Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D015402.284ON70770731870.0
Kwal_27.115422.284ON79131510571e-132
KLTH0G10318g2.284ON79031510471e-131
ADL217W2.284ON75031310211e-127
NDAI0G006402.284ON62130710091e-127
SAKL0E07722g2.284ON79131510201e-127
KLLA0E08405g2.284ON77732510031e-124
Kpol_1039.332.284ON7013259971e-124
TDEL0G021502.284ON6613079901e-124
TPHA0C033802.284ON6973119931e-124
Smik_9.842.284ON8083259991e-124
YIL095W (PRK1)2.284ON8103079991e-123
NDAI0B035602.284ON7563229931e-123
Suva_9.1042.284ON8053079921e-122
Ecym_33232.284ON7483309871e-122
CAGL0G02607g2.284ON6883229751e-121
Skud_9.782.284ON8093649781e-120
Kpol_1003.352.284ON7133079691e-120
NCAS0G038102.284ON6613039621e-120
TBLA0B059302.284ON7173319611e-119
NCAS0B062602.284ON7233309621e-119
KAFR0J013702.284ON7803209641e-119
Skud_14.3092.284ON6393209441e-117
KAFR0H033302.284ON3693319201e-117
YNL020C (ARK1)2.284ON6383209381e-116
TBLA0B069402.284ON14433159831e-116
ZYRO0A01848g2.284ON7043099371e-116
Smik_14.3112.284ON6373209271e-115
Suva_14.3272.284ON6323219221e-114
KNAG0H020202.284ON5923289161e-114
CAGL0J03432g2.284ON6223099051e-112
KNAG0A054302.284ON7883178751e-105
SAKL0D03234g3.273ON8583126584e-74
KLTH0C07260g3.273ON9013136534e-73
Kpol_1052.223.273ON11013046587e-73
TPHA0A040303.273ON10543176569e-73
KNAG0H012203.273ON9133246501e-72
CAGL0H10208g3.273ON10273166514e-72
Kwal_27.109453.273ON9353136465e-72
AGR027C3.273ON9612926476e-72
CAGL0K11990g3.273ON9913176477e-72
KAFR0C004303.273ON9493216458e-72
NCAS0A105903.273ON10953166508e-72
KAFR0A010403.273ON9123116431e-71
Ecym_26503.273ON8943146421e-71
NDAI0A057003.273ON11573306491e-71
Kpol_251.43.273ON8383136382e-71
KNAG0J008203.273ON10913266444e-71
ZYRO0E06864g3.273ON11153136359e-70
Suva_4.2973.273ON11073186331e-69
Skud_2.1793.273ON10903166313e-69
TBLA0E025903.273ON10613166303e-69
Smik_2.1913.273ON11083186313e-69
KLLA0F18612g3.273ON8143086204e-69
TDEL0D035203.273ON10492966276e-69
YBR059C (AKL1)3.273ON11083186288e-69
TBLA0I019303.273ON13613146273e-68
TPHA0M011203.273ON7883136133e-68
SAKL0A03344g6.262ON3641512415e-21
NDAI0F045201.24ON4892902446e-21
KNAG0F001701.24ON5432832421e-20
Smik_6.4416.262ON3643332343e-20
TDEL0A067506.262ON3723062343e-20
Suva_16.706.262ON3643392335e-20
TPHA0E038501.24ON4822822366e-20
YPL236C (ENV7)6.262ON3643222301e-19
Skud_16.426.262ON3643332255e-19
KAFR0G012001.24ON5072782261e-18
Kwal_56.242746.262ON3461532201e-18
ZYRO0F18062g1.24ON4712832214e-18
TBLA0A022406.262ON4131572194e-18
TDEL0C067801.24ON4682782152e-17
KLTH0H03080g6.262ON3463342077e-17
YDR523C (SPS1)1.24ON4902812101e-16
Kpol_2002.241.24ON4872812091e-16
NCAS0A002801.24ON5352822101e-16
NDAI0C026806.31ON7502802112e-16
SAKL0C00946g1.24ON5642812092e-16
ZYRO0E07876g6.262ON3691402033e-16
CAGL0H01639g1.24ON5212842045e-16
Kwal_55.215455.406ON8652522049e-16
TBLA0A074601.24ON5162732021e-15
Skud_4.7971.24ON4852752002e-15
YPL150W8.668ON9012902022e-15
Skud_16.1328.668ON9242922022e-15
Smik_4.8031.24ON4902811992e-15
Smik_13.1596.31ON7052792012e-15
ZYRO0C06776g5.591ON8902912012e-15
Suva_16.1608.668ON9182822012e-15
Kpol_1072.198.668ON8962072013e-15
TPHA0J004206.31ON7072752003e-15
KLLA0F11319g8.668ON8432812003e-15
Skud_13.1546.31ON7052791994e-15
KAFR0A050906.31ON6682351994e-15
SAKL0H06754g8.668ON8843131994e-15
YMR001C (CDC5)6.31ON7052791984e-15
Kpol_1023.266.31ON7392711984e-15
Suva_13.1636.31ON7052791985e-15
Suva_2.7031.24ON4852751956e-15
Smik_6.3478.668ON9172901986e-15
CAGL0J11638g6.31ON7462751976e-15
Kpol_1037.206.31ON7042761976e-15
TBLA0A047207.86ON12621621978e-15
Kwal_26.87518.668ON8482081969e-15
TDEL0H036407.86ON12371581979e-15
Kwal_33.131121.24ON5052781941e-14
KNAG0E008506.31ON7112761951e-14
NCAS0D021006.31ON7262781941e-14
CAGL0M02299g8.668ON8932011941e-14
KLTH0F16676g5.406ON8782481942e-14
NDAI0E023908.668ON8832001942e-14
Ecym_21536.262ON3633481892e-14
NCAS0C016708.668ON8962001932e-14
ZYRO0F07194g8.668ON9382031923e-14
KNAG0D048107.86ON14401501924e-14
KLTH0D11044g8.668ON8492141905e-14
TDEL0A061408.668ON8612411896e-14
TBLA0A035705.406ON9752041896e-14
TPHA0G016308.668ON8712001897e-14
TDEL0G043806.31ON7222751887e-14
ZYRO0D05500g7.86ON12621531898e-14
Suva_15.2975.406ON10742051898e-14
CAGL0F00913g7.86ON12061581889e-14
KAFR0D012207.86ON10551541871e-13
Kwal_26.73551.271ON14462681871e-13
KAFR0B028008.279ON10952121871e-13
ZYRO0C07480g6.31ON7742751861e-13
SAKL0G01848g5.406ON8852121861e-13
KLTH0F00946g1.24ON5122791842e-13
KNAG0J016708.668ON10092031852e-13
NDAI0F013406.262ON4061531822e-13
Kpol_1031.105.406ON11272441852e-13
KNAG0L005207.86ON3681411802e-13
TPHA0F024306.31ON7982761842e-13
ACR133C8.668ON8511981843e-13
Suva_15.4114.384ON8152821843e-13
NDAI0K021002.496ON9092321833e-13
ACL006W6.31ON7082781824e-13
Ecym_10301.24ON4402721804e-13
KAFR0K007007.86ON13811501834e-13
Smik_8.2954.384ON8242821815e-13
CAGL0K08514g2.479ON14892201825e-13
KAFR0F011506.262ON3661401776e-13
TBLA0D022308.141ON11543261816e-13
NDAI0H024707.86ON14111561816e-13
YHR205W (SCH9)4.384ON8242821806e-13
SAKL0E01584g6.31ON6952761807e-13
TPHA0H026307.86ON13671561809e-13
Skud_8.2724.384ON8352821799e-13
KLTH0D10714g8.654ON8722901799e-13
Kpol_1040.207.86ON12971391809e-13
Smik_10.1471.271ON14782861809e-13
ZYRO0B09196g1.336ON5162801771e-12
KAFR0G026906.31ON7132791781e-12
AFR724C1.24ON4402721761e-12
NCAS0B037408.279ON10492111791e-12
KLLA0F07623g7.86ON12291561791e-12
KAFR0C014403.92ON10952751791e-12
KLTH0C10912g6.31ON6972761781e-12
Kpol_1000.144.384ON6652881771e-12
YJL095W (BCK1)1.271ON14782841781e-12
KLLA0C06138g6.31ON7082871771e-12
Smik_8.1805.406ON10732051781e-12
ZYRO0D06776g8.279ON12042261781e-12
Kpol_1072.298.654ON8933081781e-12
TBLA0B038608.668ON9881991772e-12
KAFR0D049505.406ON10082591772e-12
CAGL0L11550g5.406ON10722081772e-12
Skud_10.1191.271ON14812841772e-12
CAGL0H06259g7.86ON13361501772e-12
Ecym_30356.31ON7402781762e-12
KLLA0C12485g3.92ON9252751762e-12
KNAG0F029006.31ON6492631752e-12
CAGL0H00979g6.262ON3991511733e-12
Ecym_35863.92ON10772601763e-12
Kpol_1065.36.222ON3762761723e-12
KNAG0D002106.371ON8332751753e-12
TBLA0E022907.86ON13001561754e-12
Skud_8.1635.406ON10762051754e-12
YHR102W (KIC1)5.406ON10802051744e-12
Kwal_47.183075.591ON6212781734e-12
TBLA0B004906.31ON7872751735e-12
TBLA0H016605.406ON9962051745e-12
KAFR0B069804.384ON7752631735e-12
SAKL0D06534g1.336ON5222831725e-12
TBLA0B082503.92ON13472201745e-12
Kwal_56.224766.31ON6972761726e-12
Suva_6.1691.271ON14842861736e-12
Ecym_24058.668ON8552011726e-12
NCAS0F015807.86ON13821581737e-12
Suva_4.5351.336ON5272891708e-12
CAGL0M11396g8.279ON11922261711e-11
KLTH0D03454g1.271ON14332841711e-11
KNAG0M001904.384ON7922641701e-11
NCAS0H019405.406ON10152061711e-11
SAKL0H07084g8.654ON9192981701e-11
Ecym_83398.654ON9202991701e-11
CAGL0F09075g4.384ON7462631701e-11
KLLA0E21693g5.406ON10162411701e-11
KAFR0H025108.668ON8792031701e-11
NCAS0B050908.279ON12102151701e-11
YDR122W (KIN1)8.279ON10642221701e-11
ACL104C5.406ON9472111701e-11
KNAG0B043205.406ON10272121701e-11
SAKL0G06402g5.591ON7842861691e-11
Kpol_1044.37.86ON9321551692e-11
Kwal_26.87098.654ON8292981692e-11
KAFR0A037308.654ON7882511692e-11
Skud_4.3838.279ON10652221692e-11
KNAG0D008306.262ON3871471662e-11
KLTH0D17204g4.384ON7552831682e-11
TDEL0F040608.279ON11262151692e-11
CAGL0L03520g1.271ON14473001692e-11
TDEL0A045805.591ON6942891682e-11
TPHA0I009201.271ON14341651692e-11
Kwal_47.167614.384ON7442831672e-11
TBLA0C029401.271ON16432801682e-11
TPHA0C001604.384ON7542831672e-11
Kwal_56.226933.92ON9841481682e-11
ADL389W4.384ON7112641672e-11
TBLA0B039708.654ON12082651682e-11
KLLA0C03828g3.162ON7932901672e-11
KLLA0B03586g4.384ON7342841672e-11
CAGL0E05720g6.222ON3582671642e-11
Ecym_74734.384ON7392841673e-11
NDAI0C017005.406ON10202131673e-11
Kpol_265.14.384ON7572631673e-11
KNAG0G012408.140ON9092671673e-11
Suva_1.507.86ON13601501683e-11
Suva_15.653.92ON10802051673e-11
Smik_4.7673.92ON7581531673e-11
ZYRO0G00506g4.384ON7882831673e-11
NCAS0A064404.384ON7492841663e-11
KLTH0C09548g3.92ON9932411673e-11
TDEL0D053203.92ON10571431673e-11
Skud_15.1127.86ON11011571673e-11
AFR335C3.92ON10332561673e-11
TPHA0E036401.52ON11371591673e-11
NCAS0A094701.271ON15152841673e-11
YPL203W (TPK2)6.214ON3802681633e-11
Smik_1.793.177ON9742931664e-11
SAKL0B09856g7.86ON12741531664e-11
SAKL0D12628g1.507ON8181461654e-11
KLLA0F14190g1.271ON13382841664e-11
Skud_16.766.214ON3822681624e-11
Smik_15.1227.86ON11011621664e-11
Ecym_26407.86ON13251501664e-11
Skud_1.447.86ON13561501665e-11
Smik_6.4086.214ON3812681625e-11
Suva_7.838.140ON5692551645e-11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D01540
         (707 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...  1232   0.0  
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   411   e-132
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   407   e-131
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   397   e-127
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    393   e-127
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   397   e-127
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   390   e-124
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   388   e-124
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   385   e-124
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   387   e-124
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   389   e-124
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   389   e-123
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   387   e-123
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   386   e-122
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   384   e-122
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   380   e-121
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   381   e-120
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   377   e-120
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   375   e-120
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   374   e-119
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   375   e-119
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   375   e-119
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   368   e-117
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   358   e-117
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   365   e-116
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   383   e-116
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   365   e-116
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   361   e-115
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   359   e-114
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   357   e-114
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   353   e-112
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   341   e-105
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   258   4e-74
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   256   4e-73
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   258   7e-73
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   257   9e-73
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   254   1e-72
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   255   4e-72
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   253   5e-72
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   253   6e-72
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   253   7e-72
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   253   8e-72
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   254   8e-72
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   252   1e-71
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   251   1e-71
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   254   1e-71
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   250   2e-71
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   252   4e-71
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   249   9e-70
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   248   1e-69
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   247   3e-69
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   247   3e-69
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   247   3e-69
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   243   4e-69
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   246   6e-69
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   246   8e-69
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   246   3e-68
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   240   3e-68
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    97   5e-21
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    99   6e-21
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    98   1e-20
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    95   3e-20
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    95   3e-20
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    94   5e-20
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    96   6e-20
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    93   1e-19
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    91   5e-19
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    92   1e-18
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    89   1e-18
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    90   4e-18
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    89   4e-18
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    87   2e-17
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    84   7e-17
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    86   1e-16
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    85   1e-16
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        86   1e-16
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    86   2e-16
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    85   2e-16
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    83   3e-16
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    83   5e-16
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    83   9e-16
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    82   1e-15
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    82   2e-15
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    82   2e-15
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    82   2e-15
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    81   2e-15
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    82   2e-15
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    82   2e-15
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    82   2e-15
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    82   3e-15
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    82   3e-15
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    82   3e-15
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    81   4e-15
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             81   4e-15
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    81   4e-15
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    81   4e-15
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    81   4e-15
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    81   5e-15
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    80   6e-15
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    81   6e-15
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    80   6e-15
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    80   6e-15
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    80   8e-15
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    80   9e-15
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    80   9e-15
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    79   1e-14
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    80   1e-14
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      79   1e-14
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    79   1e-14
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    79   2e-14
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    79   2e-14
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    77   2e-14
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    79   2e-14
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    79   3e-14
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    79   4e-14
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    78   5e-14
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    77   6e-14
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    77   6e-14
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    77   7e-14
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    77   7e-14
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    77   8e-14
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    77   8e-14
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    77   9e-14
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    77   1e-13
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    77   1e-13
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    77   1e-13
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    76   1e-13
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    76   1e-13
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    75   2e-13
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    76   2e-13
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    75   2e-13
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    76   2e-13
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    74   2e-13
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    75   2e-13
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    75   3e-13
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    75   3e-13
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    75   3e-13
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    75   4e-13
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    74   4e-13
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    75   4e-13
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    74   5e-13
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    75   5e-13
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    73   6e-13
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    74   6e-13
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    74   6e-13
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    74   6e-13
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    74   7e-13
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    74   9e-13
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    74   9e-13
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    74   9e-13
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    74   9e-13
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    74   9e-13
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    73   1e-12
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    73   1e-12
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    72   1e-12
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    74   1e-12
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    74   1e-12
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    74   1e-12
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    73   1e-12
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    73   1e-12
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    73   1e-12
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    73   1e-12
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    73   1e-12
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    73   1e-12
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    73   1e-12
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    73   2e-12
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    73   2e-12
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    73   2e-12
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    73   2e-12
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    73   2e-12
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    72   2e-12
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    72   2e-12
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               72   2e-12
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    71   3e-12
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    72   3e-12
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    71   3e-12
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    72   3e-12
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    72   4e-12
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    72   4e-12
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    72   4e-12
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    71   4e-12
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    71   5e-12
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    72   5e-12
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    71   5e-12
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    71   5e-12
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    72   5e-12
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    71   6e-12
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    71   6e-12
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    71   6e-12
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    71   7e-12
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    70   8e-12
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    70   1e-11
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    70   1e-11
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    70   1e-11
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    70   1e-11
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    70   1e-11
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    70   1e-11
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    70   1e-11
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    70   1e-11
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    70   1e-11
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              70   1e-11
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    70   1e-11
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    70   1e-11
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    70   1e-11
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    70   1e-11
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    70   2e-11
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    70   2e-11
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    70   2e-11
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    70   2e-11
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    69   2e-11
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    69   2e-11
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    70   2e-11
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    70   2e-11
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    69   2e-11
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    70   2e-11
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    69   2e-11
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    69   2e-11
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    69   2e-11
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    69   2e-11
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    69   2e-11
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    69   2e-11
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    69   2e-11
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    69   2e-11
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    68   2e-11
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    69   3e-11
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    69   3e-11
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    69   3e-11
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    69   3e-11
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    69   3e-11
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    69   3e-11
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    69   3e-11
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    69   3e-11
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    69   3e-11
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    69   3e-11
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    69   3e-11
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    69   3e-11
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    69   3e-11
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    69   3e-11
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    69   3e-11
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    67   3e-11
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    69   4e-11
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    69   4e-11
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    68   4e-11
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    69   4e-11
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    67   4e-11
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    69   4e-11
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    69   4e-11
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    69   5e-11
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    67   5e-11
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    68   5e-11
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    67   5e-11
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    68   5e-11
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    68   5e-11
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    68   5e-11
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    68   5e-11
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     67   6e-11
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    68   6e-11
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    68   6e-11
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    68   6e-11
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    68   6e-11
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    68   6e-11
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    68   6e-11
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    68   6e-11
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    68   7e-11
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               67   7e-11
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    68   7e-11
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    68   7e-11
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    68   7e-11
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    67   7e-11
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       68   7e-11
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    67   8e-11
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    67   8e-11
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    67   8e-11
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    67   9e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     67   9e-11
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    67   9e-11
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    67   9e-11
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    66   9e-11
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    67   9e-11
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    67   9e-11
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    67   9e-11
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    66   1e-10
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    67   1e-10
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    67   1e-10
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    67   1e-10
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    67   1e-10
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    67   1e-10
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    67   1e-10
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    67   1e-10
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    67   1e-10
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    67   2e-10
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    67   2e-10
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    65   2e-10
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    66   2e-10
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    67   2e-10
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    66   2e-10
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    67   2e-10
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    66   2e-10
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    65   2e-10
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    66   2e-10
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    66   2e-10
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    66   2e-10
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    65   2e-10
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    66   2e-10
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    66   2e-10
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               65   2e-10
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    66   2e-10
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    66   2e-10
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    66   2e-10
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    66   2e-10
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    66   2e-10
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    65   3e-10
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    66   3e-10
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    66   3e-10
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    66   3e-10
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    65   3e-10
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              66   3e-10
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    65   3e-10
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    66   3e-10
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    65   3e-10
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    65   3e-10
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    65   3e-10
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    64   3e-10
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    64   3e-10
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    65   4e-10
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    65   4e-10
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    64   4e-10
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    65   4e-10
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    65   4e-10
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    64   4e-10
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    65   4e-10
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    65   5e-10
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    64   5e-10
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    64   5e-10
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    65   5e-10
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    64   5e-10
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    65   5e-10
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    65   5e-10
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     65   5e-10
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    65   5e-10
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    65   5e-10
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    64   5e-10
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    65   6e-10
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    64   6e-10
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    64   6e-10
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    64   6e-10
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    65   6e-10
