Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D020705.349ON37337318390.0
Smik_4.5775.349ON3683736241e-77
Suva_2.4875.349ON3683536232e-77
Skud_4.5845.349ON3683736223e-77
YDR318W (MCM21)5.349ON3683745953e-73
Kpol_1051.55.349ON3703845867e-72
TDEL0E027805.349ON3473765733e-70
KAFR0C018705.349ON3413715507e-67
CAGL0H07139g5.349ON3583705431e-65
SAKL0G08888g5.349ON3793845215e-62
KNAG0C055205.349ON3853254868e-57
ZYRO0D10120g5.349ON3293724634e-54
KLTH0H14806g5.349ON3463634341e-49
Kwal_34.159865.349ON2312513735e-42
TBLA0H019805.349ON3591723828e-42
NCAS0F028505.349ON2813103681e-40
NDAI0I015505.349ON2763013357e-36
Ecym_81845.349ON2482623171e-33
AGR349W5.349ON2422572715e-27
KLLA0B10142g5.349ON2932001469e-10
TPHA0D026705.577ON76679750.95
ZYRO0D05874g8.315ON16976666.2
Ecym_63341.283ON13957648.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D02070
         (373 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.3...   712   0.0  
Smik_4.577 Chr4 (1030208..1030259,1030337..1030526,1030557..1031...   244   1e-77
Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341) [...   244   2e-77
Skud_4.584 Chr4 (1040035..1040086,1040162..1040345,1040376..1041...   244   3e-77
YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 a...   233   3e-73
Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON} (10484.....   230   7e-72
TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044...   225   3e-70
KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026...   216   7e-67
CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {...   213   1e-65
SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [114...   205   5e-62
KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa] ...   191   8e-57
ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 a...   182   4e-54
KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, ...   171   1e-49
Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {O...   148   5e-42
TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080...   151   8e-42
NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.34...   146   1e-40
NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.34...   133   7e-36
Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON} ...   126   1e-33
AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic h...   108   5e-27
KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 a...    61   9e-10
TPHA0D02670 Chr4 complement(551923..552495,552594..554321) [2301...    33   0.95 
ZYRO0D05874g Chr4 complement(499357..499866) [510 bp, 169 aa] {O...    30   6.2  
Ecym_6334 Chr6 (641501..641920) [420 bp, 139 aa] {ON} similar to...    29   8.0  

>TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.349
           YDR318W
          Length = 373

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/373 (95%), Positives = 356/373 (95%)

Query: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60
           MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF
Sbjct: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60

Query: 61  ELLSKEKIKRSEMLGKHHRDEVFGTEEEANKRKQSEHLNDDDNMPEHEWILNKQPIIEHK 120
           ELLSKEKIKRSEMLGKHHRDEVFGTEEEANKRKQSEHLNDDDNMPEHEWILNKQPIIEHK
Sbjct: 61  ELLSKEKIKRSEMLGKHHRDEVFGTEEEANKRKQSEHLNDDDNMPEHEWILNKQPIIEHK 120

Query: 121 IFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENTFRL 180
           IFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENTFRL
Sbjct: 121 IFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENTFRL 180

Query: 181 FGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKSNN 240
           FGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKSNN
Sbjct: 181 FGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKSNN 240

Query: 241 WGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQEAN 300
           WGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQEAN
Sbjct: 241 WGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQEAN 300

Query: 301 IVSXXXXXXXXXXXXXXXXXTTTKLTLYLEKDKVTSVSIYSETLDIHSQKRWKLTLLGPV 360
           IVS                 TTTKLTLYLEKDKVTSVSIYSETLDIHSQKRWKLTLLGPV
Sbjct: 301 IVSDILIDLNLKLIKMNIINTTTKLTLYLEKDKVTSVSIYSETLDIHSQKRWKLTLLGPV 360

Query: 361 SGISRKIRYLSQM 373
           SGISRKIRYLSQM
Sbjct: 361 SGISRKIRYLSQM 373

>Smik_4.577 Chr4
           (1030208..1030259,1030337..1030526,1030557..1031421)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  244 bits (624), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 137/373 (36%), Positives = 222/373 (59%), Gaps = 16/373 (4%)

Query: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60
           MS +D+L+QDI++L  E++ L   ++ L+  + N   N+    P++QEF  LF QFP L 
Sbjct: 1   MSKIDDLQQDIESLLSEIKSLEKSREELKTSIKNKRKNEDSSNPIVQEFEDLFEQFPQLN 60

Query: 61  ELLSKEKIKRSEM--LGKHHRDEVFGTEEEANKRKQSEHLNDDDNMPEHEWILNKQPIIE 118
             L  E  +  EM   G      V        + K+   LN+D+N+PE EW+L  QP+++
Sbjct: 61  NFLFNEHPELEEMDDRGVSIASVVIPATLIPYEPKKRAKLNNDENLPEQEWVLKTQPMVQ 120

Query: 119 HKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENTF 178
           H++F  E+++ ++TDILTSPSKRK+ ++  +I   D            +LE  I+ EN +
Sbjct: 121 HQMFDPEVADLLDTDILTSPSKRKRKLKIEDINSIDKG----------KLEDSIVVENVY 170

Query: 179 RLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKS 238
           R+FGI++FP+VDP DL     ++E+   REM+GIRLEVF +    FEKPHYILLKK+ KS
Sbjct: 171 RIFGITFFPLVDPIDLKIKDDSDEIFVDREMLGIRLEVFSERTSKFEKPHYILLKKRIKS 230

