Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D032503.486ON21921910431e-145
NDAI0G009803.486ON2341672807e-30
Kpol_1017.103.486ON2342342651e-27
KNAG0B008503.486ON2251522449e-25
YGR126W3.486ON2301532134e-20
CAGL0I10604g3.486ON2112042106e-20
Smik_6.2223.486ON2301592047e-19
Suva_7.4143.486ON2301592031e-18
Skud_7.4373.486ON2301532021e-18
KAFR0C019203.486ON2232201984e-18
KLTH0F14696g3.486ON2191661906e-17
NCAS0E008503.486ON2302101792e-15
Kwal_55.212153.486ON1421091691e-14
TDEL0D055403.486ON2161531689e-14
SAKL0F02904g3.486ON2221521653e-13
KLLA0E04709g3.486ON1661461263e-08
NCAS0E007503.503ON620371145e-06
NDAI0I027703.503ON626301137e-06
KNAG0B007303.503ON622631128e-06
KAFR0C020303.503ON624301092e-05
CAGL0I10384g3.503ON630681092e-05
TBLA0D029003.503ON6911641074e-05
Kwal_47.189193.503ON640321065e-05
TDEL0D057103.503ON616371065e-05
KLTH0G02266g3.503ON644601057e-05
KLLA0E03829g3.503ON609341031e-04
NCAS0F036203.503ON634421031e-04
Smik_6.2333.503ON614401022e-04
YPR156C (TPO3)3.503ON622301022e-04
TPHA0D033103.503ON613301012e-04
Smik_16.4083.503ON622301012e-04
Skud_16.4503.503ON622301012e-04
Skud_7.4483.503ON611401012e-04
YGR138C (TPO2)3.503ON614401012e-04
Suva_16.4843.503ON622301003e-04
SAKL0F02442g3.503ON610371003e-04
Kpol_1017.33.503ON62124993e-04
Suva_7.4253.503ON61340984e-04
ZYRO0G19646g3.503ON59458969e-04
AFR322C3.503ON59224790.12
NDAI0B027008.152ON63067657.3
KNAG0E019102.262ON90045648.2
KNAG0I015301.349ON52182648.5
KAFR0F018401.190ON81566648.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D03250
         (219 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...   406   e-145
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...   112   7e-30
Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...   106   1e-27
KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...    99   9e-25
YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...    87   4e-20
CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...    86   6e-20
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...    83   7e-19
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...    83   1e-18
Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...    82   1e-18
KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...    81   4e-18
KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...    78   6e-17
NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...    74   2e-15
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...    70   1e-14
TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....    69   9e-14
SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...    68   3e-13
KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...    53   3e-08
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               49   5e-06
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     48   7e-06
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    48   8e-06
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    47   2e-05
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    47   2e-05
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    46   4e-05
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    45   5e-05
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    45   5e-05
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    45   7e-05
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    44   1e-04
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    44   1e-04
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    44   2e-04
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    44   2e-04
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    44   2e-04
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    44   2e-04
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    44   2e-04
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    44   2e-04
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    44   2e-04
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    43   3e-04
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    43   3e-04
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    43   3e-04
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    42   4e-04
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    42   9e-04
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    35   0.12 
NDAI0B02700 Chr2 complement(672049..673941) [1893 bp, 630 aa] {O...    30   7.3  
KNAG0E01910 Chr5 complement(394511..397213) [2703 bp, 900 aa] {O...    29   8.2  
KNAG0I01530 Chr9 (297545..299110) [1566 bp, 521 aa] {ON} Anc_1.3...    29   8.5  
KAFR0F01840 Chr6 complement(360877..363324) [2448 bp, 815 aa] {O...    29   8.8  

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score =  406 bits (1043), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 203/219 (92%), Positives = 203/219 (92%)

