Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D020605.348ON49649625700.0
Kpol_1051.45.348ON4262865171e-59
TDEL0E027905.348ON4114684042e-43
Suva_2.4865.348ON4154714042e-43
CAGL0H07161g5.348ON4244343921e-41
Skud_4.5835.348ON4154803902e-41
ZYRO0F00550g5.348ON4154343798e-40
YDR317W (HIM1)5.348ON4144863491e-35
Smik_4.5765.348ON4154793393e-34
KLTH0H14784g5.348ON5144823081e-29
Kwal_34.159895.348ON5064882646e-24
SAKL0G08910g5.348ON5052762381e-20
TBLA0A031005.348ON3724032192e-18
AGR348W5.348ON5422662212e-18
KAFR0C018805.348ON3451602145e-18
Ecym_81855.348ON4712602159e-18
KLLA0B10120g5.348ON3482741524e-10
Kpol_312.97.148ON2212571042e-04
KLTH0H00264g7.148ON2221711023e-04
ZYRO0D09548g7.148ON2251081024e-04
YER004W (FMP52)7.148ON2311781014e-04
Smik_5.1187.148ON231178960.002
Skud_5.1037.148ON227178920.006
Suva_5.917.148ON229178920.006
KAFR0B008307.343ON71071940.007
TDEL0H031107.148ON22476880.019
TBLA0A105007.148ON23770850.049
Kwal_47.188627.148ON224124820.12
KNAG0L00925singletonON228203820.13
TPHA0L007607.148ON226135810.16
Ecym_44797.148ON224176790.25
TBLA0F033107.148ON161193731.1
KAFR0G027507.148ON225144731.7
KLTH0H16060g4.4ON59446723.4
YGL174W (BUD13)8.127ON266122695.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D02060
         (496 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.3...   994   0.0  
Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..997...   203   1e-59
TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {O...   160   2e-43
Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W ...   160   2e-43
CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {...   155   1e-41
Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317...   154   2e-41
ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON...   150   8e-40
YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Prot...   139   1e-35
Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317...   135   3e-34
KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weak...   123   1e-29
Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {...   106   6e-24
SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {...    96   1e-20
TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.3...    89   2e-18
AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic ...    90   2e-18
KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {O...    87   5e-18
Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}...    87   9e-18
KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some s...    63   4e-10
Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..222...    45   2e-04
KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}...    44   3e-04
ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar...    44   4e-04
YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protei...    44   4e-04
Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W (...    42   0.002
Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W (...    40   0.006
Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W (R...    40   0.006
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...    41   0.007
TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.14...    39   0.019
TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7....    37   0.049
Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa] ...    36   0.12 
KNAG0L00925 Chr12 (169763..170449) [687 bp, 228 aa] {ON}               36   0.13 
TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.1...    36   0.16 
Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON} ...    35   0.25 
TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON...    33   1.1  
KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.14...    33   1.7  
KLTH0H16060g Chr8 (1383120..1384904) [1785 bp, 594 aa] {ON} weak...    32   3.4  
YGL174W Chr7 (174545..175345) [801 bp, 266 aa] {ON}  BUD13Subuni...    31   5.6  

>TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.348
           YDR317W
          Length = 496

 Score =  994 bits (2570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/496 (100%), Positives = 496/496 (100%)

Query: 1   MTGDQSNIEIIKHTEEIINPDVPIESSIDRFSDNILVVGSTGLIGRNVLKSFFDTDLYIK 60
           MTGDQSNIEIIKHTEEIINPDVPIESSIDRFSDNILVVGSTGLIGRNVLKSFFDTDLYIK
Sbjct: 1   MTGDQSNIEIIKHTEEIINPDVPIESSIDRFSDNILVVGSTGLIGRNVLKSFFDTDLYIK 60

Query: 61  HSQELKRLIASSEYDSTTRIKEVTIKKTAYSLTRKRQSVELFKNKTIVGQKLKEVELDGK 120
           HSQELKRLIASSEYDSTTRIKEVTIKKTAYSLTRKRQSVELFKNKTIVGQKLKEVELDGK
Sbjct: 61  HSQELKRLIASSEYDSTTRIKEVTIKKTAYSLTRKRQSVELFKNKTIVGQKLKEVELDGK 120

Query: 121 TFYLQFDLLKQINDSGEPKESFLKSLTTKKMLEALTHGKGVKVTSNSKENQGISVRNEES 180
           TFYLQFDLLKQINDSGEPKESFLKSLTTKKMLEALTHGKGVKVTSNSKENQGISVRNEES
Sbjct: 121 TFYLQFDLLKQINDSGEPKESFLKSLTTKKMLEALTHGKGVKVTSNSKENQGISVRNEES 180

Query: 181 SILKKDKSLLFSVINYNESEGNVILQPQEYSNVECYFNLQQYDSSLIFASSSGDILKINF 240
           SILKKDKSLLFSVINYNESEGNVILQPQEYSNVECYFNLQQYDSSLIFASSSGDILKINF
Sbjct: 181 SILKKDKSLLFSVINYNESEGNVILQPQEYSNVECYFNLQQYDSSLIFASSSGDILKINF 240

Query: 241 DLKLYHLSAVDSTIWPSLLPVLFDSNTKLVPNKGLIENIDLTNEKLPLLSEVKVMLNSLG 300
           DLKLYHLSAVDSTIWPSLLPVLFDSNTKLVPNKGLIENIDLTNEKLPLLSEVKVMLNSLG
Sbjct: 241 DLKLYHLSAVDSTIWPSLLPVLFDSNTKLVPNKGLIENIDLTNEKLPLLSEVKVMLNSLG 300

Query: 301 SRSHSPKNETFKNIDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEE 360
           SRSHSPKNETFKNIDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEE
Sbjct: 301 SRSHSPKNETFKNIDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEE 360

Query: 361 DLKTNLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKV 420
           DLKTNLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKV
Sbjct: 361 DLKTNLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKV 420

Query: 421 ALLRRIKYTGFEPTCTNILAKTFYRRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKD 480
           ALLRRIKYTGFEPTCTNILAKTFYRRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKD
Sbjct: 421 ALLRRIKYTGFEPTCTNILAKTFYRRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKD 480

Query: 481 TKVEILESKTIDLLLE 496
           TKVEILESKTIDLLLE
Sbjct: 481 TKVEILESKTIDLLLE 496

>Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..9972)
           [1281 nt, 427 aa]
          Length = 426

 Score =  203 bits (517), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 176/286 (61%), Gaps = 14/286 (4%)

Query: 217 FNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKLVPNKGLI 276
           F LQ+  + L + +  G++L+I F++ +YH+    S  WP+LLP +F+  T       +I
Sbjct: 148 FELQKKRAQLTYKAKEGNMLQIQFEISVYHIIIPTSNQWPTLLPRIFNPAT-------VI 200

Query: 277 ENID-----LTNEKLPLLSEVKVMLNSLG--SRSHSPKNETFKNIDYKLNLSLINSFNNT 329
           E ++     +    LP L  +  M++SLG   R    + ++++ ID+ L L L  +F N 
Sbjct: 201 EKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKLTQTFANN 260

Query: 330 SDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTK 389
           ++KK+++IT+ N K+ +   RY ++K  +EE L+  L+ K+++LVILRPGP+VG PMT  
Sbjct: 261 NNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIVGVPMTDA 320

Query: 390 LIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRRPGT 449
           + P     LK++D+ ++Q I  K++  DYK+A L++ + TG  P  T+ILAKT YR+PGT
Sbjct: 321 INPEFNPILKKSDNLVEQSILLKKYLLDYKLATLKKYRSTGIAPRLTDILAKTMYRKPGT 380

Query: 450 SLLGYTIPASKVAEVMVFKGLCVGLENVHKDTKVEILESKTIDLLL 495
           S+LGY IPA+KVA+V   K +   + + +    V+I+ S+ ID L+
Sbjct: 381 SVLGYCIPATKVAKVAALKAIEPTIASTYSKPDVQIITSRQIDELV 426