Query: 239 NNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQE 298
           N+W LFK+T+P++ID+  IF   N G++++Y+D Y+FAK+V++QL+ IQ R++    L+ 
Sbjct: 231 NSWFLFKHTVPSFIDVQGIFDDTNGGLVVSYDDAYLFAKRVFLQLVEIQKRQQIFKDLEA 290

Query: 299 ANIVSXXXXXXXXXXXXXXXXXTTTKLTLYLEKDKVTSVSIYSETLDI-HSQK-RWKLTL 356
             I+                     K+ L+++++++ S SI  +  D  H+ K +W++ L
Sbjct: 291 KKIIH--DLNLDLESSMASFFVKDVKVELFVKQNEIVSCSILDDIHDFSHNNKNKWEIAL 348

Query: 357 LGPVSGISRKIRY 369
           LG +  +  K+ +
Sbjct: 349 LGSLDDLELKLNH 361

>Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  244 bits (623), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 134/353 (37%), Positives = 217/353 (61%), Gaps = 14/353 (3%)

Query: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60
           MS +D+L+QD+++L  E++ L   ++ L+ ++ +   N     P++QEF  LF+QFP L 
Sbjct: 1   MSKIDDLQQDVESLLSEIKSLEKSREELKTKLRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60

Query: 61  ELLSKEKIKRSEMLGKHHRDEVFGTEEEA--NKRKQSEHLNDDDNMPEHEWILNKQPIIE 118
             L  E  +  +M  K     +  T   +   + K+   L +D+N+PEHEW+L  QP+++
Sbjct: 61  NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQPMVQ 120

Query: 119 HKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENTF 178
           HK+F S++++ ++T+ILTSPSKRK+ +   EI  +D +M          LE  II EN +
Sbjct: 121 HKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSM----------LEDSIILENIY 170

Query: 179 RLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKS 238
           R+FGI++FP+VDP DL    S++E+   REM+GIRLEVF++    FEKPHYILLKK+ KS
Sbjct: 171 RMFGITFFPLVDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKS 230

Query: 239 NNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQE 298
           N+W LFK+TIP+YID+  IF   N G++++ +D Y+FAK+V++QL+ IQ R+++   L+ 
Sbjct: 231 NSWFLFKHTIPSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEA 290

Query: 299 ANIVSXXXXXXXXXXXXXXXXXTTTKLTLYLEKDKVTSVSIYSETLDIHSQKR 351
             I+                     K+ L+L+++++ S SI  E  D + + +
Sbjct: 291 KKIIH--NLDLDLQSSMVSFFVKDVKVELFLKQNEIVSCSILDEIHDFNQKNK 341

>Skud_4.584 Chr4
           (1040035..1040086,1040162..1040345,1040376..1041246)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  244 bits (622), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 134/373 (35%), Positives = 224/373 (60%), Gaps = 16/373 (4%)

Query: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60
           MS +D+L+QDI++L  E++ L   ++ L+  + N   N     P++QEF  LF+QFP L 
Sbjct: 1   MSKIDDLQQDIESLLSEIKSLEKSREELKLNIKNKRKNQDSTNPIIQEFEELFDQFPQLN 60

Query: 61  ELLSKEKIKRSEMLGK--HHRDEVFGTEEEANKRKQSEHLNDDDNMPEHEWILNKQPIIE 118
             L  E  +  E   K    +  V       ++ K+   L++D+N+ E EW+L  QP+++
Sbjct: 61  NFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKLDNDENVSEQEWVLRTQPMVQ 120

Query: 119 HKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENTF 178
           H++F S +++ ++TDILTSPSKRK+ ++  +I  +D N          +LE  II EN +
Sbjct: 121 HQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRN----------DLEDSIIMENVY 170

Query: 179 RLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKS 238
           R+FGI++FP+VDP DL     ++E+   REM+GIRLEVF +    FEKPHYILLKK+ KS
Sbjct: 171 RMFGITFFPLVDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKS 230

Query: 239 NNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQE 298
           N+W LFK+TIP++ID+  IF   N G++++++++Y+FAK+V++QL+ IQ R++    L+ 
Sbjct: 231 NSWFLFKHTIPSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEA 290

Query: 299 ANIVSXXXXXXXXXXXXXXXXXTTTKLTLYLEKDKVTSVSIYSETLDIH--SQKRWKLTL 356
             I+                     K+ L+++++++ S SI  E  D    ++ +W++ L
Sbjct: 291 KKIIH--DLDLDLQSSMVSFFVKDVKVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIVL 348

Query: 357 LGPVSGISRKIRY 369
           LG +  +  K+ +
Sbjct: 349 LGSLDDLELKLNH 361

>YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 aa]
           {ON}  MCM21Protein involved in minichromosome
           maintenance; component of the COMA complex (Ctf19p,
           Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits
           that are in contact with centromeric DNA and the
           subunits bound to microtubules
          Length = 368

 Score =  233 bits (595), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 128/374 (34%), Positives = 228/374 (60%), Gaps = 18/374 (4%)

Query: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60
           MS +D+L+QDI++L  E+  L   ++ L+ ++ +   N++   P++QEF  LF+QFP L 
Sbjct: 1   MSRIDDLQQDIESLLSEINSLEESREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60

Query: 61  ELLSKEKIKRSEMLGK---HHRDEVFGTEEEANKRKQSEHLNDDDNMPEHEWILNKQPII 117
             L  E  +  E   K     + ++  T      +K+++ L +++ +PE EW+L  QP++
Sbjct: 61  NFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAK-LENEEILPEQEWVLKTQPMV 119

Query: 118 EHKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENT 177
           +H++F   +++ ++TDILTSPSKRK+ ++  +I+ +D +          ELE  I+ EN 
Sbjct: 120 QHQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRS----------ELEDYIVLENV 169