Query: 1   MVTDNYSKSTTXXXXXXXXXXXXXXXXYTPQEFIGDTLGKESSTKMDDRASHLSHAIKET 60
           MVTDNYSKSTT                YTPQEFIGDTLGKESSTKMDDRASHLSHAIKET
Sbjct: 1   MVTDNYSKSTTDSENFDDVSSFNSDNSYTPQEFIGDTLGKESSTKMDDRASHLSHAIKET 60

Query: 61  RSGTSDNNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRRADIILPASMEGN 120
           RSGTSDNNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRRADIILPASMEGN
Sbjct: 61  RSGTSDNNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRRADIILPASMEGN 120

Query: 121 SNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNTVKSRNEGG 180
           SNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNTVKSRNEGG
Sbjct: 121 SNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNTVKSRNEGG 180

Query: 181 LNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLFY 219
           LNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLFY
Sbjct: 181 LNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLFY 219

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score =  112 bits (280), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 105/167 (62%), Gaps = 8/167 (4%)

Query: 55  HAIKETRSGTSDNNTIKPVTSN--DVHRIVSRNIMDNNVESEEALKTQLTNMESRR-ADI 111
           H  + +R+ T+   T+K + SN  D+ + ++ NIM++  E+ ++L  Q  N   +  ADI
Sbjct: 72  HGEEPSRTSTA---TLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADI 128

Query: 112 ILPASMEGNSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNN 171
             P +  G + FPEEY +ET TGLV  KT+E ++++++I S NSR+S      K++++NN
Sbjct: 129 NTPLNA-GTAEFPEEYRIETETGLVKAKTIESLRRQESIASANSRRSQDQGSFKSARTNN 187

Query: 172 TVKSRNEGGLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218
           T KSR    L+P KLN AVEKNK+ELEKY  HK +K  IK    +LF
Sbjct: 188 TRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKG-IKGFFNRLF 233

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score =  106 bits (265), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 114/234 (48%), Gaps = 28/234 (11%)

Query: 4   DNYSKSTTXXXXXXXXXXXXXXXXYTPQEFIGDTLGKESSTKMDDRASHLSHAIKETRSG 63
           DN ++++T                + PQEF G+         +D    + +    +T+SG
Sbjct: 6   DNNNRNSTDSSNFEDISSFDSQNSFAPQEFKGN---------LDSNNDNDTGVFNKTKSG 56

Query: 64  TSDNNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRRADIILPASMEGNSNF 123
           TS+ NT+K  +SN++ +IV+RN ++NN E+   L+   + +     + +LPA+ME N+ F
Sbjct: 57  TSETNTLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSKVPTENVLPATMENNAAF 116

Query: 124 PEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKA----------------- 166
           PEEY +ET TGLVP+KTLE++   K+       +                          
Sbjct: 117 PEEYRIETKTGLVPIKTLEEMHSNKSNGKNEENEHHNHQHNHHNHHNHHHHHEKNDEDKD 176

Query: 167 --SKSNNTVKSRNEGGLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218
              K  +  +    G L    ++  VE+NK++LEK++ HK E NP+KK ++K  
Sbjct: 177 VEQKEKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFL 230

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score = 98.6 bits (244), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 97/152 (63%), Gaps = 4/152 (2%)

Query: 69  TIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRR--ADIILPASMEGNSNFPEE 126
           T+    SN + R+V++N M+N  ES +AL+++  +   RR   DI  P ++   S+FPEE
Sbjct: 75  TLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLT-QSHFPEE 133

Query: 127 YTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNTVKSRNEGGLNPAKL 186
           Y +ET TGLV +KT+E +K + +  + NS+KS  +S    +   ++++   E GLN  KL
Sbjct: 134 YQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSSMEEHGEAGLNAEKL 193

Query: 187 NAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218
           N+AVE+N++ELE+Y+ ++ +K  IK  L K+F
Sbjct: 194 NSAVERNRKELERYEKNRGKKG-IKGFLSKMF 224

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score = 86.7 bits (213), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 93/153 (60%), Gaps = 5/153 (3%)