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    65   6e-10
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    65   6e-10
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    65   7e-10
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    64   7e-10
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    63   7e-10
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    64   7e-10
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    65   7e-10
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    64   7e-10
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    64   7e-10
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    64   8e-10
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    64   8e-10
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    63   8e-10
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    64   8e-10
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    64   8e-10
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    63   8e-10
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               64   9e-10
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     63   9e-10
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    64   9e-10
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    64   9e-10
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    64   9e-10
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    64   1e-09
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    64   1e-09
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    64   1e-09
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    63   1e-09
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    64   1e-09
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    63   1e-09
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    63   1e-09
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    64   1e-09
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    64   1e-09
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    64   1e-09
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    63   1e-09
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    64   1e-09
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    64   1e-09
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    62   1e-09
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     62   1e-09
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    64   1e-09
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    62   1e-09
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    62   1e-09
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    63   1e-09
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    62   1e-09
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    63   2e-09
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    63   2e-09
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    63   2e-09
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    63   2e-09
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    63   2e-09
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    63   2e-09
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    63   2e-09
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    62   2e-09
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    63   2e-09
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               63   2e-09
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    62   2e-09
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    63   2e-09
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    63   2e-09
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    63   2e-09
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    63   2e-09
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    63   2e-09
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    63   2e-09
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    63   2e-09
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    62   2e-09
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     63   2e-09
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    63   2e-09
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    63   2e-09
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    62   2e-09
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    63   2e-09
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    63   2e-09
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    62   3e-09
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    63   3e-09
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    63   3e-09
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    63   3e-09
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    63   3e-09
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    62   3e-09
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    62   3e-09
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    62   3e-09
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    61   3e-09
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    62   3e-09
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    62   3e-09
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    62   3e-09
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    62   3e-09
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    62   3e-09
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    62   3e-09
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    62   4e-09
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    62   4e-09
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    62   4e-09
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    62   4e-09
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    61   4e-09
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    62   4e-09
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    62   4e-09
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     62   4e-09
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    62   4e-09
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    61   5e-09
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    62   5e-09
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    62   5e-09
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    62   5e-09
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     62   5e-09
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              61   6e-09
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    62   6e-09
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    62   6e-09
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    61   6e-09
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    60   6e-09
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    60   6e-09
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    61   6e-09
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    60   6e-09
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    60   6e-09
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    61   6e-09
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    60   7e-09
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    61   7e-09
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    60   7e-09
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    61   7e-09
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    61   7e-09
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    61   7e-09
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    61   7e-09
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    60   7e-09
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    61   7e-09
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    61   8e-09
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    61   8e-09
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    60   8e-09
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    61   8e-09
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    60   8e-09
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    61   9e-09
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    61   9e-09
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    61   9e-09
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    61   9e-09
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    61   9e-09
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    61   1e-08
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    60   1e-08
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    60   1e-08
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    60   1e-08
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    61   1e-08
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    61   1e-08
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    60   1e-08
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    60   1e-08
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    60   1e-08
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    60   1e-08
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    60   1e-08
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    60   1e-08
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    60   1e-08
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    60   1e-08
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    60   1e-08
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    60   1e-08
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    60   1e-08
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    60   1e-08
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    60   1e-08
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    60   1e-08
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    60   1e-08
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    60   2e-08
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    60   2e-08
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    59   2e-08
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    60   2e-08
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    59   2e-08
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    60   2e-08
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               60   2e-08
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    60   2e-08
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    60   2e-08
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    60   2e-08
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    60   2e-08
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    60   2e-08
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    60   2e-08
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    60   2e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    60   2e-08
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    59   2e-08
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    59   2e-08
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    60   2e-08
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    59   2e-08
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    60   2e-08
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     59   2e-08
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    59   2e-08
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    60   2e-08
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    60   2e-08
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    60   2e-08
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    59   2e-08
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    59   2e-08
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    59   2e-08
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    59   2e-08
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    59   3e-08
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    59   3e-08
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    59   3e-08
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    59   3e-08
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    59   3e-08
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    59   3e-08
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       59   3e-08
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    59   3e-08
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    59   3e-08
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    59   3e-08
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    59   3e-08
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    59   3e-08
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    59   3e-08
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    59   3e-08
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    59   3e-08
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    59   3e-08
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    59   3e-08
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    59   3e-08
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    59   3e-08
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    58   3e-08
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    59   3e-08
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    59   3e-08
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    58   4e-08
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    59   4e-08
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    58   4e-08
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    59   4e-08
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     59   4e-08
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    59   4e-08
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    59   4e-08
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    59   4e-08
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    59   4e-08
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    58   4e-08
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    59   4e-08
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    59   4e-08
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    59   4e-08
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    59   4e-08
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    59   4e-08
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    58   4e-08
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    58   4e-08
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    58   4e-08
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    58   4e-08
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    58   4e-08
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    58   4e-08
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    58   4e-08
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    58   4e-08
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    58   5e-08
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    58   5e-08
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    59   5e-08
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    57   5e-08
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    59   5e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    59   5e-08
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    59   5e-08
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    58   5e-08
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              58   5e-08
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    57   5e-08
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    58   5e-08
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    58   5e-08
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    58   5e-08
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    58   5e-08
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    59   5e-08
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    58   6e-08
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    58   6e-08
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    58   6e-08
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    58   6e-08
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    58   6e-08
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    57   6e-08
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    58   6e-08
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    58   6e-08
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    58   6e-08
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    58   6e-08
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    58   6e-08
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    58   6e-08
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    57   7e-08
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    58   7e-08
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    57   7e-08
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    57   7e-08
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    58   7e-08
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    57   7e-08
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    58   7e-08
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    58   7e-08
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    57   7e-08
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    58   7e-08
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    58   8e-08
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    57   8e-08
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     57   8e-08
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    57   8e-08
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    58   8e-08
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    58   8e-08
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    58   8e-08
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    58   9e-08
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    58   9e-08
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               57   9e-08
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    57   9e-08
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    57   9e-08
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    57   9e-08
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    57   1e-07
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    57   1e-07
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    57   1e-07
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    57   1e-07
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    57   1e-07
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    57   1e-07
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    57   1e-07
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    57   1e-07
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    57   1e-07
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    57   1e-07
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    57   1e-07
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    57   1e-07
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    57   1e-07
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    57   1e-07
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     57   1e-07
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    57   1e-07
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    57   1e-07
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    57   1e-07
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    57   1e-07
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    56   1e-07
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    57   1e-07
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    57   1e-07
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    57   1e-07
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     56   1e-07
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    57   1e-07
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    57   2e-07
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    57   2e-07
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    57   2e-07
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    57   2e-07
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    57   2e-07
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    57   2e-07
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    57   2e-07
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    56   2e-07
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    57   2e-07
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    56   2e-07
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    56   2e-07
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    55   2e-07
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    56   2e-07
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    56   2e-07
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    56   2e-07
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    56   2e-07
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    56   2e-07
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    57   2e-07
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    57   2e-07
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    55   2e-07
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    56   2e-07
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    56   2e-07
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    56   2e-07
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    56   2e-07
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    56   2e-07
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    56   2e-07
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    56   2e-07
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    56   2e-07
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    56   3e-07
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    56   3e-07
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    55   3e-07
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    55   3e-07
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    56   3e-07
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    56   3e-07
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    55   3e-07
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    55   3e-07
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    55   3e-07
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    56   3e-07
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    54   3e-07
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    55   3e-07
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    55   3e-07
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    55   3e-07
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    55   3e-07
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    55   3e-07
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    55   3e-07
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    55   3e-07
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    55   3e-07
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    56   3e-07
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    55   3e-07
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    55   3e-07
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    55   3e-07
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    55   4e-07
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    55   4e-07
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    54   4e-07
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    55   4e-07
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    55   4e-07
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    56   4e-07
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    55   4e-07
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    55   4e-07
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    55   4e-07
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     55   4e-07
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    55   4e-07
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    55   4e-07
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    55   4e-07
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    55   4e-07
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    55   4e-07
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    55   4e-07
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    55   4e-07
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    55   4e-07
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    55   4e-07
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    55   4e-07
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    55   4e-07
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    55   4e-07
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    55   4e-07
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    55   5e-07
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    55   5e-07
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    55   5e-07
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    55   5e-07
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    54   5e-07
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    55   5e-07
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    55   5e-07
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    55   5e-07
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    55   5e-07
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    55   5e-07
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    55   5e-07
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    55   5e-07
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    55   5e-07
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    55   6e-07
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    55   6e-07
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    55   6e-07
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    55   6e-07
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    55   6e-07
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    55   6e-07
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    55   6e-07
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    55   6e-07
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    55   6e-07
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    55   6e-07
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    54   6e-07
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    55   6e-07
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    55   6e-07
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    55   6e-07
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    55   6e-07
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              54   6e-07
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    55   6e-07
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    55   6e-07
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    55   7e-07
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    55   7e-07
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    54   7e-07
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    54   7e-07
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    55   7e-07
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    54   7e-07
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    55   7e-07
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    54   7e-07
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    54   7e-07
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    54   7e-07
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    55   7e-07
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    54   7e-07
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    54   7e-07
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    55   7e-07
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    54   7e-07
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    54   8e-07
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    54   8e-07
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    54   8e-07
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    55   8e-07
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    54   8e-07
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    55   8e-07
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    54   8e-07
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    54   8e-07
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    55   8e-07
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    54   8e-07
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    54   8e-07
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    54   8e-07
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              55   8e-07
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    55   9e-07
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    54   9e-07
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    54   9e-07
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    54   9e-07
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    54   9e-07
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    54   9e-07
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    54   9e-07
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    54   9e-07
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    54   9e-07
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    54   9e-07
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    54   9e-07
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    54   9e-07
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    54   1e-06
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    54   1e-06
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    54   1e-06
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    54   1e-06
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    54   1e-06
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    54   1e-06
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    54   1e-06
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    54   1e-06
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    54   1e-06
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    54   1e-06
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    54   1e-06
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    54   1e-06
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    54   1e-06
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    54   1e-06
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    53   1e-06
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    54   1e-06
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    54   1e-06
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    54   1e-06
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    54   1e-06
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    54   1e-06
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    54   1e-06
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    54   1e-06
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    54   1e-06
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    54   1e-06
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    53   1e-06
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    54   1e-06
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    54   1e-06
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    54   1e-06
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    54   1e-06
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    54   1e-06
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    54   1e-06
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    53   1e-06
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    54   1e-06
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    54   1e-06
