD+S   N +D SK 
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQ--DGVILAPYDISNSENASDASKA 58

Query: 58  ---FGTWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNS 114
              +GTW GIN  G VS +LNLK     V      +KSRG + V FL +    +++ WN+
Sbjct: 59  ELSYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNN 118

Query: 115 YSKFLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEF 174
           Y KF + +  L+ T SF LF GD+K  ++ LIDS+ ++      K    +  VVISNS  
Sbjct: 119 YEKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSK----QPYVVISNSRV 174

Query: 175 ISNDK-ERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSEL-TNEYLHSHDDIL 231
              D+  RW K+  GE+L+ E +  ++   +  +++ CF++A TS+   N  +   D   
Sbjct: 175 NCEDEGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVTD--T 232

Query: 232 DLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYEC 291
            L  +T+FVP +K        ++G S  VG++YGTR+ IVILV+     V   E V+++ 
Sbjct: 233 SLPEKTIFVPTLK---AAGNSSMGVSKIVGEYYGTRTTIVILVDN-FNHVTMHEHVIHDS 288

Query: 292 DDDVSKAGIEKPINELNFEYNI 313
           D D+  +    P  ++ +E++I
Sbjct: 289 DKDIGLSSAMNPKTKVAYEFDI 310

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  197 bits (500), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 124/324 (38%), Positives = 197/324 (60%), Gaps = 30/324 (9%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSR--------NE 52
           MCIL  T +HP Y+LILISNRDE  +R+T  +CWN  S   +L PYD+S+        +E
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNST--ILYPYDMSKDICHDGGGDE 58

Query: 53  TDPSKFGTWCGINEFGRVSSVLNLKMDENKVEDKNVRK--KSRGYLPVKFLDNRKENSFN 110
              S+ GTWCG+N+ G++ +VLNL  +E    D +     +SRG +P+K+L +  ++ F 
Sbjct: 59  RFKSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDF-DHGFQ 117

Query: 111 DWNSYSKFLKQYPDLE-KTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVI 169
           DWN+Y KF++Q   ++ K G FNLF+GD+K  EY++I+S GQ++R+LD  +EN    +V+
Sbjct: 118 DWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLD--EEN--PYMVV 173

Query: 170 SNSEFISNDK-ERWHKISNGEKLMDEFLSKDI----RDENSVIESCFKIASTSELTNEYL 224
           SN  +    K   W KI NG KL++  ++  +    +DE  ++E CF+I+ST  L+ + +
Sbjct: 174 SNINWGDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKI 233

Query: 225 HSHDDILDLMTETVFVPPIKL-ENPVEKDNIGASLPVG-----KFYGTRSQIVILVNKER 278
             + + L+   + +FVPP+K  E  V  D  G +         K+YGTRSQIV+L  ++ 
Sbjct: 234 DGNIERLEQTKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCERKS 293

Query: 279 TTVRYMERVLYECDDDVSKAGIEK 302
             V ++ER+L+ C ++ +K   +K
Sbjct: 294 NKVTFVERILH-CKNEDAKDNTKK 316

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  181 bits (460), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 101/263 (38%), Positives = 157/263 (59%), Gaps = 15/263 (5%)

Query: 57  KFGTWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYS 116
           KFGTWCGIN+ GRV +VLNLK+D+       +   SRG +P  FL ++ +  +  WNSY+
Sbjct: 22  KFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFL-SQHDLDWEQWNSYN 80

Query: 117 KFLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSS-VVISNSEFI 175
           KF  Q+ +L+ TG FN F GD K  +Y +IDS  QT  +L   +    SS +V+SN  + 
Sbjct: 81  KFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYR 140

Query: 176 SNDKERWHKISNGEKLMDEFLSKDI-RDENSVIESCFKIASTSE----LTNEYLHSHDDI 230
              +E W K+   +K + + +  ++  D++S I  CF++ASTS      + E L S    
Sbjct: 141 YQGEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLDWQSEELLKSS--- 197

Query: 231 LDLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYE 290
            D+  +++FVPP+K    +   N+G +   G FYGTRSQIV+LV+K+R  V ++ERVL+ 
Sbjct: 198 -DVTKQSIFVPPLKFPPDL---NLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLHN 252

Query: 291 CDDDVSKAGIEKPINELNFEYNI 313
            D+ VS+   + P  +L F++++
Sbjct: 253 SDEQVSQRSPDHPAEQLKFQFDL 275

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  177 bits (448), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 176/320 (55%), Gaps = 21/320 (6%)