Query: 69  TIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRR-ADIILPASMEG-NSNFPEE 126
           T+K  TSN + ++V+ N ++ N E+ ++LK    N+  +   DI  P +    ++ FPEE
Sbjct: 79  TLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEE 138

Query: 127 YTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVS-SELKASKSNNTVKSRNEGGLNPAK 185
           Y +ET TGLV +KTLE +K++ +  S   ++ +   +++ +++S  T  S+    L P K
Sbjct: 139 YRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHSTRSKVTTNSQG-SSLEPNK 197

Query: 186 LNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218
           LN AVEKNK+ +EKYQ HK+EK  IK    ++F
Sbjct: 198 LNMAVEKNKKRIEKYQKHKSEKG-IKGFFHRIF 229

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score = 85.5 bits (210), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 109/204 (53%), Gaps = 32/204 (15%)

Query: 28  YTPQEFIG------DTLGKESS-----TKMDDRASHLSHAIKETRSGTSDNNTIKPVTSN 76
           Y P+ F G      + L ++++     T MDD  S  S A            T+K + S 
Sbjct: 26  YKPEPFTGLEHTKNENLSRKATNASQGTYMDDATSKHSGA------------TLKKLDSL 73

Query: 77  DVHRIVSRNIMDNNVESEEALKTQLTNMESRRA--DIILPASMEGNSNFPEEYTMETTTG 134
            + ++V++N +  N E+ E+LK +  +M+ R+A  D   P +  G + FPEEY +ET TG
Sbjct: 74  AIEKVVTQNAVAGNSETIESLKAKGLDMQ-RKAIPDYNAPLTTTGTNQFPEEYRLETDTG 132

Query: 135 LVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNTVKSRNEGGLNPAKLNAAVEKNK 194
           LV +KTLE +K+K T  S NS  S     +  S+SN     ++E      K+N AVE+NK
Sbjct: 133 LVKMKTLETLKRKSTQVSRNSDLSSKDKSISKSQSN-----KSEVSDIAQKINMAVERNK 187

Query: 195 EELEKYQHHKTEKNPIKKMLFKLF 218
           +E+ KYQ HK+EK  IK    ++F
Sbjct: 188 KEIAKYQKHKSEKG-IKGFFHRMF 210

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score = 83.2 bits (204), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 93/159 (58%), Gaps = 17/159 (10%)

Query: 69  TIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRR-ADIILPASMEG-NSNFPEE 126
           T+K  TSN + ++V++N ++   E+ ++LK    N++ +   DI  P +    ++ FPEE
Sbjct: 79  TLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDITAPVTNSAHDATFPEE 138

Query: 127 YTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSE-------LKASKSNNTVKSRNEG 179
           Y +ET TGLV +KTLE +++      E+SR S    E       + +++S  T  S+   
Sbjct: 139 YRLETETGLVKLKTLETLRR------EDSRVSSTKKEHNNDHTDIHSTRSKVTTNSQG-S 191

Query: 180 GLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218
            L P KLN AVEKNK+++E+YQ HK+EK  IK    ++F
Sbjct: 192 SLEPNKLNMAVEKNKKKIEQYQKHKSEKG-IKGFFHRIF 229

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score = 82.8 bits (203), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 91/159 (57%), Gaps = 17/159 (10%)

Query: 69  TIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRRA-DIILPASMEG-NSNFPEE 126
           T+K  TSN + ++V+ N ++ N E+ ++LK +  N+  +   DI  P +    ++ FPEE
Sbjct: 79  TLKRPTSNSIEKMVTHNALEGNSETVDSLKKEGLNLNKKGTPDITAPVTNSAHDAAFPEE 138

Query: 127 YTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVS-------SELKASKSNNTVKSRNEG 179
           Y +ET TGLV +KTLE +K+      E+SR S          ++  +++S  T  S+   
Sbjct: 139 YRLETETGLVKLKTLETLKR------EDSRVSGAKKDHGHDHTDAHSTRSKATAYSQG-S 191