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 61/116 (52%), Gaps = 14/116 (12%)

Query: 22  VPIESSIDRFSDNILVVGSTGLIGRNVLKSFFDTDLYIKHSQELK-RLIASSEYDSTT-- 78
           +P       FS+ I +VGSTGL  +  L S  D + Y+ +S E+K +L   S+ +  +  
Sbjct: 6   LPTSCPEKNFSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIEIPSNH 65

Query: 79  -RIKEVTIKKTAYSLTRKRQSVELFKNKTI----VGQ-KLKEVE--LD---GKTFY 123
            ++  + I K  + + R+ Q+++LF    +    VG+ K K++E  LD   G+T Y
Sbjct: 66  QKMNTIKIVKNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRLDKTPGETSY 121

>TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {ON}
           Anc_5.348 YDR317W
          Length = 411

 Score =  160 bits (404), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 135/468 (28%), Positives = 220/468 (47%), Gaps = 68/468 (14%)

Query: 28  IDRFSDNILVVGSTGLIGRNVLKSFFDTDLYIKHSQELKRLIASSEYDSTTRIKEVTIKK 87
           I +++D+ L  GS+GLIG   LK     DLY+ + + +++ + + E+ + +  +     K
Sbjct: 4   IQQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFR---FNK 60

Query: 88  TAYSLTRKRQSVELFKNKTIVGQKLKEVELDGKTFYLQFDLLKQINDSGEPKESFLKSLT 147
             Y + RK            +G   K + LD +  YL+ D L  I        SF K+  
Sbjct: 61  LIYCINRK------------IG--YKNILLDNEQ-YLKADKLAPI--------SFNKA-- 95

Query: 148 TKKMLEALTHGKGVKVTSNSKENQGISVRNEESSILKKDKSLLFSVINYNESEGNVILQP 207
                E +T      +  + K++   S+ N  S     D+S    +  +N S GNV+   
Sbjct: 96  -DYRFEKIT-----SICPSVKKHSNQSLVNNVS-----DESGTLYI--HNNSAGNVL--- 139

Query: 208 QEYSNVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNT 267
                 + + ++Q Y     + S +   L I F+  +  ++  DS+ W  LLP +F    
Sbjct: 140 ------KYHRSMQTYQVE--YKSENSKKLLITFNFVILQIACPDSSKWCELLPDIFSGCV 191

Query: 268 KLVPNKGLIENIDLTNEKLPLLSEVKVMLNSLGSRSHSPKNETFKNIDYKLNLSLINSFN 327
            L          D T  KLP L E+  M+ +LG+ S   K +    +DY+L   L  SFN
Sbjct: 192 ALRSE----AEPDGTTNKLPPLDEIPTMICTLGAGSRQSKAKR-HYVDYELTFKLAQSFN 246

Query: 328 NTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLV---GT 384
           N   K+++I+T+ N  +      Y   K  LE DL+  L  ++ +LV+LRPGPLV   G 
Sbjct: 247 NCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEHGR 306

Query: 385 PMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFY 444
           P+T  L  G + ++      LKQ++ YK + F  K+AL +  +  GF    + ++A+T Y
Sbjct: 307 PLTKSLTIGHSTNM------LKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTMY 360

Query: 445 RRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKDTKVEILESKTID 492
           R+PG+ +LGY IPA+K A V   K       +      VEI+ S+ +D
Sbjct: 361 RKPGSWMLGYCIPATKAAYVAASKA--TDEASDEASDPVEIITSEQMD 406

>Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  160 bits (404), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 129/471 (27%), Positives = 221/471 (46%), Gaps = 71/471 (15%)

Query: 31  FSDNILVVGSTGLIGRNVLKSFFDTDLYIKHSQELKRLIASSEYDSTTRIKE-VTIKKTA 89
           F+D+IL+ GS+GL G+  L++  D + YIK+  +L+      + DS T I E V + K  
Sbjct: 8   FTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQ-----DKLDSLTEINENVVLNKHI 62

Query: 90  YSLTRKRQSVELFKNKTIVGQKLKEVELDGKTFYLQFDLLKQINDSGEPKESFLKSLTTK 149
           + + RK  + +    KTI    +K +   G  +YL+          GE +       T +
Sbjct: 63  FCINRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLR--------SRGENE-------TKR 107

Query: 150 KMLEALTHGKGVKVTSNSKENQGISVRNEESSILKKDKSLLFSVINYNESEGNVILQPQE 209
           +   + T              +GI +RN     + KDK   FS                 
Sbjct: 108 ETCNSNTF-------CYDDFEEGI-IRNS----MDKDKKGTFSFA--------------- 140

Query: 210 YSNVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKL 269
                  +N +Q+  +L +A    +   I ++  +  L    ST WP LLP +F    KL
Sbjct: 141 -------YNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTSWPKLLPEVFSGTQKL 193

Query: 270 VPNKGLIENIDLTNEK-LPLLSEVKVMLNSLGSRSHSPKNETFKN--IDYKLNLSLINSF 326
              +  +++ D  ++K LP L+ +  M+ +LGS +   +     N  +DY L+ +L   F
Sbjct: 194 --ERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVDYHLSFNLAQEF 251

Query: 327 NNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLV---G 383
            NT+DKK+++ITS N    +    Y   K  LE DL+  L NK+ EL+ILRPGP+    G
Sbjct: 252 TNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKELIILRPGPMCGQHG 311

Query: 384 TPMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTF 443
            P+  ++       +++N +  ++   Y R+   YK   +  ++  G     + ++A + 
Sbjct: 312 NPVHVEM------DIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLSEVIASSI 365

Query: 444 YRRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKDTKVEILESKTIDLL 494
           YR PG++LLGY++P SKV+ V     + +  ++     KVE++ S  ID++
Sbjct: 366 YRMPGSALLGYSVPVSKVSYVASL--MAIEKKSKEAGPKVEVINSYQIDMI 414

>CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317w
          Length = 424

 Score =  155 bits (392), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 127/434 (29%), Positives = 199/434 (45%), Gaps = 60/434 (13%)

Query: 31  FSDNILVVGSTGLIGRNVLKSFFDTDLYIKHSQELKRLIASSEYDSTTRIKEVTIKKTAY 90
           F  NIL+ GSTGL G  V +   D   Y+  + EL+ L+  +  +    ++ VTIK   Y
Sbjct: 19  FEKNILLFGSTGLTGSLVFEYLLDPCFYLNSAVELRELLLEAIEEG---LENVTIKTCLY 75

Query: 91  SLTRKRQSVELFKNKTIVGQKLKEVELDGKTFYLQFDLLKQINDSGEPKESFLKSLTTKK 150
              RK                                        GEP + +LKS +   
Sbjct: 76  CFNRK---------------------------------------IGEPLDKYLKSPSANS 96

Query: 151 MLEALTHGKGVKVTSNSKENQGISVRNEESSILKKDKSLLFSVINYNESEGNVILQPQEY 210
                 +G      S    N+G  V  +    ++      F    Y + +G  +      
Sbjct: 97  FGPFCFNG------SQYHYNKGTCVPLDIDQDIETSNDATFDGFLYYKDKGKNVTGKNPI 150

Query: 211 SNVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKLV 270
           S    Y+  ++Y   L + S+ G++LK+NF      L   +S  WPS++P++F    + +
Sbjct: 151 SGE--YYG-KEYMYYLEYMSAEGNLLKLNFIFNHIQLIIKNSFSWPSVIPIIFSDEVEAI 207

Query: 271 PNKGLIENIDLTNEKLPLLSEVKVMLNSLGSRSHSPK--NETFKNIDYKLNLSLINSFNN 328
             +   E + L     PLLS++K M++++G+ ++  K  N T+ +IDY+LN+ L+ +F+N
Sbjct: 208 SFR---EKMPL-KRYFPLLSDIKTMISTIGTTTNRNKISNTTYNDIDYQLNVDLVKAFSN 263