Query: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDP----S 56
           MCILF T +HP Y+L+LISNRDE+  RKT  +CW+   N  +L PYD++  + D     S
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSH--NDSILAPYDMALQDADGLDHGS 58

Query: 57  KFGTWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYS 116
             GTW GIN  G VS +LNL   +   +     + SRG + +++L +   N+++ WN+Y 
Sbjct: 59  PCGTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYE 118

Query: 117 KFLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEF-I 175
           KF   +P L KT  F  F GDV   ++++I+S GQT   LD   ++     V+SN     
Sbjct: 119 KFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQT---LDPFSQS--PYYVVSNGPSDG 173

Query: 176 SNDKERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSE-LTNEYLHSHDDILDL 233
           +    +W K+  G +L  + + + +   E  +++ CF +AS S+ ++N+ +  HDD   +
Sbjct: 174 AKALGQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDD--SI 231

Query: 234 MTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDD 293
              T+FVP   L N   + N+  S   G +YGTRS IV+LV+++   V   E V+++ D 
Sbjct: 232 PKRTIFVP--ALYNLSGQANL--SFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSDQ 286

Query: 294 DVSKAGIEKPINELNFEYNI 313
           D+    I  P  ++   +++
Sbjct: 287 DLDSYSILNPKEQVTHRFSL 306

>Smik_4.2 Chr4 complement(4408..6789) [2382 bp, 793 aa] {ON} YDL239C
           (REAL)
          Length = 793

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 69/138 (50%), Gaps = 18/138 (13%)

Query: 178 DKERWHKISNGEKLMDEFLSKDIRDENSVIESCFKIASTSELTNEYLHSHDDILD-LMTE 236
           +K+RWH I N +    + ++ +++++ ++ E   K A      N+Y+H H +I++ L ++
Sbjct: 548 EKKRWHDILNLKNENAQKITSELKEKLALSEKIQKNAEDK--LNDYMHEHQEIIEKLQSQ 605

Query: 237 TVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDDDVS 296
           ++ +   +L N +E  NI       + +G +++++ L   E T     E +L E      
Sbjct: 606 SLIIE--ELNNQIEDSNIRHKRITDELFGKKNEVLKL---EETVRSLKEDILQE------ 654

Query: 297 KAGIEK----PINELNFE 310
           K  +EK       ELNFE
Sbjct: 655 KLNLEKLYGDSYTELNFE 672

>NCAS0G01970 Chr7 (352294..357300) [5007 bp, 1668 aa] {ON} Anc_2.82
           YNL172W
          Length = 1668

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 47/98 (47%), Gaps = 22/98 (22%)

Query: 206 VIESCFKIASTSELTNEYLHSHDDILDLMTETVFVPPIKLENPVEKDNIGASLPVGKFYG 265
           +   CFK+    ELT+ Y +S  DILD++TE + +  ++LE          + P+G    
Sbjct: 659 ITPRCFKLLRLYELTHSYGYSDADILDILTE-LAITHLELE----------TFPLG---- 703

Query: 266 TRSQIVILVNKERTTVRYMERVLYECDDDVSKAGIEKP 303
                  ++   +TT+R +E  L +   DV  + + +P
Sbjct: 704 -------VLTPLKTTIRIIESKLSQITKDVDLSVLSRP 734

>Skud_4.15 Chr4 complement(23550..25922) [2373 bp, 790 aa] {ON}
           YDL239C (REAL)
          Length = 790

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 70/139 (50%), Gaps = 20/139 (14%)

Query: 178 DKERWHKISNGEKLMDEFLSKDIRDENSVIESCFKIASTSE-LTNEYLHSHDDIL-DLMT 235
           +K RWH I N ++   + L  ++R++ ++   C KI   +E   N Y++ H +++ +L +
Sbjct: 545 EKRRWHDILNLKEESFQKLKNELREKLTL---CEKIQKNAEDKLNNYINEHKEVINELQS 601

Query: 236 ETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDDDV 295
           +++ +   KL + VE+ N   +    +  G +S+I+     E T V   E +L E     
Sbjct: 602 QSLIIE--KLNSQVEESNNVYTKAADELMGKKSEILRF---EETIVLLKEDILQE----- 651

Query: 296 SKAGIEK----PINELNFE 310
            K  ++K    P  ELNFE
Sbjct: 652 -KLNLKKLYGDPSTELNFE 669

>NDAI0G01600 Chr7 (349960..350994) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 37/57 (64%), Gaps = 6/57 (10%)