Query: 180 GLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218
            L   KLN AVEKNK+ +EKYQ HK EK  IK +  ++F
Sbjct: 192 SLESDKLNIAVEKNKKRIEKYQKHKGEKG-IKGLFHRMF 229

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score = 82.4 bits (202), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 93/153 (60%), Gaps = 5/153 (3%)

Query: 69  TIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRR-ADIILPASMEG-NSNFPEE 126
           T+K  +SN + ++++ N ++ N E+ ++LK +  N+  +   DI  P +    N  FPEE
Sbjct: 79  TLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDITAPVTNSAHNGAFPEE 138

Query: 127 YTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNTVKSRNEG-GLNPAK 185
           Y +ET TGLV +KTLE +K++ +  S +++K   +    A  + + V + ++G  L   K
Sbjct: 139 YRLETETGLVKLKTLETLKREDSRVS-SAKKEHTNDHADAHSTRSKVTTYSQGSSLESDK 197

Query: 186 LNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218
           LN AVEKNK+++E+Y+ HK+EK  IK    ++F
Sbjct: 198 LNMAVEKNKKKIEQYRKHKSEKG-IKGFFHRIF 229

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score = 80.9 bits (198), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 107/220 (48%), Gaps = 45/220 (20%)

Query: 28  YTPQEFIGDTLGKESSTKMD------DRASHLSHAIKETR-------------------- 61
           Y P+ F+G  + +E++ +++      D  SH S   +E +                    
Sbjct: 19  YKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVDPLKQVQTNDSFWSFRSVS 78

Query: 62  --SGTSDNNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRRA-DIILPASME 118
             S TS  N +K   S D+ RIV++N M    E+ ++L+    ++  R   DI  P S E
Sbjct: 79  NTSRTSSKN-LKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRAVPDINSPISHE 137

Query: 119 GNSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNTVKSRNE 178
             S   +E   ET TGL+  KTLE + +  T +S + RK L       + ++NT      
Sbjct: 138 --SKLIDESKFETDTGLIKTKTLETLNRSNTRNSSSKRKIL------GNDNSNT------ 183

Query: 179 GGLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218
            GL+P ++N  VE+N+++LEKYQ HK EK  +K   +K+F
Sbjct: 184 SGLDPERMNMVVERNRKKLEKYQQHKKEKG-LKGFFYKIF 222

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score = 77.8 bits (190), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 91/166 (54%), Gaps = 25/166 (15%)

Query: 67  NNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRR-ADIILPASMEGNSNFPE 125
           N T++   SN + +I++ N  +   E+ E+LK    N++ +   DI  PA+   N  FPE
Sbjct: 64  NGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAANYKNCAFPE 123

Query: 126 EYTMETTTGLVPVKTLEDIKK-------------KKTIDSENSRKSLVSSELKASKSNNT 172
           EY MET TGLV  +TL  + +             KK+I + N   S  +S+L  + +NNT
Sbjct: 124 EYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTAN---STTNSDL--ASANNT 178

Query: 173 VKSRNEGGLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218
           +      GL+  KL  AVEKN+++++KYQ HK+    +++ L K+F
Sbjct: 179 IN-----GLDGEKLRRAVEKNQKKIDKYQKHKSSGG-LRRFLGKIF 218

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score = 73.6 bits (179), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 108/210 (51%), Gaps = 25/210 (11%)

Query: 28  YTPQEFIG-------------DTL-GKESSTKMDD-RASHLSHAIKETRSGTSDNNTIKP 72
           Y P+ F G             DTL G E+  K +   A+  S   K+  +  +  +T++ 
Sbjct: 26  YQPEPFTGVKEPTAYKGTDRKDTLSGDETELKQEHTNATATSSHTKDGITSRTSMSTLRR 85

Query: 73  VTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRRADIILPASMEGNSN---FPEEYTM 129
             SN + R+++ N  + N E+  +L  +  ++ +++A + + A +  N     FPEEY +
Sbjct: 86  PDSNAIERVITSNAKEGNTETLGSLAAKGLDL-NKKATLDINAPLTSNPADVAFPEEYNL 144