Query: 178 FRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTK 237
           +R+FGI++FP+VDP DL    ++ E+   REM+GIRLEVF +    FEKPHY+LLKK+ K
Sbjct: 170 YRMFGITFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIK 229

Query: 238 SNNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQ 297
           SN+W LFK+TIP++ID+  IF   N G++++++D Y+FAK+V++QL+ +Q R++    L+
Sbjct: 230 SNSWFLFKHTIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLE 289

Query: 298 EANIVSXXXXXXXXXXXXXXXXXTTTKLTLYLEKDKVTSVSIYSETLDI--HSQKRWKLT 355
              I+                     K+ L+++++++ S SI  +  D   +++ +W++ 
Sbjct: 290 AKKIIH--DLDLDLESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIA 347

Query: 356 LLGPVSGISRKIRY 369
           LLG +  +  K+ +
Sbjct: 348 LLGSLDDLELKLNH 361

>Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON}
           (10484..11596) [1113 nt, 371 aa]
          Length = 370

 Score =  230 bits (586), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 144/384 (37%), Positives = 228/384 (59%), Gaps = 27/384 (7%)

Query: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60
           MS L  L QD+ ALR+E+E L  ++ A+++++ N  + +  ++P+ ++F  LF   P L+
Sbjct: 1   MSDLLELEQDVTALRREIESLTKRRDAVKDKLANNEIEEYTQKPISKDFEDLFQSHPQLY 60

Query: 61  ELLSKEKI-----------KRSEMLGKHHRDEVFGTEEEANKRKQSEHLNDDDNMPEHEW 109
           +LLS +K            +R E  GKH   E+      +NKR +      D ++ E EW
Sbjct: 61  DLLSSDKDKNKSKKKPSSEERDE--GKHMTSEI------SNKRVKPNE--QDTDISEDEW 110

Query: 110 ILNKQPIIEHKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELE 169
           IL  QP+++HK+F S +S+ INTDILTSPSKRK  +  I+   ++ + G K  NLN    
Sbjct: 111 ILKSQPLVQHKMFNSGISDMINTDILTSPSKRKLKLGNID-DDSETSKGNKQKNLN---- 165

Query: 170 RKIIKENTFRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHY 229
           +KI  EN FRLFGI++FP+VDP DL  +K    +  KREM+GIRLE++++    FEKPHY
Sbjct: 166 KKIRIENLFRLFGITFFPLVDPTDLKMNKELKTMEIKREMLGIRLEIYNEHNSTFEKPHY 225

Query: 230 ILLKKKTKSNNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNR 289
           ILLKKK K ++W +FK+TIP+YIDI   +  INNG+L TY++I +FAK+VYI+L+    R
Sbjct: 226 ILLKKKLKIDSWMIFKHTIPSYIDIESKWFGINNGMLNTYDEINVFAKEVYIELIHGNIR 285

Query: 290 KKNLMQLQEANIVSXXXXXXXXXXXXXXXXXTTTKLTLYLEKDKVTSVSIYSETLDIHSQ 349
           ++ + +L E   +                     ++ L+L+ + + S  I ++ ++   +
Sbjct: 286 EQKIQKLTELEYIR-DCQTDVNSSRVILTLIDQYEIELFLKNETIVSCKIPTDRMEPMLK 344

Query: 350 KRWKLTLLGPVSGISRKIRYLSQM 373
            +W++ LLG +  +  K+  L+ M
Sbjct: 345 NKWQIILLGTIDELPNKLSQLNNM 368

>TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044
           bp, 347 aa] {ON} Anc_5.349 YDR318W
          Length = 347

 Score =  225 bits (573), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 130/376 (34%), Positives = 223/376 (59%), Gaps = 32/376 (8%)

Query: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60
           MS L++L+QDIDAL +E+  L  ++  L++E+     +     P+++ F  +F+QFP L+
Sbjct: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60

Query: 61  ELLSKEKIKRSEMLGKHHRDEVFGTEEEANKRKQSEHLNDDDNMPEHE--WILNKQPIIE 118
           ++LS+E   R E   +  +D +      + KRK+    N D N P+ +  +  +  P+ +
Sbjct: 61  DVLSEETTARHE---ESTQDPI------SLKRKR----NTDVNSPKKDKSFRGDHPPVFQ 107

Query: 119 HKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELER-KIIKENT 177
           H++F   +++ I+T+ILTSPSK ++ +              K+   +E+  R +++ EN 
Sbjct: 108 HQMFDESIAQFIDTNILTSPSKARRRM--------------KDTKYDEDAPRNQVLLENV 153

Query: 178 FRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTK 237
           +R+FGI+YFPVVDP DL  +K  N+    REMIGIRLEVF++++  FEKP+YILLKKK K
Sbjct: 154 YRMFGITYFPVVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPYYILLKKKIK 213

Query: 238 SNNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQ 297
           S++W LFK+T+P +ID++ +F + N G ++++E+IY+FAK VY QL+ +  R +NL  L 
Sbjct: 214 SDSWLLFKHTVPIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLM 273

Query: 298 EANIVSXXXXXXXXXXXXXXXXXTTTKLTLYLEKDKVTSVSIYSETLDIHSQKRWKLTLL 357
            + ++                     +L L+  KD++ S S+  E LD + + + +   L
Sbjct: 274 SSGVIDNLDLDLEAAAVSFSKNEVQFRLMLH--KDQIVSCSLVGEALDGNVKPQLETIFL 331