Query: 329 TSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTT 388
           T DK VII+TS N  I +  S Y   KM LE  L   +   +  L ILRPGPLVG    +
Sbjct: 264 TDDKSVIIVTSFNNTIISTVSPYFKIKMKLESTLANAITPPLKTLTILRPGPLVG--RHS 321

Query: 389 KLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRRPG 448
            + P   + LK N S  ++ + +K+         +  I+  G     + I+A+TFYR PG
Sbjct: 322 DIYPTNDSILK-NSSLFERALLHKKAFLQNMECFVDDIRTGGMSIKASEIVARTFYRIPG 380

Query: 449 TSLLGYTIPASKVA 462
           + LLGY IPA KVA
Sbjct: 381 SKLLGYCIPAQKVA 394

>Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  154 bits (390), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 132/480 (27%), Positives = 212/480 (44%), Gaps = 75/480 (15%)

Query: 24  IESSIDRFSDNILVVGSTGLIGRNVLKSFFDTDLYIKHSQELKRLIASSEYDSTTRIKE- 82
           +  +I  F+D IL+ GS+GL GR  L++  D + YIK+  +L+      + DS   IKE 
Sbjct: 1   MSDNISVFTDYILLFGSSGLAGRGTLENLLDINFYIKNVSDLQ-----DKLDSLKEIKED 55

Query: 83  VTIKKTAYSLTRKRQSVELFKNKTIVGQKLKEVELDGKTFYLQFDLLKQINDSGEPKESF 142
           V + K  + + R+  + +    KTI    +K +   G  +YL+    +  ND+G    S 
Sbjct: 56  VVLNKHVFCINRRNVTEQKSFLKTIDYVNMKSITWKGGRYYLR---SRTANDNGRETSS- 111

Query: 143 LKSLTTKKMLEALTHGKGVKVTSNSKENQGISVRNEESSILKKDKSLLFSVINYNESEGN 202
             +       E    G                                     Y   +GN
Sbjct: 112 TDTFFYDNFEEGFIRGAA-----------------------------------YEGQKGN 136

Query: 203 VILQPQEYSNVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVL 262
                         +N +Q+  SL +A    +   I ++  +  L    S  WP LL  +
Sbjct: 137 FSFA----------YNQKQFSYSLHYACRKEESFGIKYNFTVTQLIIPPSESWPRLLSRI 186

Query: 263 FDSNTKLVPNKGLIENIDLTNEK-LPLLSEVKVMLNSLGSRSHSPKNETFKN--IDYKLN 319
           F    KL   K  I+N     +K LP L ++  M+ +LGS S   +     N  +DY L 
Sbjct: 187 FSKEQKL--EKFDIDNKTYVADKSLPSLRDIGTMVCTLGSTSARVRRTQVPNSFVDYHLV 244

Query: 320 LSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPG 379
            SL   F NT++K+++++TS N  +      Y   K  LE DL+  L NK+ ELVILRPG
Sbjct: 245 FSLAQEFANTTNKRLVVVTSFNNDLLMRTFEYFRIKAKLENDLEEALPNKLKELVILRPG 304

Query: 380 PLVGT---PMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCT 436
           P+ G    P+  KL       ++ N +  ++++ Y R+   YK   +   +  G     +
Sbjct: 305 PMCGQHGDPVNVKL------DVQENPTFSERILYYPRYVLKYKKQYISEARKVGLRTKLS 358

Query: 437 NILAKTFYRRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKDT--KVEILESKTIDLL 494
            ++A + YR PG++LLGY++P SKV+ V   K     +E   K+   KVE++ S  ID++
Sbjct: 359 ELIASSIYRMPGSALLGYSVPVSKVSYVTSLK----AIEKRSKEAGPKVEMINSYQIDMI 414

>ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 415

 Score =  150 bits (379), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 120/434 (27%), Positives = 198/434 (45%), Gaps = 64/434 (14%)

Query: 31  FSDNILVVGSTGLIGRNVLKSFFDTDLYIKHSQELKRLIASSEYDSTTRIKEVTIKKTAY 90
           F D+IL+ GSTGLIG   L+     +LY+    +L+  +   E    + I   T+ K  Y
Sbjct: 13  FQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKL---ELYENSDINHFTLNKFFY 69

Query: 91  SLTRKRQSVELFKNKTIVGQKLKEVEL--DGKTFYLQFDLLKQINDSGEPKESFLKSLTT 148
            + RK  + +       + ++ K   L   G+ +YL        N S  P  S       
Sbjct: 70  CVNRKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLH------NNTSATPPAS------- 116

Query: 149 KKMLEALTHGKGVKVTSNSKENQGISVRNEESSILKKDKSLLFSVINYNESEGNVILQPQ 208
                            +S  + G +V  E+ +I      L  +V N             
Sbjct: 117 ----------------QSSNPSLGNNVFEEDGTI-----QLTKTVDN------------- 142

Query: 209 EYSNVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTK 268
              +V   F   +    L + S     L I F   +  L   DST W  LLP +F    +
Sbjct: 143 --RSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDSTRWADLLPSIFSGEVE 200

Query: 269 LVPNKGLIENIDLTNEKLPLLSEVKVMLNSLGSRSHSPKNETFKN--IDYKLNLSLINSF 326
           LVP     E  + T+ +LP L +VK M+ +LG  S S K+  +    ++Y+L   ++ +F
Sbjct: 201 LVP-----EESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQNF 255

Query: 327 NNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPM 386
            +  DK+++I+TS N  + +    Y   K  LE DL+  +   + +LV+LRPGP+VG  +
Sbjct: 256 ASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLRPGPIVGNHV 315

Query: 387 TTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRR 446
               +      L+ + S  +QL +YK + ++YK + ++ I+  GF+   + ++AK  YR+
Sbjct: 316 N---LNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTKASELVAKAMYRK 372

Query: 447 PGTSLLGYTIPASK 460
           PG+S+LGY +PASK
Sbjct: 373 PGSSVLGYCVPASK 386

>YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Protein
           of unknown function involved in DNA repair
          Length = 414

 Score =  139 bits (349), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 127/486 (26%), Positives = 217/486 (44%), Gaps = 92/486 (18%)

Query: 27  SIDRFSDNILVVGSTGLIGRNVLKSFFDTDLYIKHSQELKRLIASSEYDSTTRIK-EVTI 85
           S++ F+D +L+ GS+ L+G+ +L++  D +LYIK+  +L+      + DS + IK  V +
Sbjct: 4   SVNTFTDYVLLFGSSSLVGKGILENLLDINLYIKNVSDLQ-----GKLDSLSEIKGNVVL 58

Query: 86  KKTAYSLTRKRQSVELFKNKTIVGQKLKEVELDGKTFYLQFDLLKQINDSGEPKESFLKS 145
            K  + + R+                                    IN+    ++SF+K+
Sbjct: 59  NKHVFCVNRR-----------------------------------CINE----EKSFMKT 79

Query: 146 LTTKKMLEALTHGKGVKVTSNSKENQGISVRNEESSILKKDKSLLFSVINYNESEGNVIL 205
           +    M  ++T   G     + KE     V +  ++         F   N+   EG +  
Sbjct: 80  IDYINM-RSVTWQGGRYYLRSRKEKDTEKVPSSPNT---------FCYDNF--EEGFIKN 127

Query: 206 QPQE-----YSNVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLP 260
            P+E     YS V   +N +Q+  +L +A      ++I  +  +  L    S  WP LLP
Sbjct: 128 TPEERGKDGYSFV---YNQKQFSYTLHYACGKEKGIEIICNFTVTQLIIPRSETWPKLLP 184

Query: 261 VLFDSNTKLVPNKGLIENIDLTNE------KLPLLSEVKVMLNSLGSRSHSPKNETFKN- 313
            +F    KL       E  D+ N+       LP L ++  M+ SLGS S   +     + 
Sbjct: 185 RIFSGTQKL-------EKFDIDNKNYVPGRSLPSLCDISTMVCSLGSTSARVRRTQVPSS 237