Query: 130 ETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNTVKS-RNEGGLNPAKLNA 188
           ET TGLV  KT+E ++++ +  S   R   V S     KS  T KS R+   L   KLN 
Sbjct: 145 ETETGLVKAKTIETLRRETSRVSSTRRGDDVVSH----KSQATGKSQRSAQSLQAEKLNL 200

Query: 189 AVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218
           AVEKNK+ELEK + HK +K  +K  + +LF
Sbjct: 201 AVEKNKKELEKIEKHKHQKG-LKGFMNRLF 229

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score = 69.7 bits (169), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 64/109 (58%), Gaps = 5/109 (4%)

Query: 114 PASMEGNSNFPEEYTMETTTGLVPVKTLEDIKK---KKTIDSENS-RKSLVSSELKASKS 169
           PA+   N  FPEEY +ET TGLV V+TL+ + +   + +I S NS RKS+ S+       
Sbjct: 34  PAANFTNCEFPEEYQLETDTGLVKVQTLQKLNRLESRTSIRSGNSQRKSMRSTPSTDHSI 93

Query: 170 NNTVKSRNEGGLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218
           + +    +  GL+  KL  AVEKNK +++KYQ HK     +KK L K+F
Sbjct: 94  SPSAGRSSNSGLDAEKLRKAVEKNKRQIDKYQKHKASGG-LKKFLGKIF 141

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score = 69.3 bits (168), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 80/153 (52%), Gaps = 10/153 (6%)

Query: 75  SNDVHRIVSRNIMDNNVESEEALKTQLTNMESRR-ADIILPASMEGN-SNFPEEYTMETT 132
           SN + + V+ N M+   E+ ++L+    + E +   DI  P +   + S FPEEY +ET 
Sbjct: 64  SNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNADTSQFPEEYRIETQ 123

Query: 133 TGLVPVKTLEDIKKKKT-----IDSENSRKSLVSSEL--KASKSNNTVKSRNEGGLNPAK 185
           TGLV +KTL D+ +  T      D + SRKS     +  K     +T K+  E   N   
Sbjct: 124 TGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDTAKAEQEAAQNAEN 183

Query: 186 LNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218
           L  A+EKNK  +EK++ H+ EK  +K  + +LF
Sbjct: 184 LEHAIEKNKHRIEKFEKHRHEKG-LKGFVHRLF 215

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score = 68.2 bits (165), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 90/152 (59%), Gaps = 6/152 (3%)

Query: 68  NTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRR-ADIILPASMEGNSNFPEE 126
           NT+K + SN + ++++ N ++ N E+ E+LKT+  ++  +   D   PA     S FPEE
Sbjct: 75  NTLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRSQFPEE 134

Query: 127 YTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNTVKSRNEGGLNPAKL 186
           Y +ET TGLV VKTL+ + +  T  S  ++ S  +  ++A  +++  +     G +  KL
Sbjct: 135 YQIETETGLVKVKTLQSLNRLDTRVSLGNKPS-TNQNMEAESAHDEQRPV---GYDEEKL 190

Query: 187 NAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218
             AV+KNK+++EKYQ HK EK  IK  + +LF
Sbjct: 191 KKAVDKNKKKIEKYQKHKHEKG-IKGFMSRLF 221

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score = 53.1 bits (126), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 75/146 (51%), Gaps = 19/146 (13%)

Query: 74  TSNDVHRIVSRNIMDNNVESEEALKTQLTNME-SRRADIILPASMEGNSNFPEEYTMETT 132
           T+ +V   V  N+     +S ++LK   TN++ S++A       +   + FPEEY +ET 
Sbjct: 38  TTQEVEDYVKDNVQKGETDSIDSLKA--TNLDLSKKAIPGFNQPIAEGAEFPEEYEIETR 95