Query: 358 GPVSGISRKIRYLSQM 373
           GP+  +  K+++L Q+
Sbjct: 332 GPLHELEIKLKHLDQL 347

>KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026
           bp, 341 aa] {ON} Anc_5.349 YDR318W
          Length = 341

 Score =  216 bits (550), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 130/371 (35%), Positives = 207/371 (55%), Gaps = 32/371 (8%)

Query: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60
           MS ++ L QDI +LR+E +  NT                     +++EF  LF QFP L 
Sbjct: 1   MSNIEELEQDIASLRREKQPANT---------------------VMREFEELFQQFPQLR 39

Query: 61  ELLSKE-KIKRSEMLGKHHRDEVFGTEEEANKRKQSEHLNDDDNMPEHEWILNKQPIIEH 119
           +LL KE K    E L +  +D+    + +   RK+ +     DN+PE EW+L  Q  +EH
Sbjct: 40  DLLYKEYKGPGDETLLEPLQDQNLVEKFQTPSRKRPKT-KSSDNLPEDEWVLQNQVPLEH 98

Query: 120 KIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENTFR 179
            +F   + + ++T+IL+SPSKR++ + G +   +  N+   N      L  +I+ EN FR
Sbjct: 99  NLFDKSVGDILDTEILSSPSKRRQRLNGDD-RSSIGNLPLDN------LHDQIMVENIFR 151

Query: 180 LFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKSN 239
           LFGI++FPVVDP DL  +    E++  REM+GIRL++FD+    ++KP YILLKKK KS+
Sbjct: 152 LFGITFFPVVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSD 211

Query: 240 NWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQEA 299
            W +FK+TIP+YI +  IF+ ++ G+ ++YEDIY+F+K++Y+QLL    RK  L + +E 
Sbjct: 212 TWDIFKHTIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARKGKLKKFEEK 271

Query: 300 NIVSXXXXXXXXXXXXXXXXXTTTKLTLYLEKDKVTSVSIYSETLDIHSQKRWKLTLLGP 359
            ++S                  T ++ LYL+ + + S S      D   + +W++   GP
Sbjct: 272 GLIS--NLRISLSSTKVSFSIGTFEIELYLQDNIIISCSFVKGIRDASVRSKWEVLFNGP 329

Query: 360 VSGISRKIRYL 370
           +  +  K+R L
Sbjct: 330 LEDLEYKLRQL 340

>CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {ON}
           some similarities with uniprot|Q06675 Saccharomyces
           cerevisiae YDR318w MCM21
          Length = 358

 Score =  213 bits (543), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 127/370 (34%), Positives = 209/370 (56%), Gaps = 26/370 (7%)

Query: 3   TLDNLRQDIDALRKELEYLNTKKKALENEVNNA---IVNDKEEEPLLQEFNVLFNQFPDL 59
           T++ L QD++AL  E+  L  K K L  ++ +    I  DK       +FN +F + P L
Sbjct: 5   TVEELLQDVEALTSEINGLQEKSKKLREQLKHPEQFIKFDKA----FGDFNDIFEKNPGL 60

Query: 60  FELLSKEKIKRSEMLGKHHRDEVFGTEEEANKRKQSEHLNDD-DNMPEHEWILNKQPIIE 118
            +LL   +I +S        D+         K+ +S  +N+   ++PEHEW+L  QP++E
Sbjct: 61  RDLLLGYEIDKSAT----DVDDTNIIPVTPQKKSRSSVVNEKLHSLPEHEWVLKTQPLVE 116

Query: 119 HKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIK-ENT 177
           H++F   + + I+TDIL SPSKRK+ I+ +            NPN   ++ ++ I+ EN 
Sbjct: 117 HRLFDESVRDVIDTDILISPSKRKQKIQQL------------NPNSTGKVSKEPIQYENI 164

Query: 178 FRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTK 237
           +RLFGISYFP+VDP DL+ D    ++   R+M+GIR ++F+++   FEKPHYILLKK  K
Sbjct: 165 YRLFGISYFPLVDPSDLIFDSKTEKMIVTRDMLGIRFDIFNESSKSFEKPHYILLKKSAK 224

Query: 238 SNNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQ 297
           S++W LFKYT+PNYID+  IF  +  G++ TY+D+Y+FAK +Y+ L+ I  R +  +QL+
Sbjct: 225 SDDWKLFKYTVPNYIDVEGIFAEVTGGLIRTYDDVYLFAKCIYLLLVEIVIRSELFLQLE 284

Query: 298 EANIVSXXXXXXXXXXXXXXXXXTTTKLTLYLEKDKVTSVSIYSETLDIHSQKRWKLTLL 357
           +  I+                   TTK+  ++ +  + + +I S+ +    ++R  + L 
Sbjct: 285 KDGIID-DLDMDLQSLVIKCTLQGTTKIEFHIHQYSIIACTIKSKIMSDDEKERLAMMLQ 343

Query: 358 GPVSGISRKI 367
           G +  +  K+
Sbjct: 344 GSLHDLKYKL 353

>SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [1140
           bp, 379 aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 379

 Score =  205 bits (521), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 134/384 (34%), Positives = 212/384 (55%), Gaps = 36/384 (9%)

Query: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNN------AIVNDKEEEPLLQ----EFN 50
           MS L   +QDIDAL +E+  L  ++  L   +         + ++ E+ P+++    E+ 
Sbjct: 1   MSKLQEHQQDIDALNREIASLAQQQDELHLHIQKYEDQLERLRHESEKVPVIELTTDEYG 60