Query: 314 -IDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINE 372
             DY L  +L   F NT++K++++ T+ N    +    Y   K  LE DL   L NK+ E
Sbjct: 238 FADYYLPFNLAQEFTNTTNKRLVVTTAFNNDFLSKTFEYFRIKAKLENDLDEALPNKLKE 297

Query: 373 LVILRPGPLV---GTPMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYT 429
           LVILRPGP+    G P+  +L        K N + L+++  Y  +   YK   +   +  
Sbjct: 298 LVILRPGPMCGQHGNPINVEL-------GKENSTFLEKIFYYPHYLLVYKKKYISEARRI 350

Query: 430 GFEPTCTNILAKTFYRRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKDTKVEILESK 489
           G     + I+A + YR PG++LLGY +P SKV+ V     + +  ++     K+E++ S 
Sbjct: 351 GLRTKLSEIIASSIYRMPGSALLGYAVPVSKVSYVASL--MAIERKSKEAGPKLEVISSY 408

Query: 490 TIDLLL 495
            ID+++
Sbjct: 409 QIDMIV 414

>Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  135 bits (339), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 120/479 (25%), Positives = 213/479 (44%), Gaps = 81/479 (16%)

Query: 28  IDRFSDNILVVGSTGLIGRNVLKSFFDTDLYIKHSQELKRLIASSEYDSTTRIK-EVTIK 86
           I+ F+D IL+ GS+GL G+  L++  D + YIK+  +L+      + +S T IK +V + 
Sbjct: 5   INAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQ-----DKLNSLTEIKGDVVLN 59

Query: 87  KTAYSLTRKRQSVELFKNKTIVGQKLKEVELDGKTFYLQFDLLKQINDSGEPKESFLKSL 146
           K  + + R+  + E                                       +SF+KS+
Sbjct: 60  KHVFCINRRSITEE---------------------------------------KSFMKSI 80

Query: 147 TTKKMLEALTHGKGVKVTSNSKENQGISVRNEESSILKKDKSLLFSVINYNESEGNVILQ 206
               M +++T  +G     +  EN+   + +   +              Y+  E   I +
Sbjct: 81  DYINM-KSITWKRGRYYLRSRNENETKKIPSNPDTFC------------YDAFEEGFIKK 127

Query: 207 PQEYSNVECY---FNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLF 263
             + +  + +   +N +++  +L +AS   +  +I +   +  L    S  W  LL  +F
Sbjct: 128 TTDENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWSRLLSYIF 187

Query: 264 DSNTKLVPNKGLIENIDLTNE------KLPLLSEVKVMLNSLGSRSHSPKNETFKN--ID 315
               KL       E  D  N+       LP L ++  M+ +LGS S   +     N  +D
Sbjct: 188 SGTQKL-------EKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVD 240

Query: 316 YKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVI 375
           Y L  SL   F NT+DK+++IITS N K  +    Y   K  LE DL+  L NK  EL+I
Sbjct: 241 YSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELII 300

Query: 376 LRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTC 435
           LRPGP+ G    +  +      ++ N +   +++ Y R+   YK   +  ++  G     
Sbjct: 301 LRPGPMCGQHGNSIKV---ELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKL 357

Query: 436 TNILAKTFYRRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKDTKVEILESKTIDLL 494
           + ++A + YR PG++LLGY++P SKV+ V     + +  ++     K+E++ S  ID++
Sbjct: 358 SELIASSTYRMPGSALLGYSVPVSKVSYVASL--MAIERKSKEAGPKMEVINSYQIDMI 414

>KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weakly
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 514

 Score =  123 bits (308), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 122/482 (25%), Positives = 209/482 (43%), Gaps = 73/482 (15%)

Query: 11  IKHTEEIINPDVP-------------IESSIDRFSDNILVVGSTGLIGRNVLKSFFDTDL 57
           I+H + +I P  P             +  S  R +DN+L++G+TGL G  +L +     +
Sbjct: 46  IRHDQILIWPRQPSPVRSTDDLADGMVSLSTQRVTDNVLILGATGLTGSLILANLAQPWI 105

Query: 58  YIKHSQELKRLIASSEYDSTTRIKE--VTIKKTAYSLTR---KRQSVELFKNKTIVGQKL 112
           Y+  + +L+  + S       R  +  + +KK    L     +R+S+E+ KN   + ++ 
Sbjct: 106 YLNATNDLQSKVDSLYPADLERFTKHNIFVKKPKSPLCNILVRRKSIEVTKNLYCLARRP 165

Query: 113 KEVE---LDGKTFYLQFDLLKQINDSGEPKESFLKSLTTKKMLEALTHGKGVKVTSNSKE 169
             VE   LDG                     S+  ++  K     L  GKG         
Sbjct: 166 IAVEGMPLDGL------------------DASWEHTVRCKGF--DLICGKG--------- 196

Query: 170 NQGISVRNEESSILKKDKSLLFSVINYNESEGNVILQPQEYSNVECYFNLQQYDSSLIFA 229
             GIS        L+++ ++      +N     +ILQ Q +S     F L   +S     
Sbjct: 197 --GIS----RDCTLERNAAMYELASTHNCPGREIILQLQSFS-----FKLVYENSRDPHG 245

Query: 230 SSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNT---KLVPNKGLIENIDLTNEKL 286
            + G  L +  ++ +  +   DS  WP+LL  +F        L+P    +E I  ++ + 
Sbjct: 246 DTCGHALMVKLNINVICVIDTDSQRWPALLTDVFGEQPMKRGLIPQGQGLEGI--SHWEF 303

Query: 287 PLLSEVKVMLNSLGSRSHSPKNETFKN--IDYKLNLSLINSFNNT----SDKKVIIITSV 340
           P L +V  ++++LGS  H  +  +     +DY+LNL+L   F       + KK++++TS 
Sbjct: 304 PSLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSF 363

Query: 341 NKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKR 400
           N  + +  S Y   K+ LE+DL T + + ++ LV+LRPGPLVG        P  T     
Sbjct: 364 NSSLLSTVSNYFQTKLKLEQDLYTKV-HGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTF 422

Query: 401 NDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRRPGTSLLGYTIPASK 460
             ++L  ++  K+  FD KV LLR +   G     + + A+  Y+ P   L+     A K
Sbjct: 423 LPAALFHILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHK 482

Query: 461 VA 462
           VA
Sbjct: 483 VA 484

>Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {ON}
           YDR317W - Hypothetical ORF [contig 272] FULL
          Length = 506

 Score =  106 bits (264), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 122/488 (25%), Positives = 215/488 (44%), Gaps = 72/488 (14%)

Query: 11  IKHTEEIINPD----VPIESSID---------RFSDNILVVGSTGLIGRNVLKSFFDTDL 57
           I+H + +I+P     V I  + D         R  D+ L+ G TGL G  +  +     +
Sbjct: 42  IRHDQILISPQQRSLVQIARNADSEVLNVPSNRTVDSTLIFGITGLTGGLIAANLAQPWV 101

Query: 58  YIKHSQELKRLIAS-SEYDSTTRIKEVTIKKTAYSLTR---KRQSVELFKNKTIVGQK-- 111
           Y+  + +L+R I+S   +          +++T   L     K +SVE+ KN     ++  
Sbjct: 102 YLNATNDLQRKISSLFPFSDQLEKHHHFMRRTRSPLCNLLTKEKSVEVTKNLFCFTRRSV 161

Query: 112 -LKEVELDGKTFYLQFDLLKQINDSGEPKESFLKSLTTKKMLEALTHGKGVKVTSNSKEN 170
            L+++ LDG            ++ S E    +                KG K+   SKEN
Sbjct: 162 TLEQICLDG------------LDASWEHSIDY----------------KGSKMVC-SKEN 192