Query: 133 TGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNTVKSRNEGGLNPAKLNAAVEK 192
           TGLV V TL  + +  T  + +S K       K++K  NT       G +  KL   +E+
Sbjct: 96  TGLVKVATLHQLNRLDTRVTTHSSK-------KSTKEKNT-----SCGYDNDKLQKCIER 143

Query: 193 NKEELEKYQHHKTEKNPIKKMLFKLF 218
           N++E++ Y  HK  K+  KK + KLF
Sbjct: 144 NQKEIDSY--HK--KSGFKKFIGKLF 165

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (75%)

Query: 110 DIILPASMEGNSNFPEEYTMETTTGLVPVKTLEDIKK 146
           DI  P S + N+ FPEEYTMETTTGLVPV TL+ + +
Sbjct: 65  DINAPQSSKKNAIFPEEYTMETTTGLVPVATLQSMGR 101

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/30 (66%), Positives = 24/30 (80%)

Query: 120 NSNFPEEYTMETTTGLVPVKTLEDIKKKKT 149
           N+ FPEEYTMETTTGLVPV TL+ + +  T
Sbjct: 81  NTIFPEEYTMETTTGLVPVSTLQSLGRTAT 110

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 1/63 (1%)

Query: 110 DIILPASMEGNSNFPEEYTMETTTGLVPVKTLEDIKKKKT-IDSENSRKSLVSSELKASK 168
           D+  P + +  + FPEEYTMET TGLVPV TL+ I +  T I    +R+   S  +++S 
Sbjct: 70  DVNAPQTAKKTAIFPEEYTMETPTGLVPVATLQSIGRTATSISRTRTRQMDRSISMRSSH 129

Query: 169 SNN 171
           SN+
Sbjct: 130 SND 132

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%)

Query: 120 NSNFPEEYTMETTTGLVPVKTLEDIKKKKT 149
           N+ FPEEYT+ETTTGLVPV TL+ + +  T
Sbjct: 80  NAIFPEEYTIETTTGLVPVATLQSLGRTST 109

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 110 DIILPASMEGNSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKS 169
           D+  P +   N+ FPEEYTMET TGLVPV TL+ + +  T  S++  + +  S   + +S
Sbjct: 70  DVNAPQTTTKNAIFPEEYTMETPTGLVPVATLQSLGRTSTAISKSRTRQIERS--VSRRS 127

Query: 170 NNTVKSRN 177
            N   S N
Sbjct: 128 QNIAASSN 135

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 41/164 (25%), Positives = 69/164 (42%), Gaps = 31/164 (18%)

Query: 30  PQEFIGDTLGKESSTKMDDRA-SHLSHAIKETRSGTSDNNTIKPVTSNDVHRIVSRNIMD 88
           PQ++I  ++ ++S   +     S+L+       S  S N  +K V +  V     ++++D
Sbjct: 25  PQQYIYQSVSRQSRDDLQSSINSYLTTTPTNRSSNASTNQRLKLVKTETV-----KSLID 79

Query: 89  NNVESEEALKTQLTNMESRRADIILPASMEGNSNFPEEYTMETTTGLVPVKTLEDIKKKK 148
             V S            S++A             FPEEYT+ET TGLVPV TL  + +  
Sbjct: 80  MGVSSYIPNPAINAPKTSKKAI------------FPEEYTLETETGLVPVSTLHSLGRTN 127

Query: 149 TIDSENSRKSLVSSELKASKSNNTVKSRNEGGLNPAKLNAAVEK 192
           T              L   ++ +T+  RN    + A+ +  +EK
Sbjct: 128 T-------------NLSRQRTRHTLSRRNTRIASSAQHDTTLEK 158

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%)

Query: 115 ASMEGNSNFPEEYTMETTTGLVPVKTLEDIKK 146
           A+  G + FPEEYT+ET TGLVPV TL+ + +
Sbjct: 76  AATSGKAIFPEEYTLETATGLVPVATLQSLGR 107

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (67%)