Query: 51  VLFNQFPDLFELLSKEKIKRSEMLGKHHRDEVFGTEEEA---NKRKQSEHLNDDDNMPEH 107
            +F  FP L +LLS++  ++    G  H +    T +++   + RK+  +     +MPEH
Sbjct: 61  PIFEAFPHLHKLLSEKLFQQESNRG--HDNTALSTPKKSTTISPRKRVVNQVLPPSMPEH 118

Query: 108 EWILNKQPIIEHKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEE 167
           EW+L  QP +EHK+F S++++ I+T+ILTSPSKRK+ +  +              N  + 
Sbjct: 119 EWVLRMQPAVEHKMFDSDIADLIDTEILTSPSKRKEKLSKVH-------------NNKQN 165

Query: 168 LERKIIKENTFRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKP 227
           L   +  EN +R+ GI+ FPVVDP DL  +K   E    REM+G+RLEVF++ L  FEKP
Sbjct: 166 LIDYVRLENVYRMTGITVFPVVDPSDLKVNKETKEYEILREMMGVRLEVFNEVLSTFEKP 225

Query: 228 HYILLKKKTKSNNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQ 287
           +Y+LLKK +K ++W +FK+TIPNYIDI L+F++ N GI+  Y   Y+FAK+VY QLLL  
Sbjct: 226 YYVLLKKSSKRDSWDIFKHTIPNYIDIQLLFEKTNGGIITDYSGTYLFAKKVY-QLLLQT 284

Query: 288 NRKKNLMQL--QEANIVSXXXXXXXXXXXXXXXXXT--TTKLTLYLEKDKVTSVSIYSET 343
           + K  + ++  +E + +S                    + K  L ++ + V   SI    
Sbjct: 285 SLKAQVFEVLAREDSRISQIESDLAVNVVSFKVSFKNLSFKTVLQMDWNNVHGASI---K 341

Query: 344 LDIHSQKRWKLTLLGPVSGISRKI 367
           L+    +RW+  LLGPV    RK+
Sbjct: 342 LNSEHVRRWENYLLGPVDEFPRKL 365

>KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa]
           {ON} Anc_5.349 YDR318W
          Length = 385

 Score =  191 bits (486), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 113/325 (34%), Positives = 178/325 (54%), Gaps = 36/325 (11%)

Query: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEP----LLQEFNVLFNQF 56
           M  L++L QDIDAL KE+E L  +   ++ E+ +  +     +     ++QEF  +F +F
Sbjct: 1   MRELEDLEQDIDALEKEIESLKKRTADVKGEIRDKRLGGSRTKDTTNVVIQEFESVFEKF 60

Query: 57  PDLFELLSKE-----------KIKRSEMLGKHHRDE-------VFGTEEEANKRKQSEHL 98
           P L+++L  +                +  G +  ++          T  +  K K  +  
Sbjct: 61  PQLYDILYNDYRPDASDNDDNDTNSVDSAGSNRANQTNNRSVSATATPVKTGKDKAHQQG 120

Query: 99  N-DDDNMPEHEWILNKQPIIEHKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANM 157
           N  D+++PE EW+L  Q  IEH++F   + + ++TDIL+SPSKRK+         N A  
Sbjct: 121 NRSDEDLPEDEWVLKNQVPIEHQMFDQSVGDLLDTDILSSPSKRKR---------NPAQH 171

Query: 158 GYKNPNLNEELERKIIKENTFRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVF 217
           G     L+E    KI+ EN +RLFGI+YFPVVDP DL  +    ++   REM+G+R +VF
Sbjct: 172 GADTSRLHE----KILLENAYRLFGITYFPVVDPADLQLNAETQKMVITREMLGVRFDVF 227

Query: 218 DDTLGVFEKPHYILLKKKTKSNNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAK 277
           +D    FEKP Y+LLKK  K+  W +FK+TIP  ID++ +F  I  G+  +  DIY+F+K
Sbjct: 228 NDQDSKFEKPFYVLLKKNLKAKVWEIFKHTIPGNIDVHSLFHTITGGLATSNNDIYLFSK 287

Query: 278 QVYIQLLLIQNRKKNLMQLQEANIV 302
           +VY++L+    R K+   LQE  ++
Sbjct: 288 EVYVRLVQSSLRLKHFNSLQERGLI 312

>ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 329

 Score =  182 bits (463), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 120/372 (32%), Positives = 201/372 (54%), Gaps = 48/372 (12%)

Query: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60
           M +++ L QDI++L +E+  L  K+  L+ +      ++    P+++EF  +F +FP L+
Sbjct: 1   MQSVEELEQDIESLTREITSLCQKRDELKAQKFEKECSELSNHPVVKEFESVFTKFPKLY 60

Query: 61  ELLSKE-KIKRSEMLGKHHRDEVFGTEEEANKRKQSEHLNDDDNMPEHEWILNKQPIIEH 119
           E+L++E +I  S        DE    +    KR++ E  +                 +++
Sbjct: 61  EVLARENQIVDSN--DNDTSDEPSTVDSSFVKRRKLEFSDGS---------------VQN 103

Query: 120 KIFASELSENI-NTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENTF 178
           K+F   +++ + +T   TSP KR+  ++  +                  LE ++  EN +
Sbjct: 104 KMFDKSIADLLGDTSSSTSPGKRRSKLQNFK-----------------GLESQVSIENAY 146

Query: 179 RLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKS 238
           RLFGI++FP+VDP D+   +  N++N  R+M+GIRLEVF++ L  FEKPHYILLK+  K 
Sbjct: 147 RLFGITFFPLVDPSDINFQR--NDIN--RKMLGIRLEVFNEGLRQFEKPHYILLKQNLKL 202