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    54   1e-06
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    54   1e-06
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    54   1e-06
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    54   1e-06
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    53   2e-06
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    54   2e-06
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    53   2e-06
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    53   2e-06
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    53   2e-06
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    53   2e-06
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    54   2e-06
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    53   2e-06
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    53   2e-06
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    53   2e-06
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    53   2e-06
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    53   2e-06
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    53   2e-06
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    53   2e-06
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    53   2e-06
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    53   2e-06
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    53   2e-06
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     53   2e-06
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    53   2e-06
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    53   2e-06
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    53   2e-06
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               53   2e-06
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    53   2e-06
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    52   2e-06
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    53   2e-06
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    53   2e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    53   2e-06
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    53   2e-06
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    53   2e-06
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    52   2e-06
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    53   2e-06
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    53   2e-06
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    53   2e-06
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    53   2e-06
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    53   2e-06
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    53   2e-06
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    53   3e-06
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    52   3e-06
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    52   3e-06
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    52   3e-06
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    53   3e-06
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    52   3e-06
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    52   3e-06
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    51   3e-06
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    52   3e-06
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    52   3e-06
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    52   3e-06
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    53   3e-06
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    52   3e-06
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    52   3e-06
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    52   3e-06
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    52   3e-06
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    52   3e-06
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    53   3e-06
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    52   3e-06
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    52   3e-06
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    52   3e-06
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     52   3e-06
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    52   3e-06
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      53   3e-06
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    52   3e-06
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    52   3e-06
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    52   4e-06
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    52   4e-06
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    52   4e-06
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    52   4e-06
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    52   4e-06
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    52   4e-06
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     52   4e-06
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    52   4e-06
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    51   4e-06
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    52   4e-06
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    52   4e-06
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    51   4e-06
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    50   4e-06
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    51   4e-06
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    52   4e-06
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     52   4e-06
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    52   4e-06
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    52   4e-06
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    51   4e-06
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    52   4e-06
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    52   4e-06
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    52   4e-06
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    52   4e-06
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    52   5e-06
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    52   5e-06
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     52   5e-06
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    51   5e-06
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    52   5e-06
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    51   5e-06
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    52   5e-06
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    52   5e-06
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    52   5e-06
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    51   5e-06
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    52   5e-06
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    52   5e-06
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    52   5e-06
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    51   5e-06
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    52   5e-06
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    52   5e-06
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    52   5e-06
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    52   5e-06
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    52   6e-06
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    52   6e-06
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    52   6e-06
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    52   6e-06
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    52   6e-06
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    52   6e-06
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    50   6e-06
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    50   6e-06
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    50   6e-06
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    52   6e-06
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    50   6e-06
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    52   7e-06
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    52   7e-06
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    52   7e-06
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    51   7e-06
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    50   7e-06
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    50   7e-06
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    51   7e-06
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    51   7e-06
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    52   7e-06
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    50   7e-06
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    51   7e-06
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    52   7e-06
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    51   7e-06
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    51   8e-06
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    52   8e-06
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    50   8e-06
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    52   8e-06
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              51   8e-06
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    51   8e-06
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    51   8e-06
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    51   8e-06
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    51   8e-06
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    50   9e-06
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    51   9e-06
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    51   9e-06
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    51   9e-06
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    50   9e-06
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    50   9e-06
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    50   9e-06
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    51   1e-05
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    50   1e-05
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    51   1e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    50   1e-05
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    51   1e-05
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    51   1e-05
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    50   1e-05
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    51   1e-05
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    50   1e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    50   1e-05
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              51   1e-05
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    50   1e-05
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    50   1e-05
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    50   1e-05
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    50   1e-05
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    50   1e-05
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    50   1e-05
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    50   1e-05
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    50   1e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    50   1e-05
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    50   1e-05
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    50   1e-05
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    50   1e-05
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    50   1e-05
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    50   1e-05
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    50   1e-05
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    50   1e-05
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    50   1e-05
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    50   2e-05
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    50   2e-05
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    49   2e-05
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    50   2e-05
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    50   2e-05
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    50   2e-05
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    50   2e-05
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    50   2e-05
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    50   2e-05
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    50   2e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    50   2e-05
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    50   2e-05
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    50   2e-05
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    50   2e-05
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    50   2e-05
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    50   2e-05
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    50   2e-05
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    50   2e-05
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    50   2e-05
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    50   2e-05
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    49   2e-05
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    50   2e-05
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    49   2e-05
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    50   2e-05
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    50   2e-05
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    50   2e-05
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    49   2e-05
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    50   2e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    49   2e-05
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    50   2e-05
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    50   2e-05
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    49   2e-05
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    50   2e-05
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    49   2e-05
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              50   2e-05
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    49   2e-05
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    50   2e-05
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    49   2e-05
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    49   2e-05
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    49   2e-05
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    49   2e-05
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    49   2e-05
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    49   3e-05
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    49   3e-05
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    49   3e-05
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    49   3e-05
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    49   3e-05
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    49   3e-05
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    49   3e-05
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    49   3e-05
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               49   3e-05
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    50   3e-05
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               49   3e-05
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    49   3e-05
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    49   3e-05
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    49   3e-05
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    50   3e-05
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    50   3e-05
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    49   3e-05
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    49   3e-05
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    49   3e-05
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    49   3e-05
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    49   3e-05
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    49   3e-05
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    49   3e-05
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    49   3e-05
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              48   3e-05
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    49   3e-05
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    49   3e-05
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    49   3e-05
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    49   3e-05
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    49   3e-05
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    49   4e-05
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    49   4e-05
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    49   4e-05
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    49   4e-05
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    49   4e-05
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    49   4e-05
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    49   4e-05
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     49   4e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    49   4e-05
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    49   4e-05
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    49   4e-05
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    49   4e-05
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    48   4e-05
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               49   4e-05
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    48   4e-05
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    49   4e-05
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              49   4e-05
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    48   4e-05
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    49   4e-05
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    49   4e-05
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     49   4e-05
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    49   4e-05
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    49   4e-05
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    49   4e-05
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    49   5e-05
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    48   5e-05
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    49   5e-05
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    48   5e-05
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    49   5e-05
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    49   5e-05
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    49   5e-05
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    48   5e-05
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    48   5e-05
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    49   5e-05
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    49   5e-05
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    49   5e-05
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    49   5e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    48   5e-05
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    49   5e-05
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    48   5e-05
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    48   5e-05
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    48   5e-05
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    49   5e-05
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    49   5e-05
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    48   5e-05
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    49   5e-05
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    49   5e-05
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    48   6e-05
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    48   6e-05
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    48   6e-05
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    48   6e-05
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    49   6e-05
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     48   6e-05
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    48   6e-05
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    48   6e-05
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    47   6e-05
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    48   6e-05
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    48   6e-05
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    49   6e-05
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    48   6e-05
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    48   6e-05
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    48   6e-05
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             48   6e-05
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    48   6e-05
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    48   6e-05
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    48   7e-05
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    48   7e-05
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    48   7e-05
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    47   7e-05
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    48   7e-05
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    48   7e-05
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    48   7e-05
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               48   7e-05
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    48   7e-05
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    47   7e-05
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    48   8e-05
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    47   8e-05
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    48   8e-05
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    48   8e-05
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    47   8e-05
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    48   8e-05
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    48   9e-05
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    48   9e-05
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    47   9e-05
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    48   9e-05
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    47   9e-05
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    47   9e-05
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    48   9e-05
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    47   1e-04
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    47   1e-04
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    48   1e-04
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    47   1e-04
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    47   1e-04
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    47   1e-04
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    47   1e-04
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    48   1e-04
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    48   1e-04
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    47   1e-04
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    47   1e-04
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    47   1e-04
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    47   1e-04
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    47   1e-04
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    47   1e-04
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    47   1e-04
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    47   1e-04
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    47   1e-04
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    47   1e-04
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    47   1e-04
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    47   1e-04
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    47   1e-04
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    47   1e-04
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    47   1e-04
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    47   1e-04
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    47   1e-04
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    47   1e-04
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    47   1e-04
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    47   1e-04
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    47   1e-04
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    46   1e-04
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    46   1e-04
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    47   1e-04
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    47   1e-04
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    47   1e-04
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    47   1e-04
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    47   1e-04
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    47   1e-04
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    47   2e-04
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    47   2e-04
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    47   2e-04
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    47   2e-04
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    47   2e-04
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    47   2e-04
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    47   2e-04
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     47   2e-04
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    47   2e-04
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    47   2e-04
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    47   2e-04
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    47   2e-04
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    47   2e-04
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    47   2e-04
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    47   2e-04
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    47   2e-04
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    47   2e-04
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    47   2e-04
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    46   2e-04
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    47   2e-04
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    47   2e-04
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    47   2e-04
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    46   2e-04
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    47   2e-04
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    47   2e-04
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    47   2e-04
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    47   2e-04
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    46   2e-04
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    46   2e-04
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    47   2e-04
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    47   2e-04
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    46   2e-04
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    46   2e-04
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    46   2e-04
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    46   2e-04
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    47   2e-04
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    46   2e-04
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    46   2e-04
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    47   2e-04
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    47   2e-04
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    46   2e-04
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    47   2e-04
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    47   2e-04
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    46   2e-04
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    46   2e-04
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     46   2e-04
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    46   3e-04
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    46   3e-04
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    46   3e-04
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               46   3e-04
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    46   3e-04
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    46   3e-04
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    47   3e-04
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    46   3e-04
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    46   3e-04
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    46   3e-04
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    46   3e-04
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    46   3e-04
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    46   3e-04
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    46   3e-04
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    46   3e-04
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    46   3e-04
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    46   3e-04
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    46   3e-04
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    46   3e-04
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    46   3e-04
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    46   3e-04
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    46   3e-04
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    46   3e-04
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    46   3e-04
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    46   3e-04
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    46   3e-04
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    45   3e-04
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    46   3e-04
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    46   3e-04
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    46   3e-04
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    46   3e-04
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    46   3e-04
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    46   3e-04
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    46   3e-04
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    46   4e-04
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    46   4e-04
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    45   4e-04
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    46   4e-04
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    46   4e-04
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    46   4e-04
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    45   4e-04
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    45   4e-04
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    45   4e-04
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    45   4e-04
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    46   4e-04
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    45   4e-04
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    45   4e-04
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    45   4e-04
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    45   4e-04
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    45   4e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    46   4e-04
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    45   4e-04