Query: 186 SNG--EKLMDEFLSK-DIRDENSVI--ESCFKIASTSELT-NEYLHSHDDILDLMTE 236
           SNG  E+L+ EFL K +IR E  VI  ++ F++  T +L   E+ HS +D+LDL+ +
Sbjct: 65  SNGKSERLLGEFLRKFEIRRETVVILTKTYFRVDETLDLPLGEFPHSENDVLDLVNQ 121

>KAFR0C03350 Chr3 complement(683059..685677) [2619 bp, 872 aa] {ON}
           Anc_8.73 YFL003C
          Length = 872

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 58  FGTWCGINEFGRVSSVLNLK-MDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYS 116
           F T CGI+   ++S V N K + +N++ DK     + G   VK+ D+  + S N++  YS
Sbjct: 189 FSTQCGISAINKLSIVENTKDLLKNEMLDKTYALAAIGA-AVKYTDDVVKKSNNEFYHYS 247

Query: 117 KFLKQYPDLEKT 128
            F  +Y   E T
Sbjct: 248 HFRMRYECSENT 259

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (54%), Gaps = 5/75 (6%)

Query: 136 GDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISNDKERWHKISNGEKLM--D 193
            D+K++   L     Q K  L  +D   KS+V++ N  FI ND ER+  I   EKLM   
Sbjct: 47  SDLKREIKKLQKQREQIKTWLSKEDVKDKSNVLLENRRFIENDMERFKTI---EKLMKAK 103

Query: 194 EFLSKDIRDENSVIE 208
           +F ++ + + +S+I+
Sbjct: 104 QFSNEALTNPDSIID 118

>NCAS0H01560 Chr8 (300838..301683) [846 bp, 281 aa] {ON} Anc_5.333
           YDR310C Region orthologous to S. cerevisiae SUM1/YDR310C
           contains an in-frame stop codon in N. castellii
          Length = 281

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 49/111 (44%), Gaps = 10/111 (9%)

Query: 126 EKTGSFNLFIGDVKKQEYAL----IDSFGQTKRIL---DGKDE-NGKSSVVISNSEFISN 177
           ++  S  L  G+  K+E  L     +S G  +R L   DGK+  N KS +V+S  EFI  
Sbjct: 31  KQISSEGLIKGETPKKERPLKMEEPESLGPPERYLYKFDGKNYVNKKSGLVVSTGEFIRA 90

Query: 178 DKERWHKISNGEKLMDEFLSKDIRDENSVIESCF--KIASTSELTNEYLHS 226
             E   K S      D  L     D+   +ES F  KI     ++  YLH+
Sbjct: 91  HYEWLGKTSASSNHSDTNLGPLEIDDLIRVESQFAAKILGKPPMSKHYLHT 141

>Suva_8.107 Chr8 complement(197136..199787) [2652 bp, 883 aa] {ON}
           YOR058C (REAL)
          Length = 883

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 178 DKERWHKISNGEKLMDEFLSKDIRDENSVIESCFKIASTSELTNEYL----HSHDDILDL 233
           D+ER  KI    K M+   S+ +  +N ++E C K+ +  +++ EY+    HSH  +   
Sbjct: 379 DRERMRKIDAALKKMEAIHSERMNKKNLLMEQCQKLWTKLKISQEYVKSFTHSHSGLSTE 438

Query: 234 MTETVFVPPIKLE 246
             E + V   +LE
Sbjct: 439 TLEKINVELTRLE 451

>TBLA0J00720 Chr10 (167109..169553) [2445 bp, 814 aa] {ON} Anc_5.603
           YOR023C
          Length = 814

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 168 VISNSEFISNDKERW--HKISNGEKLMDEFLSKDIRDENSVI--ESCFKIASTSELTNEY 223
            IS+ E ISN+ E     KI NG  ++    +++I+D NS    E  FKIA T  L + +
Sbjct: 96  AISSGEKISNEMEATLNEKICNGSSIIRNHSTQNIKDPNSGASKEIQFKIAKTEILDSLH 155

Query: 224 LHS 226
           LHS
Sbjct: 156 LHS 158

>CAGL0F06589g Chr6 (648302..649711) [1410 bp, 469 aa] {ON} weakly
           similar to uniprot|Q04746 Saccharomyces cerevisiae
           YMR065w KAR5 nuclear fusion protein
          Length = 469

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 141 QEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISNDKERWHKISNGEKLMDEFLSKDI 200
           QE A+I++F      +       KSSVV    EF SN K+++  + N     +  LS+ I
Sbjct: 132 QEKAIIETFLNITDFMADFHNQFKSSVVSETQEFQSNMKDKFAGVYNQFTHFESLLSQMI 191