Query: 239 NNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQE 298
           N+W LFK+TIP +ID+  IFQ+I+NGI+ TY+ +Y+FAKQVYIQLL +  R + + +LQ+
Sbjct: 203 NSWSLFKHTIPAFIDLESIFQKIDNGIITTYDQVYLFAKQVYIQLLCVSQRVQIIEELQD 262

Query: 299 ANIVSXXXXXXXXXXXXXXXXXTTTKLTLYLEKDKVTSVSIYSETLDIHSQKRWKLTLLG 358
             ++S                    ++ L+L+ D+V S   + +          K+ LLG
Sbjct: 263 IRLIS-NLEIDLQIAAVSFDIQGMKRVRLFLQDDQVISCDTFDD-------DELKMLLLG 314

Query: 359 PVSGISRKIRYL 370
           PV  +  K+  L
Sbjct: 315 PVKELKLKLGRL 326

>KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, 346
           aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 346

 Score =  171 bits (434), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 115/363 (31%), Positives = 185/363 (50%), Gaps = 28/363 (7%)

Query: 9   QDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLFELLSKEKI 68
           Q I++L  E+  L  K + LE+E+  A      E P+  EF  LF + P+L   LS++  
Sbjct: 9   QYINSLNAEILQLKNKCRVLEDELQ-AQKKGVSEVPV--EFEGLFQKNPELKHTLSQKIF 65

Query: 69  KRSEMLGKHHRDEVFGTEEEANKRKQSEHLNDDDNMPEHEWILNKQPIIEHKIFASELSE 128
           K ++   +         ++   K   ++  N   ++PE EW+L  Q  +EHK F S +++
Sbjct: 66  KETDSFPQTPYS---SPKKRPLKSSAAQLSNLSPDIPESEWVLKTQVPVEHKFFDSAVAD 122

Query: 129 NINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENTFRLFGISYFPV 188
            I TDILTSPSKRK+  +                  +EEL +K+  EN +R+ GIS FPV
Sbjct: 123 LIETDILTSPSKRKRAAQS---------------RAHEELVQKVQIENIYRMLGISTFPV 167

Query: 189 VDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKSNNWGLFKYTI 248
           VDP DL      +E+N KR+M+G+RLE+F++    FE P+YIL K+  K++ W +F++T+
Sbjct: 168 VDPSDL-EGTEEDEINIKRKMLGLRLELFNELERSFEPPYYILFKQNPKNSYWNIFRHTV 226

Query: 249 PNYIDIYLIFQRI-NNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQEANIVSXXXX 307
           P+Y+ +  +FQ++ +NG+L    +IY FAK+VY  LL I  + +   + ++   +S    
Sbjct: 227 PSYVGVEQMFQQVRSNGLLANQSEIYTFAKKVYKSLLSISVKTQIFRRTEKKEAISQLEI 286

Query: 308 XXXXXXXXXXXXXTTTKLTLYLEKDKVTSVSIYSETLDIHSQKRWKLTLLGPVSGISRKI 367
                            + L L+   V + S        H    W   +LGPV  +  +I
Sbjct: 287 DPSCTSVSFHIEKLGCFVKLKLDATDVIACSCIP-----HENVSWNAQMLGPVVSLPDRI 341

Query: 368 RYL 370
             L
Sbjct: 342 ESL 344

>Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {ON}
           YDR318W (MCM21) - involved in minichromosome maintenance
           [contig 272] FULL
          Length = 231

 Score =  148 bits (373), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 85/251 (33%), Positives = 134/251 (53%), Gaps = 22/251 (8%)

Query: 121 IFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENTFRL 180
           +F S +++  NTDILTSPSKRKKV+               N   ++EL +K+  EN +R 
Sbjct: 1   MFDSTVADLFNTDILTSPSKRKKVV---------------NSRKHQELIKKLDIENLYRT 45

Query: 181 FGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKSNN 240
            G+S FPVVDP D+  D+ + E   +R MIG+RLE+F++    FE PHY+L K+  K+ +
Sbjct: 46  IGLSTFPVVDPSDVEQDE-DGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGH 104

Query: 241 WGLFKYTIPNYIDIYLIFQRINN-GILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQEA 299
           W +F++TIP+Y+ +  +F++      L     IY F K+VY  LL I  +++    L E+
Sbjct: 105 WNIFRHTIPSYVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAES 164

Query: 300 NIVSXXXXXXXXXXXXXXXXXTTTKLTLYLEKDKVTSVSIYSETLDIHSQKRWKLTLLGP 359
            IVS                  +  + L L +  +T+ S         S ++W  T+LGP
Sbjct: 165 GIVSQLVIDPSCTSASFQMMQGSVSVKLKLSETDITACSSIP-----RSSQKWTATILGP 219

Query: 360 VSGISRKIRYL 370
           V  + R+++ L
Sbjct: 220 VQSLPRRLQTL 230

>TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080
           bp, 359 aa] {ON} Anc_5.349 YDR318W
          Length = 359

 Score =  151 bits (382), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 114/172 (66%), Gaps = 14/172 (8%)

Query: 114 QPIIEHKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLN--EELERK 171
           Q  +EHK+F  E+S  ++ ++++ PS+R+K             M  + PNL+  E L+  
Sbjct: 102 QLTLEHKLFDDEISRLLSPEVVSLPSQRRK------------RMKLERPNLHIREILKNF 149

Query: 172 IIKENTFRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYIL 231
           +I E  +R+ GI++FPVVDP DL    +   ++ +REM+GIRLE+++D +  FEKPHYIL
Sbjct: 150 VILEIVYRMVGITFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYIL 209

Query: 232 LKKKTKSNNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQL 283
           LK+  KS  W +FKYTIPNYIDI+ +F +INNGI+ T  DI++FAK VY  L
Sbjct: 210 LKQSEKSKIWSIFKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSAL 261

>NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.349
           YDR318W
          Length = 281

 Score =  146 bits (368), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 103/310 (33%), Positives = 166/310 (53%), Gaps = 56/310 (18%)

Query: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60
           M+ + +L QDI AL+ E++ L  K+  L+++      +    +P++ E   L  QFP L 
Sbjct: 1   MTEIVDLEQDIAALKSEVQALTKKRDELKSKPKLKPRSSSTSDPIVNEITDLITQFPQLN 60

Query: 61  E-LLSKEKIKRSEMLGKHHRDEVFGTEEEANKR--------------KQSEHLNDDDNMP 105
           E LLSK  +  S              EEE++K+              K+S+  N++D++P
Sbjct: 61  EILLSKPSVTESS--------RSTSNEEESDKKRKLDNEKIQAFQDAKKSKLNNENDDLP 112

Query: 106 EHEWILNKQPIIEHKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLN 165
           EHEW+L  Q  +EHK+F + +++ +NT++L+SPSKR+ +++      N  +   +N +L 
Sbjct: 113 EHEWVLKNQRPVEHKMFDTSVADVLNTEMLSSPSKRRLILK------NGQDEMEENKHLQ 166

Query: 166 EELERKIIKENTFRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFE 225
           +E     + EN FR+ GIS+F  VDP DL  D           MIGIRL+ F+    V+ 
Sbjct: 167 KEYR---LLENVFRIVGISFFDAVDPNDLESD-----------MIGIRLDPFNQPSKVY- 211

Query: 226 KPHYILLKKKTKSNN---WGLFKYTIPNYIDIYLIFQRINNGILLT------YEDIYIFA 276
              YI+LKK+ K+N    W + K+TIP YI++   F         T      ++DIY+ A
Sbjct: 212 ---YIILKKEAKNNREGLWTIIKHTIPKYINVTNTFGESKRETWRTMIKIENHDDIYLLA 268

Query: 277 KQVYIQLLLI 286
           K+VY++LLL+
Sbjct: 269 KEVYVKLLLL 278

>NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.349
           YDR318W
          Length = 276

 Score =  133 bits (335), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 102/301 (33%), Positives = 166/301 (55%), Gaps = 38/301 (12%)

Query: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKE--EEPLLQEFNVLFNQFPD 58
           MS + +L QDI AL+ ELE L  K+ AL++   + I  D    E    ++   L +QFP 
Sbjct: 1   MSDITDLEQDIAALKVELEGLRAKRDALKDPGKD-IQKDTSIAETNADRQLQSLLDQFPQ 59

Query: 59  LFE-LLSKEKI-KRSEMLGKHHRDEVFGTEEEANKRKQSEH---------LNDDDNMPEH 107
           L + LLS   I K S +L  +  D+        +++++SEH         L+   N+PEH
Sbjct: 60  LHDILLSDNAIDKSSPVLHNNGEDDT----SLLSRKRKSEHGSPNTKHKRLSLSANLPEH 115

Query: 108 EWILNKQPIIEHKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEE 167
           EW+L  QP IEHK+F + +++ + TDIL+SPSKR  +IE  E          ++ NL   
Sbjct: 116 EWVLKMQPPIEHKMFDTSVADVLGTDILSSPSKR--IIETKE---------RQSDNLQRT 164

Query: 168 LERKIIKENTFRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKP 227
           L   I+ E+ ++  G+++  + DP DL  ++    +  K +M+G+R E+   + G   + 
Sbjct: 165 L---ILLEDFYKKLGVNFLQLFDPNDLEMNEKMEALQMKGDMLGVRFEL-PSSEGA--QK 218

Query: 228 HYILLKKKTKSNNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQ 287
           +Y+LLKK+T S+ W  +K+++PN ID+   F  +      ++EDIY+ AK +Y+QLL   
Sbjct: 219 YYLLLKKETASDYWIPYKHSLPNIIDVNEYFVNVAAE---SHEDIYLIAKDIYLQLLTSA 275

Query: 288 N 288
           N
Sbjct: 276 N 276

>Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AGR349W
          Length = 248

 Score =  126 bits (317), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/262 (30%), Positives = 135/262 (51%), Gaps = 30/262 (11%)

Query: 117 IEHKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKEN 176
           +EH++F   ++   +T+I+ SPSKR K+++    +    N          ELE+ +  EN
Sbjct: 5   VEHRMFDPTIASFFDTEIVRSPSKRNKLMKSSATSIRPDN----------ELEKFVEIEN 54

Query: 177 TFRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKT 236
            +R+ GI++FP+VDP  L  +  ++  +   E++GIRLEVF++T   +E P+YI+LK++ 
Sbjct: 55  CYRMSGITFFPLVDPGKLASNTHHDSTSLVAELLGIRLEVFNETTLKYEPPYYIILKRRP 114

Query: 237 KSNN-WGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQ 295
           K+N  W L+K+TIP  IDI  I+    +GI+   +++YIFAK+ Y++LL I  R + +  
Sbjct: 115 KANQIWDLYKHTIPKVIDIEQIWSTTGHGIISMDKEVYIFAKKCYMELLAIHYRLQFICN 174

Query: 296 LQEANIVSXXXXXXXXXXXXXXXXXTTTKLTLYLEKDKVTSV-------SIYSETLDIHS 348
           L                            L+  L  +++ +V       SI    +DI  
Sbjct: 175 LDP------------QLFENIKVDSYAVMLSFQLTGEEIITVVAQLRDRSIIDCDIDIER 222