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    45   4e-04
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    45   4e-04
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    45   5e-04
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    45   5e-04
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    45   5e-04
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     45   5e-04
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    45   5e-04
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    45   5e-04
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    45   5e-04
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    45   5e-04
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    45   5e-04
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    45   5e-04
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    45   5e-04
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    45   5e-04
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    45   5e-04
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    45   5e-04
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    45   5e-04
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    45   5e-04
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    45   5e-04
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    45   5e-04
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    45   6e-04
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    45   6e-04
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    45   6e-04
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    45   6e-04
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    45   6e-04
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    45   6e-04
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    45   6e-04
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    45   6e-04
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    45   6e-04
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    45   6e-04
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    45   6e-04
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    45   7e-04
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    45   7e-04
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    45   7e-04
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    45   7e-04
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    45   7e-04
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    45   7e-04
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    45   7e-04
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    45   7e-04
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       45   7e-04
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    45   7e-04
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    45   7e-04
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    45   7e-04
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    45   8e-04
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               45   8e-04
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    45   8e-04
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    45   8e-04
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    44   9e-04
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    44   9e-04
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    44   9e-04
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    44   9e-04
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    45   0.001
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    44   0.001
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    44   0.001
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    44   0.001
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    44   0.001
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    44   0.001
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    44   0.001
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    44   0.001
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    44   0.001
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    44   0.001
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    44   0.001
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     44   0.001
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    44   0.001
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    44   0.001
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    44   0.001
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    44   0.001
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    44   0.001
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    44   0.001
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    44   0.001
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    44   0.001
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    44   0.001
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    44   0.001
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    44   0.001
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    44   0.001
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    44   0.001
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    44   0.001
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    44   0.001
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    44   0.001
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    44   0.001
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    44   0.001
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    44   0.001
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    44   0.001
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    44   0.001
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    44   0.001
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    44   0.001
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    44   0.001
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    44   0.001
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    44   0.001
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    44   0.001
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    44   0.001
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    44   0.001
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    44   0.001
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    44   0.001
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    44   0.001
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    44   0.002
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    43   0.002
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    44   0.002
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    44   0.002
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    44   0.002
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    44   0.002
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    44   0.002
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    43   0.002
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    44   0.002
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    44   0.002
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    43   0.002
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    44   0.002
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    43   0.002
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    43   0.002
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    43   0.002
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    43   0.002
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    43   0.002
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    44   0.002
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    43   0.002
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    43   0.002
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    44   0.002
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    44   0.002
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    44   0.002
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    43   0.002
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    43   0.002
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    43   0.002
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    43   0.002
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    43   0.002
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    43   0.002
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    43   0.002
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    43   0.002
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    43   0.002
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    43   0.002
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    43   0.002
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    43   0.002
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    43   0.002
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    43   0.002
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    43   0.003
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    43   0.003
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    43   0.003
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    43   0.003
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    43   0.003
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    43   0.003
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    43   0.003
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    42   0.003
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    43   0.003
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    43   0.003
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    42   0.003
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    43   0.003
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    43   0.003
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    43   0.003
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    42   0.003
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    43   0.003
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    43   0.003
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    43   0.003
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    43   0.003
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    42   0.003
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     43   0.003
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    43   0.003
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    43   0.003
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    42   0.004
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      43   0.004
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    42   0.004
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    42   0.004
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    42   0.004
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    42   0.004
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    42   0.004
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    42   0.004
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    42   0.004
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    42   0.004
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    42   0.004
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    42   0.004
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    42   0.004
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    42   0.004
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    42   0.004
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    42   0.004
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    42   0.004
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    42   0.004
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    42   0.004
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    42   0.004
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    42   0.004
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    42   0.004
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    42   0.004
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    42   0.004
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    42   0.004
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    42   0.004
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    42   0.004
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    42   0.004
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    42   0.004
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    42   0.005
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    42   0.005
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    42   0.005
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    42   0.005
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    42   0.005
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    42   0.005
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    42   0.005
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    42   0.005
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    42   0.005
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    42   0.005
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    42   0.005
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    42   0.005
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    42   0.005
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    42   0.005
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    42   0.005
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    42   0.005
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    42   0.005
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    42   0.005
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    42   0.005
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    42   0.005
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    42   0.005
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    42   0.005
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    42   0.005
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     42   0.005
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    42   0.006
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    42   0.006
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    42   0.006
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    42   0.006
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    42   0.007
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      42   0.007
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    42   0.007
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    42   0.007
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     41   0.007
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    42   0.007
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    42   0.007
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      42   0.007
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    42   0.007
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    42   0.007
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    42   0.008
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    42   0.008
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               42   0.008
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    41   0.008
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    41   0.008
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    41   0.008
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               41   0.008
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    41   0.008
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    41   0.008
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    41   0.009
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    41   0.009
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    41   0.009
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    41   0.009
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    41   0.009
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    41   0.010
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    41   0.010
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    41   0.010
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    41   0.010
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    41   0.010
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    41   0.010
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    40   0.010
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               41   0.011
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    41   0.011
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    41   0.011
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    41   0.011
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    41   0.011
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    41   0.011
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    41   0.011
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    41   0.012
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    41   0.012
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    41   0.012
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    41   0.012
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    41   0.012
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    41   0.013
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    40   0.013
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    41   0.013
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    40   0.013
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    40   0.013
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    40   0.013
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    41   0.013
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    41   0.014
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       41   0.014
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    40   0.014
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    40   0.015
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    40   0.015
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    40   0.015
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    40   0.016
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    40   0.016
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    40   0.016
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    40   0.016
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    40   0.017
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    40   0.017
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    40   0.017
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    40   0.017
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    40   0.018
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    40   0.018
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    40   0.019
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    40   0.019
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    40   0.019
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    40   0.019
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    40   0.021
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    40   0.021
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    40   0.022
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    40   0.023
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    40   0.023
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    40   0.023
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    40   0.023
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    40   0.023
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    40   0.024
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    40   0.024
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    40   0.025
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    39   0.025
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    40   0.025
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    40   0.026
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    39   0.028
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    39   0.028
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    39   0.029
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    40   0.029
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    39   0.031
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    39   0.032
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    39   0.032
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    39   0.033
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    39   0.033
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    39   0.035
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    39   0.037
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    39   0.038
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    39   0.038
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    39   0.038
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    39   0.039
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    39   0.041
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    39   0.042
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    39   0.044
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    39   0.045
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    39   0.046
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    39   0.047
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    39   0.047
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    39   0.047
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    39   0.047
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    39   0.048
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    39   0.048
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    39   0.048
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    39   0.050
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    38   0.050
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    39   0.051
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    39   0.051
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    39   0.052
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    39   0.053
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    39   0.053
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    39   0.053
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    39   0.054
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    39   0.055
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    39   0.057
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    38   0.058
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    39   0.059
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    39   0.060
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    38   0.061
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    38   0.062
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    38   0.064
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    38   0.064
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    38   0.065
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      39   0.065
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    39   0.066
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    38   0.067
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    39   0.068
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    39   0.069
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    39   0.069
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    38   0.069
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    38   0.070
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    39   0.071
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    38   0.072
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    38   0.072
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    38   0.072
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    38   0.073
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    38   0.074
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    38   0.077
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    38   0.080
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    38   0.081
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    38   0.081
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    38   0.084
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    38   0.088
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    38   0.088
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    38   0.088
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    38   0.091
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    38   0.092
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    38   0.092
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    38   0.093
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    38   0.097
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    38   0.097
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    38   0.10 
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    38   0.10 
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    38   0.10 
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    38   0.11 
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    38   0.11 
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    37   0.11 
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    38   0.11 
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    37   0.11 
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    37   0.11 
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 37   0.11 
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    38   0.12 
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    37   0.12 
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    37   0.12 
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    37   0.12 
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    37   0.12 
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    37   0.12 
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    37   0.12 
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    37   0.13 
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    37   0.13 
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    38   0.13 
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    37   0.13 
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    37   0.13 
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    37   0.14 
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    37   0.14 
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    37   0.15 
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    37   0.15 
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    37   0.15 
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    37   0.15 
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    37   0.15 
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    37   0.16 
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    37   0.16 
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    37   0.17 
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    37   0.17 
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    37   0.18 
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    37   0.21 
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    37   0.23 
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    37   0.25 
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    37   0.25 
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    37   0.25 
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    36   0.26 
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    37   0.26 
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    37   0.27 
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    36   0.27 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    36   0.28 
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    36   0.29 
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    36   0.29 
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    36   0.35 
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    36   0.35 
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    36   0.38 
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    36   0.43 
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    36   0.43 
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    35   0.43 
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    36   0.44 
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    36   0.44 
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    36   0.50 
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    35   0.52 
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    35   0.54 
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    35   0.57 
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    35   0.58 
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    35   0.61 
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    35   0.71 
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    35   0.73 
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    35   0.73 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    35   0.74 
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    35   0.77 
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    35   0.78 
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    35   0.82 
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    35   0.85 
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    33   1.1  
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    34   1.1  
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    34   1.2  
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    33   1.4  
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    34   1.4  
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    34   1.4  
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    33   1.7  
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    33   1.9  
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    33   1.9  
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    33   2.3  
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    33   2.4  
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    33   2.8  
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    33   3.3  
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    33   3.3  
KAFR0E02240 Chr5 complement(451940..453811) [1872 bp, 623 aa] {O...    33   3.5  
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    32   3.7  
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    33   4.1  
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    33   4.1  
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    32   4.2  
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    32   4.7  
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    32   5.0  
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    32   5.2  
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      32   5.3  
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    32   5.5  
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    32   5.8  
KLTH0H04686g Chr8 complement(419384..421726) [2343 bp, 780 aa] {...    32   5.8  
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    32   5.9  
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    32   6.4  
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    32   6.7  
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    32   6.9  
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    32   7.6  
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    32   8.2  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    32   8.6  