Query: 171 QGISVRNEESSILKKDKSLLFSVINYNESEGNVILQPQEYSNVECYFNLQQYDSSLIFAS 230
                   E   +K+  +  F   + +     + +Q Q+++     ++L   +S  +   
Sbjct: 193 LSC-----EEPFVKRGTTTFFQDAS-DAPAVTLTIQLQKFT-----YHLNYDNSRDVHGE 241

Query: 231 SSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKLVP--NKGLIENIDLTNEKLPL 288
           +    L I   + +  +   DS  WP LL  +F  +    P   K   E I  T    P 
Sbjct: 242 TCRHTLMIQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTA---PP 298

Query: 289 LSEVKVMLNSLGSRSHSPKNETFKN--IDYKLNLSLINSFNNTS----DKKVIIITSVNK 342
           L+++  M++SLGS+S   K         DY+LN+ L ++F        +KK++IITS N 
Sbjct: 299 LTQINTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNN 358

Query: 343 KIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKRND 402
              +  S Y   K++LE+DL T +   +++LV+LRPGPLVG        P +        
Sbjct: 359 LFLSSTSDYFQSKLMLEQDLVTKV-QALDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIP 417

Query: 403 SSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRRPGTSLLGYTIPASKVA 462
           +++ +++ +K+   + K+ LLR I   G     + ++A+  Y+R  + LLG+ +PA KVA
Sbjct: 418 TAMFKVLKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVA 477

Query: 463 EVMVFKGL 470
            V   + +
Sbjct: 478 FVASIRAV 485

>SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {ON}
           weakly similar to uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W Hypothetical ORF
          Length = 505

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 134/276 (48%), Gaps = 21/276 (7%)

Query: 193 VINYNESEGNVILQPQEYSNVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDS 252
           ++N NE   N I    +    +  F  Q+ D S+    +    L I+  + +  +   +S
Sbjct: 201 LVNSNE---NSITNQCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPNS 257

Query: 253 TIWPSLLPVLF-DSNTKLVPNKGLIENIDLTNEKLPLLSEVKVMLNSLGSRSHSPKNETF 311
            +WP LL   F D++T +  +   ++    T    P LS+V  ++++LGS +   K    
Sbjct: 258 KLWPLLLHSTFGDTDTNVALH---VQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHV 314

Query: 312 KN--IDYKLNLSLINSFNNTSD-----KKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKT 364
               +DY LN  +   F   S      KKV++ITS N    +  S Y + K+ LE+DL T
Sbjct: 315 SRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLAT 374

Query: 365 NLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQL---INYKRFAFDYKVA 421
            +  +++ELVILRPGPL+G+  T + IPG     K  +  LK L     YK+  +D+K  
Sbjct: 375 RIP-ELDELVILRPGPLIGS-HTPEFIPGDPP--KSTNGLLKPLSTVCYYKKACYDHKRH 430

Query: 422 LLRRIKYTGFEPTCTNILAKTFYRRPGTSLLGYTIP 457
            L+ +   G +   T + A+  YR   + + GY++P
Sbjct: 431 FLQSVTQVGLKTKMTEVFARLIYRSSCSWMFGYSVP 466

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 120/455 (26%), Positives = 194/455 (42%), Gaps = 64/455 (14%)

Query: 20  PDVPIESSIDRFSDNILVVGS------TGLIGRNVLKSFFDTDLYIKHSQELKRLIAS-- 71
           PD+  E      +   L+  S      TGL G  +L S  +  LY+  + +++  I    
Sbjct: 55  PDIEFEQQCGSLTTPNLLTDSYLLLGTTGLTGGIILNSLAEPWLYLGTTNDVQDKIQMMF 114

Query: 72  SEYDSTTRIKEVTIKKTAYSLTRKRQSVELFKNKTIVGQKLKEVELDGKTFYLQFDLLKQ 131
              D ++      +K+T   + R  +S+E+ KN     +KL  +E+     Y        
Sbjct: 115 EAGDLSSESNPPNVKRTFGQILRGEKSIEITKNLFCFNRKLALLEIPSTPEY-------- 166

Query: 132 INDSGEPKESFLKSLTTKKMLEALTHGKGVKVTSNSKENQGISVRNEESSILKKDKSLLF 191
           IND  E    +                KG K  S  K N    V       LK  K    
Sbjct: 167 INDYWEYSIDY----------------KGTKYHSK-KNNISFGV-----PTLKFGK---- 200

Query: 192 SVINYNESEGNVILQPQEYSNVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVD 251
            ++N NE   N I    +    +  F  Q+ D S+    +    L I+  + +  +   +
Sbjct: 201 -LVNSNE---NSITNQCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPN 256

Query: 252 STIWPSLLPVLF-DSNTKLVPNKGLIENIDLTNEKLPLLSEVKVMLNSLGSRSHSPKNET 310
           S +WP LL   F D++T +  +   ++    T    P LS+V  ++++LGS +   K   
Sbjct: 257 SKLWPLLLHSTFGDTDTNVALH---VQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSH 313

Query: 311 FKN--IDYKLNLSLINSFNNTSD-----KKVIIITSVNKKIYTFFSRYLNYKMVLEEDLK 363
                +DY LN  +   F   S      KKV++ITS N    +  S Y + K+ LE+DL 
Sbjct: 314 VSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLA 373

Query: 364 TNLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQL---INYKRFAFDYKV 420
           T +  +++ELVILRPGPL+G+  T + IPG     K  +  LK L     YK+  +D+K 
Sbjct: 374 TRIP-ELDELVILRPGPLIGS-HTPEFIPGDPP--KSTNGLLKPLSTVCYYKKACYDHKR 429

Query: 421 ALLRRIKYTGFEPTCTNILAKTFYRRPGTSLLGYT 455
             L+ +   G +   T + A+  YR   + + GY+
Sbjct: 430 HFLQSVTQVGLKTKMTEVFARLIYRSSCSWMFGYS 464

>TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.348
           YDR317W
          Length = 372

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 105/403 (26%), Positives = 174/403 (43%), Gaps = 52/403 (12%)

Query: 34  NILVVGSTGLIGRNVLKSFFDTDLYIKH---SQELKRLIASSEYDSTTRIKEVTIKKTAY 90
           N +  GSTG+ G   L +  + + Y++       +  L    ++ +     ++ + K  +
Sbjct: 6   NYIFFGSTGMTGFTTLTNLLNINSYLQAKDPQSAIDNLPQDFQWQACDDSLDLYLVKNIF 65

Query: 91  SLTRKRQSVELFKNKTIVGQKLKEVELDGKTFYLQF--DLLKQINDSGEPKESFLKSLTT 148
            + R+     ++ ++ I+   +  +    KTF LQF  +     N+  E  E  L  ++T
Sbjct: 66  CINRRFFDSPIYLDEKIISSNI-SINYKDKTFELQFQSNTNSVSNNITEQNELKLPLVST 124

Query: 149 KKMLEALTHGKGVKVTSNSKENQGISVRNEESSILKKDKSLLFSVINYNESEGNVILQPQ 208
             +   +  G     T+  KENQ          IL  D+                     
Sbjct: 125 DCLRYFIDTGNIQLETTPGKENQ----------ILTTDEVWY------------------ 156

Query: 209 EYSNVECYFNLQQYDSSLIFASS---SGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDS 265
            ++   C  N +Q + +     +       +K+N+ + +Y      S  W  +LP +F  
Sbjct: 157 HFNQQLCQLNFKQINLNENENDNDNVQEKFIKLNYIINIYQFVLPKSDTWLEVLPNIFKP 216

Query: 266 NTKLVPNKGLIEN-ID-LTNEK----LPLLSEVKVMLNSLGSRSHSPKNETFKNIDYKLN 319
            T L        N ID  TNEK    LP L +++VM+ +LG+     +    K ID+ L 
Sbjct: 217 TTILHSKINCTWNYIDQFTNEKSNIVLPKLEDIQVMICTLGTNLLCDQ----KKIDFDLT 272