Query: 349 QKRWKLTLLGPVSGISRKIRYL 370
              W   +LGP+  +  KI  L
Sbjct: 223 HNEWSKIILGPLVDLPDKILIL 244

>AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR318W (MCM21)
          Length = 242

 Score =  108 bits (271), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 129/257 (50%), Gaps = 29/257 (11%)

Query: 121 IFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELE-RKIIK-ENTF 178
           +F   L+  ++T++L SPSKR K++                P  +++ E R  I+ EN +
Sbjct: 1   MFDPALAPFLDTELLRSPSKRGKILS-------------TRPEQSKQRELRNFIEVENCY 47

Query: 179 RLFGISYFPVVDPCDLV-HDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTK 237
           R+ GI++FP+VDP  L   DK N  + N  EM+GIRLEVF++    F+ P+Y+LL++  K
Sbjct: 48  RMCGITFFPLVDPGRLGGQDKDNEGIVN--EMLGIRLEVFNENTRRFDYPYYVLLRRDAK 105

Query: 238 -SNNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQL 296
            +  W LFK+T+P  +D   I+    NG + +  D+Y+FAK+ Y +L+ +  R + + +L
Sbjct: 106 VATRWQLFKHTLPKMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARL 165

Query: 297 QE---ANIVSXXXXXXXXXXXXXXXXXTTTKLTLYLEKDKVTSVSIYSETLDIHSQKRWK 353
                 NI +                     +T+ LE  +V S       LD      W 
Sbjct: 166 DPYLFENIRTDSYAAMLSFLISGGAQ--PLAVTVLLEGREVRSCQ-----LDQQQHDEWA 218

Query: 354 LTLLGPVSGISRKIRYL 370
             L+G ++ +  K+R L
Sbjct: 219 HVLVGALADLPNKVRVL 235

>KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 293

 Score = 60.8 bits (146), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 95/200 (47%), Gaps = 26/200 (13%)

Query: 113 KQPIIEHKIFASELSENINTDILTSPSKRKKVIEGIEITGNDA----NMGYKNPNLNEEL 168
           KQ + E+  F++ + ++ NT +  + S RK      +I G D+    N G  + + NE  
Sbjct: 44  KQFLSENINFSNLMRKDENTTLSINLSPRKPGTTTGQIQGIDSSIRSNFGVSSGH-NEVA 102

Query: 169 ERKIIK-----ENTFRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGV 223
             K I      EN+ RL G+S FPV                +  E +GIRLE+FD+    
Sbjct: 103 GFKSITDFVQWENSVRLIGVSLFPVN--------------YDNIEFMGIRLELFDELSLK 148

Query: 224 FEKPHYILLKKKTKS-NNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQ 282
           ++ P Y++LK   K    W LFK+ +P YI+I+  +Q I      +  +I  FA   Y  
Sbjct: 149 YDPPFYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSDSNIMKFANLCYKD 208

Query: 283 LLLIQNRKKNLMQLQEANIV 302
           LL + +R +   +L E N V
Sbjct: 209 LLKVHSRVQFFRKL-EGNYV 227

>TPHA0D02670 Chr4 complement(551923..552495,552594..554321) [2301
           bp, 766 aa] {ON} Anc_5.577 YML034W
          Length = 766

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 41/79 (51%), Gaps = 9/79 (11%)

Query: 60  FELLSKEKIKRSEMLGKHHRDEVFGTEEEAN--KRKQSEHLNDDDNMPE----HEWILNK 113
            EL  K  IK    L    +D      E+ +  K+K+ +HL++D+ + E    HE + NK
Sbjct: 162 IELSEKTPIKTIGKLSNKEKDTAIDQAEDYSTPKKKKQKHLSNDNRISETSIIHEKLANK 221

Query: 114 QPI-IEH--KIFASELSEN 129
            PI IE   KIF S+ SEN
Sbjct: 222 SPIKIESPMKIFKSDTSEN 240

>ZYRO0D05874g Chr4 complement(499357..499866) [510 bp, 169 aa] {ON}
           weakly similar to uniprot|Q99176 Saccharomyces
           cerevisiae YLR119W SRN2 Component of the ESCRT-I complex
           which is involved in ubiquitin-dependent sorting of
           proteins into the endosome suppressor of rna1-1 mutation
           may be involved in RNA export from nucleus
          Length = 169

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 13/76 (17%)

Query: 5   DNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLFELLS 64
           D L+Q+++ LR +L+ L +K + LE+E +N        +  L+E  ++  Q+  L++ L 
Sbjct: 45  DELKQEVNELRSQLQSLESKFQGLEDERSNT-------QRQLEECRIMEAQYVKLWQDL- 96

Query: 65  KEKIKRSEMLGKHHRD 80
                R  ++ K+H D
Sbjct: 97  -----RQRIMEKYHDD 107

>Ecym_6334 Chr6 (641501..641920) [420 bp, 139 aa] {ON} similar to
           Ashbya gossypii AFR102C
          Length = 139

 Score = 29.3 bits (64), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 199 SNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTKSNNWGLFKYTI-PNYIDI 254
           S  + NN  E   I+  + D TL      H ILL ++T +NN    K TI  NY D+
Sbjct: 54  SQEQPNNPEESPAIQTAIADSTLTQLLHSHNILLTRETAANNS--IKNTIYDNYYDL 108

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,131,541
Number of extensions: 2208991
Number of successful extensions: 10839
Number of sequences better than 10.0: 266
Number of HSP's gapped: 11245
Number of HSP's successfully gapped: 284
Length of query: 373
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 262
Effective length of database: 40,753,473
Effective search space: 10677409926
Effective search space used: 10677409926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)