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score = 1232 bits (3187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/707 (85%), Positives = 606/707 (85%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60
           MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV
Sbjct: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60

Query: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120
           PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF
Sbjct: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120

Query: 121 MNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180
           MN               MTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS
Sbjct: 121 MNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180

Query: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240
           VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC
Sbjct: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240

Query: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
           YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ
Sbjct: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300

Query: 301 HKSSPLPNFYVQRAMSSLQMDTTQPHRIPILKYTQMXXXXXXXXXXXXXHCQTFSQKDYP 360
           HKSSPLPNFYVQRAMSSLQMDTTQPHRIPILKYTQM             HCQTFSQKDYP
Sbjct: 301 HKSSPLPNFYVQRAMSSLQMDTTQPHRIPILKYTQMSKPVISSQSSPSKHCQTFSQKDYP 360

Query: 361 YIQPNLSNSARAKDYYXXXXXXXXXXXXXXXKQLSEDRVYDVNVNTMDSHCTYRRKLTPN 420
           YIQPNLSNSARAKDYY               KQLSEDRVYDVNVNTMDSHCTYRRKLTPN
Sbjct: 361 YIQPNLSNSARAKDYYLGGSSSTDTLESSLSKQLSEDRVYDVNVNTMDSHCTYRRKLTPN 420

Query: 421 YDHALKKGSSPSINDNSTLNNMTSLKHEHSFNSREAYIHPDFSGSKHFITSNDALNLNCR 480
           YDHALKKGSSPSINDNSTLNNMTSLKHEHSFNSREAYIHPDFSGSKHFITSNDALNLNCR
Sbjct: 421 YDHALKKGSSPSINDNSTLNNMTSLKHEHSFNSREAYIHPDFSGSKHFITSNDALNLNCR 480

Query: 481 TPXXXXXXXXXXXXXXXXXXXXTGGXXXXXXXXXXXXXXXXXXRSQSPIKSRQNTGDSIR 540
           TP                    TGG                  RSQSPIKSRQNTGDSIR
Sbjct: 481 TPRSRDSSINSNSSVDSISRNSTGGSLIKSLGTKIKLTTTGGKRSQSPIKSRQNTGDSIR 540

Query: 541 SAFNKVRQGINLRSSRISSNDSVVRNSEQFGGIPELSNDNKYQFDTTSKNRHEYXXXXXX 600
           SAFNKVRQGINLRSSRISSNDSVVRNSEQFGGIPELSNDNKYQFDTTSKNRHEY      
Sbjct: 541 SAFNKVRQGINLRSSRISSNDSVVRNSEQFGGIPELSNDNKYQFDTTSKNRHEYNSLSRK 600