Query: 320 LSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPG 379
             L N F+N   KK++I+T+ N  + +    Y N K  LE+ LK +LD  + ELVILRPG
Sbjct: 273 FQLSNWFSNRLGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPG 332

Query: 380 PLVGTPMTTKLIPGLTAHLKRNDSS--LKQLINYKRFAFDYKV 420
           PL+GT +   L P     +  N S+  LKQL  YK F  ++K 
Sbjct: 333 PLLGTHV---LNPSEEQAVVLNHSTKILKQLWFYKTFFSNHKC 372

>AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR317W
          Length = 542

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 126/266 (47%), Gaps = 26/266 (9%)

Query: 212 NVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKLVP 271
            ++C+++  QY+  ++   ++G++   N  + +  +   DS  WP L   +F        
Sbjct: 260 GLKCHWD--QYNWDVVL--TTGEVR--NATINVVQVVQPDSRRWPDLFNKMFT------- 306

Query: 272 NKGLIENIDLTNE-KLPLLSEVKVMLNSLGSRSHSPKNETFKN--IDYKLNLSLINSF-- 326
             G +   +  +E  +P ++E++ ++++LGS S   +        +DY LN+ +  +F  
Sbjct: 307 --GGVRTFNAYSEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAP 364

Query: 327 --NNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGT 384
                + K ++I+TS N       S+Y   K  LE DL  ++   +  L ILRPGPL+G 
Sbjct: 365 DPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPG-LTHLTILRPGPLLGE 423

Query: 385 PMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFY 444
             +    P ++       + L +   YK+     +   L ++K  G     T ++AK  Y
Sbjct: 424 HGSK---PVISPTNPDTGNMLTRCYTYKKNVMRTQFNWLAQVKEVGPTTKVTELVAKATY 480

Query: 445 RRPGTSLLGYTIPASKVAEVMVFKGL 470
             PG  ++GY+IPA +VA++   + L
Sbjct: 481 HLPGNWIVGYSIPAGRVAQIAAQEAL 506

>KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {ON}
           Anc_5.348 YDR317W
          Length = 345

 Score = 87.0 bits (214), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 88/160 (55%), Gaps = 4/160 (2%)

Query: 228 FASSSGDILKINFDLKLYHLSAV--DSTIWPSLLPVLFDSNTKLVPNKGLIENIDLTNEK 285
           F  S+ +  ++N    ++H+  V  +S  WP LLP+LF    ++   +   + +     K
Sbjct: 134 FGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIARKRKDRLFPELFK 193

Query: 286 LPLLSEVKVMLNSLGSRSHSPK--NETFKNIDYKLNLSLINSFNNTSDKKVIIITSVNKK 343
           L  ++++  ++ +LG+ S + K  N T   IDY L  +LI +F  T +KKVII+TS N  
Sbjct: 194 LANINDISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTENKKVIIVTSFNNA 253

Query: 344 IYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVG 383
           + +    Y   K+ LE DLKT L+  I EL ILRPGP+ G
Sbjct: 254 LISNIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKG 293

>Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AGR348W
          Length = 471

 Score = 87.4 bits (215), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 77/260 (29%), Positives = 122/260 (46%), Gaps = 22/260 (8%)

Query: 217 FNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKLVPNKGLI 276
           F   Q+D  L   +   D +K N  + ++ +   DS  W      LF  N      K L 
Sbjct: 193 FQWDQFDWELKLPT---DEVK-NVTVNVFQIIQNDSKKWDKTFSELFTGN-----RKPLN 243

Query: 277 ENIDLTNEKLPLLSEVKVMLNSLGSRS-HSPKNETFKN-IDYKLNLSLINSFNNTSDKKV 334
           + I++    LP + +V+ ++++LGS S  S K +T ++ +DY LN+ +   F     K +
Sbjct: 244 DRIEVY---LPSIDQVETLISTLGSSSWESRKMKTPRSFVDYTLNMDMAKVFAPDQKKSL 300

Query: 335 I----IITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTKL 390
           I    I+TS N       S Y   K  LE DL  ++   +  L ILRPGPL+G     ++
Sbjct: 301 IKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPG-LTHLTILRPGPLIGQ-HGKQI 358

Query: 391 IPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRRPGTS 450
           I  L   L      L +   +KR     K+  L ++K  G     T ++AK  Y  PG  
Sbjct: 359 I--LAPQLPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSKKVTELIAKATYHLPGNW 416

Query: 451 LLGYTIPASKVAEVMVFKGL 470
           ++GY+IP+SKVA +   + +
Sbjct: 417 IVGYSIPSSKVARIAAKEAM 436

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 17/64 (26%)

Query: 4   DQSNIEIIKHTEEIINPDVPIESS----------------IDRFSDNILVVGSTGLIGRN 47
           DQ N +II  T  + +P  P +SS                ++   DN++++GSTGL G  
Sbjct: 56  DQ-NQQIISTTTPVNSPPPPEDSSAAKAISVPKVSINPPKVNEKGDNVIILGSTGLTGSQ 114

Query: 48  VLKS 51
           VLK 
Sbjct: 115 VLKG 118

>KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W
          Length = 348

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 119/274 (43%), Gaps = 42/274 (15%)

Query: 204 ILQPQEYSNVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLF 263
           + Q  +    +C FN  +  +++ ++++  D++ I  ++++  +   DST W        
Sbjct: 68  MFQKSDLVEWKCVFN--ESSNTISYSTTIHDLISICVNVEVTTIKEPDSTKW-------- 117

Query: 264 DSNTKLVPNKGLIEN--IDLTNEKLPLLSEVKVMLNSLGSRSHSPKNETFKN--IDYKLN 319
               +++P+   I +   DL+            +++ LGS S   K        +D  LN
Sbjct: 118 ---AQMIPHHIFINDPSADLS------------VISCLGSTSARSKRTGVARDWVDKILN 162

Query: 320 LSLINSFNNT---SDK--KVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELV 374
           L ++ +  N    S K  + II+TS N    +    Y   K  LE + +  L N    +V
Sbjct: 163 LDILKAILNNDILSQKLSQYIIMTSFNNFAISRMFPYFKAKQELETNTQFLLQNHRASIV 222

Query: 375 ILRPGPLVGTPMTTK--LIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFE 432
           ILRPGPL+G   +T    +P L      +D  L  ++ YK+  F + V  +   K  G  
Sbjct: 223 ILRPGPLIGKHGSTSSFTVPEL------DDRLLHSILRYKKAIFHHYVRRMNEWKDVGIA 276

Query: 433 PTCTNILAKTFYRRPGTSLLGYTIPASKVAEVMV 466
              + ++A+  Y  PG   +GY +     A V+V
Sbjct: 277 TRTSELVAQFSYNMPGAFFVGYPVKVLDCAHVIV 310

>Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..22242)
           [666 nt, 222 aa]
          Length = 221

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/257 (22%), Positives = 100/257 (38%), Gaps = 81/257 (31%)

Query: 237 KINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKLVPNKGLIENIDLTNEKLPLLSEVKVML 296
           +++F+ K   +   DST W  L+P                              + K + 
Sbjct: 36  ELDFESKANQIVEKDSTKWSELIP-----------------------------DDTKYLF 66

Query: 297 NSLGS-RSHSPKNETFKNIDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYK 355
           + L + R+ +   +    IDY LN+ L  +        +++++S     +++ + YL  K
Sbjct: 67  SGLATTRAAAGGLDNQYKIDYDLNIELAKAAKEKGCSTLVLVSSAGANEHSWIA-YLKMK 125

Query: 356 MVLEEDL-KTNLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQLINYKRF 414
             +E D+ K   D+ I    ILRPG ++G           T+H             +K F
Sbjct: 126 GEIERDMIKLGFDHTI----ILRPGAILGER---------TSH-------------HKGF 159

Query: 415 AFDYKVALLRRIKYTGFEPTCTNILAKTFYRRPGTSLLGYTIPASKVAEVMVFKGLCVGL 474
             D+ V                  + + FYR     L+ Y + A +V++V    G+ + L
Sbjct: 160 GNDFGV-----------------FVGRMFYRSKCQFLVKYPVYAEEVSKV----GVHLAL 198