Query: 201 RDENSVIESCFKIASTSELTNEYL 224
           +  + +I     +A  ++L+ E++
Sbjct: 192 QKHSGIINDSI-VAIKNKLSTEFV 214

>SAKL0E12518g Chr5 (1035137..1036321) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P53890 Saccharomyces cerevisiae
           YNL166C BNI5 Protein involved in organization of septins
           at the mother-bud neck may interact directly with the
           Cdc11p septin localizes to bud neck in a septin-
           dependent manner
          Length = 394

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 8/56 (14%)

Query: 101 LDNRKENSFNDWNSYSKFLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRIL 156
           LDN++E   N   S+S+          T + NLF+   + Q+   ID+ GQ++ +L
Sbjct: 30  LDNQEEPEGNACKSFSQLT--------TNAGNLFVQSAESQDKKQIDTKGQSQEVL 77

>Kpol_529.6 s529 complement(10311..13541) [3231 bp, 1076 aa] {ON}
           complement(10311..13541) [3231 nt, 1077 aa]
          Length = 1076

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 9/89 (10%)

Query: 161 ENGKSSVVISNSE------FISNDKERWHKISNGEKLMDEFLSKDIR-DENSVIESCFK- 212
           +NG  +  + N E      F  +D+E  H  SNG KL  E  S  I   +N  +ES  + 
Sbjct: 496 KNGSKTPALDNGEEYIFGVFFQSDEEDSHSGSNG-KLKGETPSGSISFKKNLSLESPLRH 554

Query: 213 IASTSELTNEYLHSHDDILDLMTETVFVP 241
           + STS + N YL S D+  +++ +   +P
Sbjct: 555 LESTSSVKNGYLSSDDENKNILLDEAHIP 583

>YGL090W Chr7 (343319..344584) [1266 bp, 421 aa] {ON}  LIF1Component
           of the DNA ligase IV complex that mediates nonhomologous
           end joining in DNA double-strand break repair;
           physically interacts with Dnl4p and Nej1p; homologous to
           mammalian XRCC4 protein
          Length = 421

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 10/53 (18%)

Query: 266 TRSQIVILVNKERTTVRYMERVLYE-----CDDDVSKAG-----IEKPINELN 308
           TR+ +V L+N+++  +R +  +L +      DDDV  +      ++KPI+ELN
Sbjct: 208 TRAMMVTLLNEKKKKIRELHEILRQNNIKLSDDDVLDSALINTEVQKPISELN 260

>NDAI0K02310 Chr11 complement(517057..519069) [2013 bp, 670 aa] {ON}
           Anc_6.357 YNR039C
          Length = 670

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 17/70 (24%)

Query: 76  LKMDENKVEDK--NVRKKSRGYLPVKFLDNRKE---------------NSFNDWNSYSKF 118
           L +++ K+E K   VR++SR  LP+  L++ K                NS   W   S++
Sbjct: 525 LHVEDTKIETKKQQVRQRSRSTLPIAVLNSNKSSITSHNDGMLTFTFLNSIFKWGKNSQY 584

Query: 119 LKQYPDLEKT 128
           L ++P   K+
Sbjct: 585 LNKHPSAIKS 594

>Skud_15.322 Chr15 (580909..581859) [951 bp, 316 aa] {ON} YOR158W
           (REAL)
          Length = 316

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 149 FGQTKRILDGKDENGKSSVVISNSEFISNDKERWHKISNGEKLMDEFLSKDIRDENSVIE 208
           FG  K +L G   N      I+N+   S   E++  IS    L+D FL+KD+RD +  I+
Sbjct: 244 FGNKKSLLSG---NSTLQTQINNAIMGSLTNEKFFDIS----LVDSFLNKDLRDISDRID 296

Query: 209 SCFKIAS 215
           S   ++S
Sbjct: 297 SKLNLSS 303

>Smik_6.53 Chr6 complement(99374..102454) [3081 bp, 1026 aa] {ON}
           YFL025C (REAL)
          Length = 1026

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 26/53 (49%)

Query: 134 FIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFISNDKERWHKIS 186
            IG + +  +  ID  GQ  R+L  + + G+SS    N + ++    ++H  S
Sbjct: 6   LIGGITRPIFNKIDPSGQYSRVLAARKDQGQSSTKYINKDKLAKQPYKYHVFS 58

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,781,274
Number of extensions: 1846319
Number of successful extensions: 6693
Number of sequences better than 10.0: 118
Number of HSP's gapped: 6862
Number of HSP's successfully gapped: 118
Length of query: 314
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 205
Effective length of database: 40,982,805
Effective search space: 8401475025
Effective search space used: 8401475025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)