Query: 601 XXXXXXXXXXXXXXTSNDPIILITNLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYTD 660
                         TSNDPIILITNLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYTD
Sbjct: 601 LSLSSQKQNSLNDSTSNDPIILITNLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYTD 660

Query: 661 NKSSIKHFKSNIEHLTAYGNMNGHLKTAHHLKAKPKVPTKPVFLRSP 707
           NKSSIKHFKSNIEHLTAYGNMNGHLKTAHHLKAKPKVPTKPVFLRSP
Sbjct: 661 NKSSIKHFKSNIEHLTAYGNMNGHLKTAHHLKAKPKVPTKPVFLRSP 707

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  411 bits (1057), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 234/315 (74%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60
           M+Q     Y +GT L V SH+  I  YLTSGGFA +Y+A I+    N    + CLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120
           P+KQSLN+LRAEVDAMK+L+ NK++VSYIDSHA +    + SY V LLMEYCS  GL+DF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180
           MN               M+D++QG+  MH L PPL+HRDIKIENVL+S D  FK+CDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240
           V GV+R P +++EF Y+QNDILKNTTAQYRSPEM++L  G PINEKSDIWALG+ LYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
           YYTTPFE+ G  AI+  +F +PAYPQY+D LKN+I V+LS NP QRPNICQ+LEE+ RIQ
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 HKSSPLPNFYVQRAM 315
           +   PL NFY+ R+M
Sbjct: 301 NVPCPLRNFYLLRSM 315

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 82/188 (43%), Gaps = 29/188 (15%)

Query: 503 TGGXXXXXXXXXXXXXXXXXXRSQSPIKSRQNTGDSIRSAFNKVRQGINL---RSSRISS 559
           TGG                  RS SPIKSRQNTG+S++SAF  +R+G +    +  ++S 
Sbjct: 510 TGGSFSRTFGRRLKKVFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSK 569

Query: 560 NDSVVRNSEQFGGIPELSNDNKYQFDTTSKNRHEYXXXXXXXXXXXXXXXXXXXXT---- 615
            ++V   +         S+ N Y+F  TS +  E                          
Sbjct: 570 KNTVDVTTNG-------SSSNGYKFRVTSSDSIEEENSGFIYSHSRKASSTSIVSDLDSL 622

Query: 616 -------------SNDPIILITNLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYT--D 660
                        S+ P+ L  + +A+ SI+ RVQ L+KSS D+ V  SAHGYG+ +  +
Sbjct: 623 QDDSGTNAKKYYRSHSPVKLSGSSDARSSIQKRVQNLLKSSQDSPVKKSAHGYGEVSEKE 682

Query: 661 NKSSIKHF 668
           +K S + F
Sbjct: 683 DKESPEQF 690

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  407 bits (1047), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 188/315 (59%), Positives = 234/315 (74%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60
           M+Q   D Y+ GT+L V SH   I  YLTSGGFA +YTA I     +   ++ CLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120
           P+K SLN+LRAEVDAMK+L+ N+++VSYIDSHA +    + SY V LLMEYCSG GL+DF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180
           MN                +D++QG+  MH LQPPL+HRDIKIENVL+S D  FK+CDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240
           V GV+R P + +EF Y+Q+DILKNTTAQYR+PEM++L  G+PINEKSDIWALG+ LYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
           YYTTPFE+ G  AI+  +F +P+YPQY+DSLK++I  +LS NP QRPNICQ+LEE+ RIQ
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 HKSSPLPNFYVQRAM 315
               PL NFYV RAM
Sbjct: 301 GTPCPLRNFYVTRAM 315

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 66/147 (44%), Gaps = 16/147 (10%)

Query: 524 RSQSPIKSRQNTGDSIRSAFNKVRQGINLRSSRISSNDSVVRNSEQFGGIPELSNDNKYQ 583
           RS SPIKSRQNTGDS+RSAF  +R+G +  S    S     RNS         SN  K++
Sbjct: 527 RSISPIKSRQNTGDSVRSAFATLRRGFSGGS--FKSELPNKRNSLDISSTSSHSNGFKFR 584

Query: 584 FDTTSKN-------RHEYXXXXXXXXXXXXXXXXXXXXT-------SNDPIILITNLEAK 629
             ++          R  +                    T       S+ P+ +     ++
Sbjct: 585 VSSSESIEEENVYPRFSHSRSSSSASIVSDLDQLQQDDTGAKNYYKSHSPVKVSATQGSR 644

Query: 630 KSIKDRVQALMKSSSDNHVIISAHGYG 656
            SI+ RVQ L+K+S D+ V  +AHGYG
Sbjct: 645 SSIQKRVQDLLKNSQDSPVKKTAHGYG 671

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  397 bits (1021), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 183/313 (58%), Positives = 234/313 (74%), Gaps = 1/313 (0%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60
           M+Q+ +D  + G  L V SHEV I  YLTSGGFAQ+Y+  + S    +   L CLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHV 59

Query: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120
           P+K SLN LRAEVDAMK+LK ++++VSYIDSHA +    + +Y V LLMEYC   GL+DF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180
           MN               M+ V+QG+  MH L PPL+HRDIKIENVL+SGDG+FK+CDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240
           VSGV+R P ++ EF Y+Q+DILKNTTAQYR+PEM++L    P++EKSDIWALG+ LYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
           Y+TTPFE+ G  AI++ KF +P+YPQYTD LKN+I V+LS +P+QRPNICQ+LEE+ RIQ
Sbjct: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299

Query: 301 HKSSPLPNFYVQR 313
               PLPNFY++R
Sbjct: 300 GVPCPLPNFYLER 312

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  393 bits (1009), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 183/307 (59%), Positives = 225/307 (73%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y  GT L V SH+  I  YLTSGGFAQVYTA I+     +   + CLKRVIVP+K SLN 
Sbjct: 9   YHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIVPDKPSLNT 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           LRAEVDAMK+L+NN ++VSYIDSHA +   +  SY V LLMEYC   GL+DFMN      
Sbjct: 69  LRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDFMNTRLQNR 128

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    M+ VSQGV  MH LQPPLLHRDIKIENVLL+  G++KLCDFGSV G++R P
Sbjct: 129 LHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGSVCGIIRPP 188

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
           T+ +EF Y+Q+DI+KNTTAQYRSPEM+NL  G PINEKSDIWALG+ LYKLCYYTTPFE+
Sbjct: 189 TNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLCYYTTPFEK 248

Query: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
            G  AI+   F +P +P Y+D +K++IR+ L+  P QRPNI QLLEE+ +IQ+   P+P+
Sbjct: 249 TGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQNVPCPIPD 308

Query: 309 FYVQRAM 315
           FY+QR +
Sbjct: 309 FYLQRKL 315

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  397 bits (1020), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 189/315 (60%), Positives = 229/315 (72%), Gaps = 1/315 (0%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60
           MSQ   + Y  GT L V SH+  I  YLTSGGFA +Y+A I+    N    + CLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPN-SSSIACLKRVLV 59

Query: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120
           P+K SLN LRAEVDAMK+LK +K++VSYIDSHA +   +  SY V LLMEYC+  GL+DF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180
           MN               M+ VSQGV  MH LQPPL+HRDIKIENVL+S DGNFK+CDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240
           V GV+R P + +E  Y+Q+DILKNTTAQYRSPEM++L  G P++EKSDIWALG+ LYKLC
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
           YYTTPFE+ G  AI+  KF +PAYPQY+D LKN+I  LL  NP+QRPNICQLL E+ RIQ
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 HKSSPLPNFYVQRAM 315
               P+ NFY++R M
Sbjct: 300 GVPCPVKNFYLERKM 314

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 70/156 (44%), Gaps = 26/156 (16%)

Query: 524 RSQSPIKSRQNTGDSIRSAFNKVRQGINLRSSRISSNDSVVRNSEQF-------GG---- 572
           R+ SPI+SRQNTG S RSAF+ +R+G    SS  SS D   RNS  F       GG    
Sbjct: 524 RNTSPIRSRQNTGGSTRSAFSTLRRGT---SSNFSS-DRSKRNSVDFSVRRLGSGGNKVR 579

Query: 573 ------IPELSNDNKYQFDTTSKNRHEYXXXXXXXXXXXXXXXXXXXXTSND---PIILI 623
                 I E  N NK  F+    NR                         N    PI + 
Sbjct: 580 VSSSKSIEEKGNTNK--FENKGHNRSVSTSSITSDLNKYEGKAGSVSRGYNQAHSPIKMS 637

Query: 624 TNLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYT 659
            N E++ SI+ RV  L+K+S D+ V  +A  +G+++
Sbjct: 638 ANRESRNSIQKRVHDLLKNSQDSPVRKTAPDFGEFS 673

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  390 bits (1003), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 184/325 (56%), Positives = 230/325 (70%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60
           M+Q   +KY  GT L V SH+V +  YL SGGFA VY+  I+         + CLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120
           P+K SLN LRAEVD+MK L+ NK+IVSYIDSHA +   +   Y V LLMEYCSG GL+DF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180
           MN               M+ VSQGV  MH LQPPL+HRDIKIENVLLS +  FKLCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240
           VSGV+R+P ++EEF Y+Q DI+KNTTAQYR PEM++L  G PI+EKSDIWALG+ LYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
           YYTTPFE++G  AI+  KF +PAYP+Y+D +KN+I V+L  +P++RPNICQ++EE+ RIQ
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 HKSSPLPNFYVQRAMSSLQMDTTQP 325
               P+ NFY+ R M   +     P
Sbjct: 301 GIPCPIKNFYLLRMMDKQEQPRVSP 325

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 75/178 (42%), Gaps = 15/178 (8%)

Query: 503 TGGXXXXXXXXXXXXXXXXXXRSQSPIKSRQNTGDSIRSAFNKVRQGINL------RSSR 556
           TGG                  R  S I+S QNTG+S++SAFN +R+GI+        SSR
Sbjct: 521 TGGSLTRKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSR 580

Query: 557 ISSNDSVVRNSEQFGGIPELSNDNKYQFDTTSKNRHEYXXXXXXXXXXXXXXXXXXXXTS 616
            SS ++    S     IPE ++ N     T S  R                         
Sbjct: 581 KSSLEARKYRSTSGKSIPENTSSN-----TKSHRRSTSSFSFVPENNDYELIEDIQKEKP 635

Query: 617 NDPIILITNLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYTD--NKSSIK-HFKSN 671
              +   ++L+   SI+ RV+ L+ ++ D     SA GYGKYTD   K+ I  H KSN
Sbjct: 636 KSSLRRSSSLKTSSSIQKRVKDLI-NADDIPNRSSATGYGKYTDIGRKTDISDHHKSN 692