Query: 475 ENVHKDTKVEILESKTI 491
           EN   D KV+I+ES  I
Sbjct: 199 EN--SDQKVQIIESSEI 213

>KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 222

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 69/171 (40%), Gaps = 34/171 (19%)

Query: 229 ASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKLVPNKGLIENIDLTNEKLPL 288
           A+ S   L  N+D K+  L   DS+ W + +P                EN D        
Sbjct: 32  ATISRKALNGNYDGKVRSLILEDSSNWSAAVP----------------ENYD-------- 67

Query: 289 LSEVKVMLNSLGSRSHSPKNETFKNIDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFF 348
                ++ + L +       E F  +D+ +NL L  S         ++++S      + F
Sbjct: 68  -----ILFSGLATTRGEAGKENFYKVDHDMNLQLARSAKEKGYSTYVVVSSTGADENSMF 122

Query: 349 SRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTK-LIPGLTAHL 398
             Y+  K  LE D+   L       +ILRPGPL+G    +K L+ GL++ +
Sbjct: 123 -YYMKTKGELERDI---LALGFERTIILRPGPLLGERTKSKGLLNGLSSKI 169

>ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar to
           uniprot|P40008 Saccharomyces cerevisiae YER004W FMP52
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 225

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 51/108 (47%), Gaps = 5/108 (4%)

Query: 292 VKVMLNSLGS-RSHSPKNETFKNIDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSR 350
           VK   ++ G+ R+ +   E F  ID+ LN+ L  +        +++++SV     +    
Sbjct: 64  VKFYFSAFGTTRAAAGSAENFYKIDHDLNVELAKAAKTKGCTTMVLVSSVGANENSMLP- 122

Query: 351 YLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTKLIPGLTAHL 398
           Y   K  +E D+   L    +  +ILRPGPL+G   +   + G+T  L
Sbjct: 123 YFKDKGEIERDI---LALDFDHTIILRPGPLLGRQKSKGFLDGITCKL 167

>YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protein
           of unknown function, localized to the mitochondrial
           outer membrane; induced by treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 231

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 72/178 (40%), Gaps = 47/178 (26%)

Query: 314 IDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINEL 373
           ID+ LNL L  +      + +++++S      + F  Y+  K  +E D+   LD K   +
Sbjct: 89  IDHDLNLQLAQAAKEKGCETIVLVSSAGAHPDSRFG-YMKMKGEIERDV-IALDFK--HI 144

Query: 374 VILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEP 433
           +ILRPGPL+G               +R +S                       K +GF  
Sbjct: 145 IILRPGPLLG---------------ERTNS-----------------------KQSGFGG 166

Query: 434 TCTNILAKTFYRRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKDTKVEILESKTI 491
             T  L    YR     LLGY +   +V +V    G+ + L    KD KV+ + SK I
Sbjct: 167 NLTAALGTRVYRSRFQRLLGYPVYGDEVGKV----GVHLALNTSGKD-KVQFVSSKDI 219

>Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W
           (REAL)
          Length = 231

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 68/178 (38%), Gaps = 47/178 (26%)

Query: 314 IDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINEL 373
           ID+ LNL L  +  +   + +++++S      + F  Y+  K  +E D+   +       
Sbjct: 89  IDHDLNLQLARAAKDKGCETIVLVSSAGAHADSRFG-YMKMKGEIERDV---IALNFKHT 144

Query: 374 VILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEP 433
           +ILRPGPL+G               +R +S                       K +GF  
Sbjct: 145 IILRPGPLLG---------------ERENS-----------------------KQSGFGG 166

Query: 434 TCTNILAKTFYRRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKDTKVEILESKTI 491
                L    YR    S LGY +   +V +V V   L     N+   +KV+ + SK I
Sbjct: 167 NLAAALGVRVYRSRFQSWLGYPVYGDEVGKVGVHLAL-----NLTGKSKVQFVSSKEI 219

>Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W
           (REAL)
          Length = 227

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 67/178 (37%), Gaps = 47/178 (26%)

Query: 314 IDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINEL 373
           ID+ LNL L  +      + +++++S      + F  Y+  K  +E D+   +       
Sbjct: 89  IDHDLNLQLARAAKEKGCETIVLVSSAGAHPDSRFG-YMKMKGEIERDV---IALNFKHT 144

Query: 374 VILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEP 433
           +ILRPGPL+G               +R  S                       K +GF  
Sbjct: 145 IILRPGPLLG---------------ERTKS-----------------------KQSGFGG 166

Query: 434 TCTNILAKTFYRRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKDTKVEILESKTI 491
             T  L    YR    S LGY +   +V +V V   L     N  ++ KV+ + SK I
Sbjct: 167 NLTAALGTRVYRSILQSWLGYPVYGDEVGKVGVHLAL-----NSSEENKVQFVSSKDI 219

>Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W
           (REAL)
          Length = 229

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 66/178 (37%), Gaps = 47/178 (26%)

Query: 314 IDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINEL 373
           ID+ LN+ L  +  +     +++++S    + + F  Y+  K  +E D+   +       
Sbjct: 89  IDHDLNMQLARAAKDRGCDTIVLVSSAGAHVDSRFG-YMKMKGEIERDI---IALNFKHT 144

Query: 374 VILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEP 433
           +ILRPGPL+G               KR +S                       K  GF  
Sbjct: 145 IILRPGPLLG---------------KRTNS-----------------------KQNGFGG 166

Query: 434 TCTNILAKTFYRRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKDTKVEILESKTI 491
                L    YR    S LGY +    V +     G+ + L    KD KV+ + SK I
Sbjct: 167 NLAAALGARVYRSRLQSWLGYPVYGDDVGKA----GVHLALNPSEKD-KVQFVSSKDI 219

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 322 LINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPG-- 379
           LIN +NNT D  + +I    +KI   F +  NY++V+   LK  + N ++E   LRPG  
Sbjct: 287 LINEYNNTLDPDMELIEKAEQKIRDAFCQIPNYEIVINSCLKYGIMN-LDEHCSLRPGIP 345

Query: 380 --PLVGTPMTT 388
             P++  P  T
Sbjct: 346 LKPMLAKPTKT 356

>TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.148
           YER004W
          Length = 224

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 314 IDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINEL 373
           ID+ LN+ L            ++++S   K  + F+ Y+  K  +E D+   L    +  
Sbjct: 86  IDHDLNIELAKVAKEKGCSTFVLVSSGGAKEDSMFA-YMKMKGEIERDI---LALGFDHT 141

Query: 374 VILRPGPLVGTPMTTK 389
           +ILRPGPL+G  +T+K
Sbjct: 142 IILRPGPLLGDRLTSK 157

>TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7.148
           YER004W
          Length = 237

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 314 IDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINEL 373
           ID+ LN+              ++++S      + F  YL  K  +E DLK  +D   + L
Sbjct: 90  IDHDLNIDFAKKAKENGCSTFVVVSSAGASADSRFF-YLKMKGEIERDLKA-ID--FDHL 145

Query: 374 VILRPGPLVG 383
           +ILRPGPL+G
Sbjct: 146 IILRPGPLLG 155

>Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa]
           {ON} YER004W - Hypothetical ORF [contig 189] FULL
          Length = 224

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 49/124 (39%), Gaps = 12/124 (9%)

Query: 294 VMLNSLGSRSHSPKNETFKNIDYKLNLSLINSFNNTSDKKVIIITSVNKKIYT-FFSRYL 352
           V+  +L +       E F  +D+ LNL L         K  ++++S      + FF  Y 
Sbjct: 69  VVFTALATTREQAGKEHFYWVDHDLNLQLAQKAKENGCKTFVLVSSAGASEKSPFF--YF 126