Query: 123 FPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSL 159
           FPEEYTMET TGLVPV TL+ I +  T  S +  + +
Sbjct: 77  FPEEYTMETPTGLVPVATLQSIGRTSTAISRSRTRQM 113

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 119 GNSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNTVKSRNE 178
           G + FPEEYT+ET TGLVPV TL+ + + ++  S  +R  ++     A +  +   S NE
Sbjct: 86  GAAIFPEEYTLETATGLVPVATLQSLGRTQSAVSR-TRTRVMREGAAARRRGSDAGSENE 144

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 24/34 (70%)

Query: 116 SMEGNSNFPEEYTMETTTGLVPVKTLEDIKKKKT 149
           S+  N+ FPEEYT+ET TGLVPV TL  + +  T
Sbjct: 74  SVAKNAIFPEEYTLETATGLVPVATLHSLGRTPT 107

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 27/42 (64%)

Query: 105 ESRRADIILPASMEGNSNFPEEYTMETTTGLVPVKTLEDIKK 146
           E+   DI  P   +  + FPEEYTMET TGLVPV TL+ I +
Sbjct: 64  EAPLPDINAPQGSKKPAIFPEEYTMETPTGLVPVVTLQSIGR 105

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 120 NSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSL 159
           N+ FPEEYTMET +GLVPV TL+ + +  T  S    K +
Sbjct: 73  NNIFPEEYTMETPSGLVPVATLQSMGRTATALSRTRTKQM 112

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 21/30 (70%)

Query: 120 NSNFPEEYTMETTTGLVPVKTLEDIKKKKT 149
           N  FPEEYT+ET TGLVPV TL  I +  T
Sbjct: 78  NKIFPEEYTLETPTGLVPVATLHSIGRTST 107

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 22/30 (73%)

Query: 120 NSNFPEEYTMETTTGLVPVKTLEDIKKKKT 149
           +S FPEEYTMET TGLVPV TL  + +  T
Sbjct: 73  HSIFPEEYTMETPTGLVPVATLHSLGRNST 102

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 21/30 (70%)

Query: 120 NSNFPEEYTMETTTGLVPVKTLEDIKKKKT 149
           N  FPEEYT+ET TGLVPV TL  I +  T
Sbjct: 78  NKIFPEEYTLETPTGLVPVATLHSIGRTST 107

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 21/30 (70%)

Query: 120 NSNFPEEYTMETTTGLVPVKTLEDIKKKKT 149
           N  FPEEYT+ET TGLVPV TL  I +  T
Sbjct: 78  NKIFPEEYTLETPTGLVPVATLHSIGRTST 107

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 120 NSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSL 159
           N+ FPEEYTMET +GLVPV TL+ + +  +  S    K L
Sbjct: 73  NNIFPEEYTMETPSGLVPVATLQSMGRTASALSRTRTKQL 112

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 120 NSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSL 159
           N+ FPEEYTMET +GLVPV TL+ + +  +  S    K L
Sbjct: 73  NNIFPEEYTMETPSGLVPVATLQSMGRTASALSRTRTKQL 112

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 21/30 (70%)

Query: 120 NSNFPEEYTMETTTGLVPVKTLEDIKKKKT 149
           N  FPEEYT+ET TGLVPV TL  I +  T
Sbjct: 78  NKIFPEEYTIETPTGLVPVATLHSIGRTST 107

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 23/37 (62%)

Query: 123 FPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSL 159
           FPEEYTMET TGLVPV TL  I +  +  S    + L
Sbjct: 75  FPEEYTMETPTGLVPVATLHSIGRTTSAVSRTRTRQL 111

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/24 (70%), Positives = 20/24 (83%)

Query: 123 FPEEYTMETTTGLVPVKTLEDIKK 146
           FPEEYTMET TGLVPV TL+ + +
Sbjct: 79  FPEEYTMETPTGLVPVATLQSLGR 102

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 26/40 (65%)