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  388 bits (997), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 182/325 (56%), Positives = 235/325 (72%), Gaps = 3/325 (0%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y   T + V SH   I  YL SGG+AQVY+A +T    +    + CLKRV+VP+K+SLN 
Sbjct: 9   YVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVVPDKKSLNA 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           LRAEVDA+K+L+N KY+VSYIDSHA++      SY V +LMEYCSG  L+DF+N      
Sbjct: 69  LRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDFLNTRLKNR 128

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    MT V+ GV  MH+LQP L+HRDIKIEN+L+S +G +K+CDFGSV GV+R P
Sbjct: 129 LREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGSVCGVIRPP 188

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
            S EE  Y+Q+DI+KNTTAQYRSPEM++L  G+ INEKSDIWALG+ L+KLCYYTTPFE+
Sbjct: 189 RSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLCYYTTPFEK 248

Query: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
            G +AI++ +F YPAYP Y+DSLKN+IRVLLS +P +RPNICQL+EEL R+Q    P+ N
Sbjct: 249 EGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQGIVPPMKN 308

Query: 309 FYVQRAM---SSLQMDTTQPHRIPI 330
           FY+ RA+   S +Q      +++PI
Sbjct: 309 FYLSRALETSSLMQPLQNNSYKVPI 333

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 85/186 (45%), Gaps = 24/186 (12%)

Query: 524 RSQSPIKSRQNTGDSIRSAFNKVRQGINLRSSRISSNDSVVRNSEQFGGIPELSNDNKYQ 583
           RS SP++SRQNTG S RS F  + +G    +SRISS++  +R          +S+  K  
Sbjct: 521 RSVSPVRSRQNTGGSSRSVFTVLHEGFTGGNSRISSSEHTIRGPSSSSHKSRVSSSTK-N 579

Query: 584 FDTTSKNRHEYXXXXXXXXXXXXXXXXXXXXTSNDP---IILITNLEAKKSIKDRVQALM 640
           F+     +H                       S +P   I L T  EAK SIK RV+ L+
Sbjct: 580 FEEGFIRKH-----------------VDIVEESAEPKVGIKLKTTREAKDSIKRRVRELL 622

Query: 641 KSSSDNHVIISAHGYGKYTDNKSSIKHFKSNIEHLTAYGNMNGHLKTAHHLKAKPKVPTK 700
             S D     +A GYGKYTD +  + +  + +   T    ++    +    + KP +P K
Sbjct: 623 LVSEDEQYHRTASGYGKYTDVQEIVTNIMTPLVKSTQKTPIDSKNSSP---RKKPILPAK 679

Query: 701 PVFLRS 706
           P+ LRS
Sbjct: 680 PLHLRS 685

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  385 bits (990), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 179/307 (58%), Positives = 223/307 (72%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y  GT L V SH   + +YLTSGGFAQVY+A I      +   + CLKRVIVP+K SLN 
Sbjct: 9   YNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIVPDKPSLNT 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           LRAEVDAMK+L+NNK++VSYIDSHA +      SY V LLMEYC+G GL+DFMN      
Sbjct: 69  LRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDFMNTRLQNR 128

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    M+ V+QG+  MH LQPPL+HRDIKIENVL+S  G +K+CDFGSV GV+R P
Sbjct: 129 LQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGSVCGVIRPP 188

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
            + +EF Y+Q+D+LKNTTAQYRSPEM++L  G PI+EKSDIWALG+ LYKLCYYTTPFE+
Sbjct: 189 QNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLCYYTTPFEK 248

Query: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
            G  AI+  +F +PA P Y+D LK +IR +L  NP QRPN+CQ+LE++ R+Q    P+ N
Sbjct: 249 GGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQGIQCPVRN 308

Query: 309 FYVQRAM 315
           FY+ RAM
Sbjct: 309 FYLLRAM 315

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  387 bits (993), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 184/311 (59%), Positives = 227/311 (72%), Gaps = 4/311 (1%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y  G  L V SH+  I  YLTSGGFAQVY   I+    +    + CLKRVIVP+K SLN+
Sbjct: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNV 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNS----EDSYVVLLLMEYCSGAGLLDFMNXX 124
            RAEV+AMK+L+NNKY+VSYIDSHA + + +      SY V LLMEYCSG GL+DFMN  
Sbjct: 69  PRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTR 128

Query: 125 XXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGV 184
                        M+ VSQGV  MH LQPPLLHRDIKIENVL+S    FKLCDFGSV GV
Sbjct: 129 LQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGV 188

Query: 185 LRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTT 244
           +R PT+  E  ++Q+DILKNTTAQYRSPEM++L+   PINEKSDIWALG+ LYK+CYYTT
Sbjct: 189 IRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTT 248

Query: 245 PFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSS 304
           PFE+ G  AI+  ++ YPAYPQY+D+LKN+IRV+L  +P +RPNICQ++EE+ R+Q    
Sbjct: 249 PFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPC 308

Query: 305 PLPNFYVQRAM 315
           PL NFY++RA+
Sbjct: 309 PLKNFYLERAI 319

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 46/96 (47%), Gaps = 12/96 (12%)

Query: 618 DPIILITNLEAKK-SIKDRVQALMKSSSDNHVII---SAHGYGKYT---DNKSSIKHFKS 670
           +P   +TN   KK SI DR    + S  DN V     +A GYGKYT   D + S+    +
Sbjct: 597 EPSSELTNKTVKKNSITDR---YLNSVGDNGVTSVKKTAEGYGKYTKVSDKEGSLTSVNT 653

Query: 671 N--IEHLTAYGNMNGHLKTAHHLKAKPKVPTKPVFL 704
              +E      N N ++K     K  PK+PTKP +L
Sbjct: 654 AKPLESGHKSENTNKYIKGNTKQKVPPKLPTKPSYL 689

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  389 bits (999), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 185/325 (56%), Positives = 232/325 (71%), Gaps = 4/325 (1%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y+ GT L V SH   I  YLTSGGFAQVYTA I+         + CLKRVIVP+KQ LN 
Sbjct: 9   YEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDKQGLNT 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           LRAEVDAMK+LKNNK++VSYIDSHA +  N   +Y V +LME+C   GL+DFMN      
Sbjct: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEFCERGGLIDFMNTRLQNR 127

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    M+   QG+  MH LQPPL+HRDIKIENVL+S +G +K+CDFGSVSGV+R P
Sbjct: 128 LRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSGVIRPP 187

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
            +++EF Y+Q+DIL NTTAQYRSPEM++L  G PI+EKSDIWALGI LYK+CYYTTPFE+
Sbjct: 188 RNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYTTPFEK 247

Query: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
            G   I+  ++ YP +PQY+D LKN+IR++L   P +RPNICQ+LEE+ R+Q K  P+ N
Sbjct: 248 SGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKPCPIRN 307

Query: 309 FYVQRAMSSLQMDTTQPHRIPILKY 333
           FY+ RAMS      ++P   P +KY
Sbjct: 308 FYLLRAMSQTAQLASEP---PSMKY 329

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%)

Query: 625 NLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYTDNKSSIKHFKSNI 672
           N E K+SI+ RV  L+KSS D     SA GYGKYTD  +   +  S++
Sbjct: 667 NQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYTDTDTETSNRHSSV 714

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 19/26 (73%)

Query: 524 RSQSPIKSRQNTGDSIRSAFNKVRQG 549
           R  SPIKSRQNTGDS RSA   +R G
Sbjct: 524 RGSSPIKSRQNTGDSTRSALGMLRHG 549

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  389 bits (999), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 181/307 (58%), Positives = 226/307 (73%), Gaps = 1/307 (0%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y+ GT L V SH   I  YLTSGGFAQVYTA I+         + CLKRVIVP+KQ LN 
Sbjct: 9   YEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIVPHKQGLNT 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           LRAEVDAMK+L+NNK++VSYIDSHA R  N   +Y V +LME+C   GL+DFMN      
Sbjct: 69  LRAEVDAMKLLRNNKHVVSYIDSHAARSVNG-IAYEVFVLMEFCERGGLIDFMNTRLQNR 127

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    M+   QG+  MH LQPPL+HRDIKIENVL+S DG +K+CDFGSVSGV+R P
Sbjct: 128 LQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPP 187

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
            +++EF Y+Q+DIL NTTAQYRSPEM++L  G PI+EKSDIWALG+ LYK+CYYTTPFE+
Sbjct: 188 RNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKICYYTTPFEK 247

Query: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
            G   I+  ++ YP++PQY+D LKN+IR++L   P QRPNICQ+LEE+ R+Q+K  P+ N
Sbjct: 248 SGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQNKPCPIRN 307

Query: 309 FYVQRAM 315
           FY+ RAM
Sbjct: 308 FYLLRAM 314

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 74/179 (41%), Gaps = 42/179 (23%)

Query: 524 RSQSPIKSRQNTGDSIRSAFNKVRQGI---NLRSSRISSNDSVVRN-----------SEQ 569
           R  SPIKSRQNTGDSIRSAF K+R G    ++ +SR +S D+   N           S  
Sbjct: 526 RGNSPIKSRQNTGDSIRSAFGKLRHGFTGNSVNNSRSASFDNNNVNGNGNNTNRRLVSSS 585

Query: 570 FGGIPELSNDNKYQ----------------------FDTTSKNRHEYXXXXXXXXXXXXX 607
               P+ ++D K +                      FD   +N                 
Sbjct: 586 TSSFPKFNSDTKRKEESDKNQRLEKRRSMPPSILSDFDQHERNNSRTGSRDYYRSHSPVK 645

Query: 608 XXXXXXXTSNDPIILI------TNLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYTD 660
                  T++ P ++        N E K+SI+ RV  L+KSS D     SA GYGKYTD
Sbjct: 646 KTQASAKTTSKPTLIPDNGNVNINQEKKESIQRRVHNLLKSSDDPVTYKSASGYGKYTD 704

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  387 bits (993), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 187/322 (58%), Positives = 225/322 (69%), Gaps = 5/322 (1%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y  GT L V +H  +I+ YLTSGGFAQ+Y   IT         + CLKRVIVP K  LN 
Sbjct: 9   YPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIVPTKSGLNT 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           LRAEVDAMK+LKNN+++VSYIDS+A +   +  SY VLLLMEYC G GL+DFMN      
Sbjct: 69  LRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDFMNSRLQNR 128

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    ++  +QGV +MH LQP LLHRDIKIENVL SG+G FKLCDFGSV G +R P
Sbjct: 129 LSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGSVCGYIRPP 188

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
            + +E  Y+Q+DILKNTTAQYR PEM++L  G PI+EKSDIWALG+ LYKLCYYTTPFE+
Sbjct: 189 RNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEK 248