Query: 353 NYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQLINYK 412
             K  +E D+   L     + +ILRPG L G     K I      + R  + L   +   
Sbjct: 127 KTKAEIERDI---LALNFEKTIILRPGALFGARDKPKGI------VSRASAKLGSYLYRT 177

Query: 413 RFAF 416
           RF F
Sbjct: 178 RFQF 181

>KNAG0L00925 Chr12 (169763..170449) [687 bp, 228 aa] {ON}
          Length = 228

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 76/203 (37%), Gaps = 48/203 (23%)

Query: 290 SEVKVMLNSLGSRSHSPKNETFKNIDYKLNLSLINSFNNTSD-KKVIIITSVNKKIYTFF 348
            ++ V+L++LG+   +   E    +D+ L +++  +  N  + K V +++S      + F
Sbjct: 67  GDLDVLLSALGTTRAAAGAEGQYAVDHDLCVAVARAARNDKNCKSVALVSSAGAHTDSRF 126

Query: 349 SRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQL 408
             Y   K   E D+           V LRPG L+G                         
Sbjct: 127 F-YTRMKGDTERDIAAL---AFPHAVFLRPGILLGQ------------------------ 158

Query: 409 INYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRRPGTSLLGYTIPASKVAEVMVFK 468
                          R  K+TGF       + +  YR    SL+ Y +  S+VA+V    
Sbjct: 159 ---------------RTTKHTGFGNVLATKVGQWLYRSKCQSLIWYPVKGSEVAQV---- 199

Query: 469 GLCVGLENVHKDTKVEILESKTI 491
           GL + L+      +V+I+ S  I
Sbjct: 200 GLQLALDTEGTKPRVDIVASNEI 222

>TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.148
           YER004W
          Length = 226

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 68/135 (50%), Gaps = 13/135 (9%)

Query: 252 STIWPSLLPVLFDSNTKL--VPNKGLIENIDLTNEKLPLLSEVKVMLNSLGSRSHSPKNE 309
           +TI    L   +D+NTK+  + NK   E +   NE    L  V   L++    + S +N+
Sbjct: 30  TTITRRKLADTYDNNTKINQIINKNSEEWV---NEVPKGLDVVFTSLSTTKGAAGSLENQ 86

Query: 310 TFKNIDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDL-KTNLDN 368
            +K ID+ LNL L+        K V++I+S     ++ ++ YL  K  +E D+ K   D+
Sbjct: 87  -YK-IDHDLNLQLLEKAKENGCKTVVLISSSGANEHS-WAGYLKMKGEIERDVTKLGFDH 143

Query: 369 KINELVILRPGPLVG 383
            I    ILRPG L+G
Sbjct: 144 TI----ILRPGVLLG 154

>Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADR005W
          Length = 224

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 67/176 (38%), Gaps = 44/176 (25%)

Query: 292 VKVMLNSLGS-RSHSPKNETFKNIDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSR 350
           + V+ ++LG+ ++ +   E    ID+ LNL++  +      K +++++S+   I +    
Sbjct: 64  INVLFSALGTTKAAAGSIENQYKIDHGLNLAVAKAAKEKGCKTLVLVSSLGASIESRLP- 122

Query: 351 YLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQLIN 410
           Y   K  LE D+   L       ++LRPG L+G                           
Sbjct: 123 YFKMKGELERDV---LALGFERTILLRPGVLLGE-------------------------- 153

Query: 411 YKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRRPGTSLLGYTIPASKVAEVMV 466
                        R   YTGF  +    LA   YR     LLG  + A +V +V V
Sbjct: 154 -------------RDSNYTGFGRSLITKLASWIYRGKLQYLLGCPVYADEVGKVAV 196

>TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON}
           Anc_7.148 YER004W possible pseudogene; truncated at 5'
           end
          Length = 161

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 75/193 (38%), Gaps = 49/193 (25%)

Query: 301 SRSHSPKNETFKNIDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEE 360
           +R+ +   +    ID+ LN+ L            ++++S      + F+ YL  K  +E 
Sbjct: 7   TRAAAGSTQEQYRIDHNLNIHLAKKAKENGCSTFVLVSSSLANADSRFT-YLKMKGEIER 65

Query: 361 DLKTNLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKV 420
           DL+       + L+ILRPG L+G               ++ND                  
Sbjct: 66  DLEAI---GFDHLIILRPGKLLGE--------------RQND------------------ 90

Query: 421 ALLRRIKYTGFEPTCTNILAKTFYRRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKD 480
                  + GF  +    L  + YR     +L Y +  ++V +V V+    + L+ +   
Sbjct: 91  -------FKGFANSMFTALGNSIYRSRLQCVLQYPVFGNEVGQVGVY----LALKAIQDK 139

Query: 481 T--KVEILESKTI 491
           +  +V+I+ES  I
Sbjct: 140 SSPRVQIVESSEI 152

>KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.148
           YER004W
          Length = 225

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 59/144 (40%), Gaps = 32/144 (22%)

Query: 241 DLKLYHLSAVDSTIWPSLLPVLFDSNTKLVPNKGLIENIDLTNEKLPLLSEVKVMLNSLG 300
           D KL  +   DS+ W +++              GL ENID             V+  +L 
Sbjct: 42  DSKLNSIVDKDSSNWSNIIS-------------GLDENID-------------VLFTALA 75

Query: 301 S-RSHSPKNETFKNIDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLE 359
           + R+       +K ID+ LN+ L  +        ++I+T+      + F  Y   K  +E
Sbjct: 76  TTRAVGGTGYQYK-IDHDLNVELAKAAREKGCSTIVIVTAHGAHADSRFF-YTKMKGEIE 133

Query: 360 EDLKTNLDNKINELVILRPGPLVG 383
            D+    D   N  +ILRPG L+G
Sbjct: 134 RDIS---DLGFNRTIILRPGILLG 154

>KLTH0H16060g Chr8 (1383120..1384904) [1785 bp, 594 aa] {ON} weakly
           similar to uniprot|P03874 Saccharomyces cerevisiae
           YHL038C CBP2 Protein required for splicing of COB aI5
           intron Cytochrome B pre-mRNA processing protein
          Length = 594

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 450 SLLGYTIPASKV---AEVMVFKGLCVGLENVHKDTKVEILESKTID 492
           +LL Y+I  S++   AE+   K LCV  E+V + + VE +  K  D
Sbjct: 238 ALLAYSIIPSRLCSEAEICQLKSLCVDTESVRRPSVVEAISPKVAD 283

>YGL174W Chr7 (174545..175345) [801 bp, 266 aa] {ON}  BUD13Subunit
           of the RES complex, which is required for nuclear
           pre-mRNA retention and splicing; involved in bud-site
           selection; diploid mutants display a unipolar budding
           pattern instead of the wild-type bipolar pattern
          Length = 266

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 56/122 (45%), Gaps = 17/122 (13%)

Query: 107 IVGQKL----KEVELDGKTFYLQFDLLKQINDSGEPKESFLKSLTTKKMLEALTHGKGVK 162
           IV ++L    +E E  G   + +FD  K  N          K+L T ++  A+TH     
Sbjct: 39  IVKERLSTLQQEQEKSGVASFSKFDKQKSKN--------IWKNLETNELSHAITHPSASS 90

Query: 163 VTSNSKENQGISVRNEESSILKKDKSLLFSVINYNESEGNVILQPQEYSNV-ECYFNLQQ 221
           +T N  +N    +R +E  +   DKS     I Y +++G+ I   QE S + +  F+  +
Sbjct: 91  ITGNESKNDLKEIRAQEPLVTVADKSKTRKTI-YRDAQGHKI---QEDSKIDDSSFSRSK 146

Query: 222 YD 223
           Y+
Sbjct: 147 YE 148

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,409,032
Number of extensions: 2596484
Number of successful extensions: 11110
Number of sequences better than 10.0: 161
Number of HSP's gapped: 11625
Number of HSP's successfully gapped: 174
Length of query: 496
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 382
Effective length of database: 40,409,475
Effective search space: 15436419450
Effective search space used: 15436419450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)