Query: 120 NSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSL 159
           N+ FPEEYTMET +GLVPV TL+ + +  +  S    + L
Sbjct: 73  NNIFPEEYTMETPSGLVPVATLQSMGRTASALSRTRTRQL 112

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 92  ESEEALKTQLTNMESRRADIILPASMEGNSNFPEEYTMETTTGLVPVKTLEDIKKKKT 149
           E+ E L+T      +   D++ P +      FPEEYTMET +G+VP+  LE + +  T
Sbjct: 41  ETAETLQTMGMARGTPLPDVVAP-TYAAAPVFPEEYTMETPSGIVPLAQLESLGRTVT 97

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 18/24 (75%)

Query: 123 FPEEYTMETTTGLVPVKTLEDIKK 146
           FPEEYT+ET TGLV + TL  + +
Sbjct: 76  FPEEYTLETPTGLVKIATLVSLGR 99

>NDAI0B02700 Chr2 complement(672049..673941) [1893 bp, 630 aa] {ON}
           Anc_8.152 YGL192W
          Length = 630

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 9/67 (13%)

Query: 105 ESRRADIILPASM---EGNSNFPEEYTMETTTGLVPVKTLEDI---KKKKTIDSENSRKS 158
           E +  +II+P S+     N+  P E+   T   +VP+K L  +   +K K  DS +SRK 
Sbjct: 59  ELKDVEIIVPGSIIFKNENAPSPHEFDTITFIDVVPLKILYYMHFERKDKNSDSFDSRK- 117

Query: 159 LVSSELK 165
             SSELK
Sbjct: 118 --SSELK 122

>KNAG0E01910 Chr5 complement(394511..397213) [2703 bp, 900 aa] {ON}
           Anc_2.262 YIL109C
          Length = 900

 Score = 29.3 bits (64), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 146 KKKTIDSENSRKSLVSSELKA--SKSNNTVKSRNEGGLNPAKLNA 188
           +K   DS +S + L+ S+L A  S     + SRNEGG+ P K  A
Sbjct: 646 QKVMYDSLSSARELLKSKLLAIMSVYKKEISSRNEGGILPLKFPA 690

>KNAG0I01530 Chr9 (297545..299110) [1566 bp, 521 aa] {ON} Anc_1.349
           YFR028C
          Length = 521

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 38/82 (46%)

Query: 72  PVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRRADIILPASMEGNSNFPEEYTMET 131
           P+   + +R+  + + D   E +       T  +S+ +D ++P+S   +   P+    + 
Sbjct: 359 PLVPVEQYRLQKKKLKDGRKEWQNGRDVTTTPGQSKLSDSVMPSSAFSSVAVPQHSPGQP 418

Query: 132 TTGLVPVKTLEDIKKKKTIDSE 153
             G     T+EDI K K ID++
Sbjct: 419 RKGQNGSNTIEDIAKVKNIDAK 440

>KAFR0F01840 Chr6 complement(360877..363324) [2448 bp, 815 aa] {ON}
           Anc_1.190 YJL157C
          Length = 815

 Score = 29.3 bits (64), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 15/66 (22%), Positives = 34/66 (51%)

Query: 82  VSRNIMDNNVESEEALKTQLTNMESRRADIILPASMEGNSNFPEEYTMETTTGLVPVKTL 141
           V +  ++NN   E+ ++   ++       + +  S++GN++ P+ Y     TG    +TL
Sbjct: 210 VCQEGLNNNFAGEKIVELSCSHPNHYSCYLTMLGSIQGNNSLPKCYLCGQITGPTDTETL 269

Query: 142 EDIKKK 147
           +++K K
Sbjct: 270 QEMKSK 275

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.121    0.316 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,817,672
Number of extensions: 992829
Number of successful extensions: 5132
Number of sequences better than 10.0: 365
Number of HSP's gapped: 5092
Number of HSP's successfully gapped: 373
Length of query: 219
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 114
Effective length of database: 41,441,469
Effective search space: 4724327466
Effective search space used: 4724327466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 63 (28.9 bits)