Query: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
            G  AI+  KF YPA+P Y+D LKN+IRV+LS NP +RPNIC+LLEE+  IQ    P+ N
Sbjct: 249 TGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQGVPCPIQN 308

Query: 309 FYVQRAMS-----SLQMDTTQP 325
           FY+ RA        LQ  TT P
Sbjct: 309 FYLIRAQQLANQIQLQRQTTVP 330

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 20/24 (83%)

Query: 524 RSQSPIKSRQNTGDSIRSAFNKVR 547
           R+ SPI+SRQ+TG S+RSAF  +R
Sbjct: 502 RNASPIRSRQDTGGSVRSAFGAIR 525

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  386 bits (992), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 180/307 (58%), Positives = 225/307 (73%), Gaps = 1/307 (0%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y+ GT L V SH   I  YLTSGGFAQVY+A I+         + CLKRVIVP+KQ LN 
Sbjct: 9   YEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIVPDKQGLNT 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           LRAEVDAMK+LKNNK++VSYIDSHA +  N   +Y V +LMEYC   GL+DFMN      
Sbjct: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGV-AYEVFVLMEYCERGGLIDFMNTRLKNR 127

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    M    QG+  MH LQPPL+HRDIKIENVL+S +G +K+CDFGSVSGV+R P
Sbjct: 128 LQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGSVSGVIRPP 187

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
            + +EF Y+Q+DIL NTTAQYRSPEM++L  G PI+EKSDIWALG+ LYK+CYYTTPFE+
Sbjct: 188 KNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKICYYTTPFEK 247

Query: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
            G  AI+  ++ YP++PQY+D LKN+IR++L   P QRPNICQ+LEE+ R+Q++  P+ N
Sbjct: 248 TGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQNRPCPIRN 307

Query: 309 FYVQRAM 315
           FY+ RAM
Sbjct: 308 FYLLRAM 314

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%)

Query: 627 EAKKSIKDRVQALMKSSSDNHVIISAHGYGKYTDNKSSIKHFKSNI 672
           E K+SI+ RV  L+ +S D+    SA GYGKYTD ++   + +S++
Sbjct: 666 EKKESIQRRVHNLLNNSEDSLSYKSASGYGKYTDTEAESTNRQSSV 711

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  384 bits (987), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 181/330 (54%), Positives = 240/330 (72%), Gaps = 6/330 (1%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60
           M+Q+ +D ++ GT L V SH+V +  YLTSGGFAQ+Y   + S    +  ++ CLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59

Query: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120
           P+KQSLN LRAEVDAMK+L+ NK+IVSYIDSHA++   +  SY V+LLMEYCS  GL+ F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180
           MN               M  V QG+  MH LQPPL+HRDIKIENVL++ +G+ K+CDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240
           V GV+R P ++ E  Y+Q+DILKNTTAQYR+PEM++L  GF ++EKSDIWALG+ LYKLC
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
           YYTTPFE+ G  AI++  F +P+YPQY++ LKN+I V+L+ NPI RPN CQ+LEE+ RIQ
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 HKSSPLPNFYVQRAM-----SSLQMDTTQP 325
            +  P+ NFY++R++     S L+   +QP
Sbjct: 300 GQPCPVKNFYLERSLKQQIPSQLRHSVSQP 329

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  380 bits (975), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 230/322 (71%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60
           M+Q   D+   GT+L V +H V I  YLTSGGFAQ+Y   I S        + CLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120
           P+K SLNILRAEVDAMK+L NNK++VSYIDSHA R   ++ +Y V LLMEYC G GL+DF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180
           MN               M+  +QG+  MH L PPLLHRDIKIENVLLS  G +K+CDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240
           VSGV+R P + +E +Y+Q+DI+KNTTAQYR PEM++L  G PI+EK+DIWALG+ LYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
           YYTTPFE+ G  AI+  +F +P++P Y+D LKN+I+ +L  +P  RPN+CQ+LEE+ R+Q
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 HKSSPLPNFYVQRAMSSLQMDT 322
           +   P+ NFY+ RAM  +++ T
Sbjct: 301 NVPCPIRNFYLLRAMEKVKLST 322

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 27/40 (67%)

Query: 625 NLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYTDNKSS 664
           N E +KSI+ RVQ L+ + S N V  SA GYGKYTD  SS
Sbjct: 546 NSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTDELSS 585

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  381 bits (978), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 188/364 (51%), Positives = 237/364 (65%), Gaps = 4/364 (1%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y  GT L V SH   I  YLTSGGFAQVYTA I+           CLKRVIVP+KQ LN 
Sbjct: 9   YDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNT 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           LRAEVDAMK+LKNNK++VSYIDSHA +  N   +Y V +LME+C   GL+DFMN      
Sbjct: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNG-IAYEVFVLMEFCERGGLIDFMNTRLQSR 127

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    M+   QG+  MH LQPPL+HRDIKIENVL+S DG +K+CDFGSVSGV+R P
Sbjct: 128 LRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPP 187

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
            +S+EF Y+Q+DIL NTTAQYRSPEM++L    PI+EKSDIWALG+ LYK+CYYTTPFE+
Sbjct: 188 RNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEK 247

Query: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
            G  AI+  ++ YP++PQY+D LK +I ++L   P QRPNICQ+LEE+ R+Q++  P+ N
Sbjct: 248 SGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNEPCPIRN 307

Query: 309 FYVQRAMSSLQMDTTQPHRIPILKYTQMXXXXXXXXXXXXXHCQTFSQKDYPYIQPNLSN 368
           FY+ RAM       ++P   P + Y                H Q+     +    PNL  
Sbjct: 308 FYLLRAMGQNAQLASEP---PSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTTPNLGT 364

Query: 369 SARA 372
             +A
Sbjct: 365 LTKA 368

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 503 TGGXXXXXXXXXXXXXXXXXXRSQSPIKSRQNTGDSIRSAFNKVRQGINLRSSRISSNDS 562
           TGG                  RS SPIKSRQNTGDSIRSAF  +R G  L  S +S+N +
Sbjct: 505 TGGSIVRSLSSKLKKVITGESRSSSPIKSRQNTGDSIRSAFGMLRHG--LTGSSVSNNRT 562

Query: 563 V 563
           +
Sbjct: 563 I 563

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (65%)

Query: 629 KKSIKDRVQALMKSSSDNHVIISAHGYGKYTD 660
           K+SI+ RV  L+ +S D     SA GYGKYTD
Sbjct: 672 KESIQRRVHNLLNNSEDPLAHKSASGYGKYTD 703

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  377 bits (969), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 174/307 (56%), Positives = 225/307 (73%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y +G  LQV  H   I  YLTSGG+AQVY A+I+        ++ CLKR+IVP+K SLN 
Sbjct: 9   YPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIVPDKASLNT 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
            RAEVDAMK+L+N  ++VSYIDS+A +      +Y VLLLME+C+  GL+DFMN      
Sbjct: 69  PRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDFMNTRLQNR 128

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    M+ V+QGV  MH L+PPLLHRDIKIENVL+S  G +KLCDFGSV GV+R P
Sbjct: 129 LQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGSVCGVIRPP 188

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
           TS +EF ++Q+DILKNTTAQYR+PEM++L+   PI+EKSDIWALG+ LYKLCYYTTPFE+
Sbjct: 189 TSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLCYYTTPFEK 248

Query: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
            G  AI+  ++ Y AYP Y+D+LKN+IR++L+  P QRPNICQ+LEE+ R+Q    P+ N
Sbjct: 249 AGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQGIPCPIKN 308

Query: 309 FYVQRAM 315
           FY++RA+
Sbjct: 309 FYLERAI 315

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  375 bits (962), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 171/303 (56%), Positives = 219/303 (72%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y+ GT L V SH+V +  YLTSGGFAQ+YT +I+   K     + CLKRVIVP+K SLN 
Sbjct: 9   YQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIVPDKPSLNT 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           LRAEVD MK+L+NN ++VSYIDSHA +   +E SY V LLMEYC   GL+DFMN      
Sbjct: 69  LRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDFMNTRLQER 128

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    M+ V+QG+  MH L PPLLHRDIKIENVLL+  G +K+CDFGSV G++R P
Sbjct: 129 LREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGSVCGIIRPP 188

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
           ++++E  Y+Q+DI+KNTTAQYR+PEM++L  G PI+EKSDIWALG+ LYKLCYYTTPFE+
Sbjct: 189 SNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLCYYTTPFEK 248

Query: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
           +G  AI+   F +P YPQY+D LK +I  +L   P QRPN  Q+LEE+  +Q+   P+PN
Sbjct: 249 NGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQNVQCPIPN 308

Query: 309 FYV 311
           FY+
Sbjct: 309 FYL 311

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  374 bits (961), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 177/331 (53%), Positives = 228/331 (68%), Gaps = 1/331 (0%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60
           M+Q     Y  GTKL V  H+V I  YLTSGGFAQ+Y  ++   +      L CLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120
           P K  LN LRAEV+AM++LK   ++V YIDS+A R  +++ +Y VL LME+C G GL+DF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180
           MN               M  V+QG+  MH L PPL+HRDIKIENVL+S +G +K+CDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240
           VSG++R P ++EEF ++Q DI+KNTTAQYR PEM++L  G PINEKSDIWALG+ LYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
           YYTTPFE  G RAI+  ++ YP YP Y+  LKN+IR++L   P QRPN+CQ+LEE+  +Q
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 HKSSPLPNFYVQRAMSS-LQMDTTQPHRIPI 330
               PLPNFY+QR  ++ L M+ T     PI
Sbjct: 301 GIPCPLPNFYLQRQQATQLMMNNTNGSIYPI 331

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  375 bits (962), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 182/330 (55%), Positives = 224/330 (67%), Gaps = 3/330 (0%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y  GT L V SH   I  YLTSGGFAQ+YT  I+  +     +  CLKRVIVP+K  LN 
Sbjct: 9   YPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIVPDKAGLNT 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           LRAEVDAMK+LKNN+++VSYIDSHA R      +Y V LLMEYC G GL+DFMN      
Sbjct: 69  LRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDFMNTRLQNR 128

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    ++   QGV  MH LQP L+HRDIKIENVL+S  G FK+CDFGSV   +R P
Sbjct: 129 LTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGSVCSYIRPP 188

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
            + +E  Y+Q+D+LKNTTAQYR+PEM++L  G PINEKSDIWALG+ LYKLCYYTTPFE+
Sbjct: 189 RNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLCYYTTPFEK 248

Query: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
            G  AI+  ++ YPA+P YTD LKN+IR  L  +P +RPNICQLLEE+ RIQ    P+ N
Sbjct: 249 GGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQGIPCPINN 308

Query: 309 FYVQRAM---SSLQMDTTQPHRIPILKYTQ 335
           FY+ R +   +SL      P +   LK++Q
Sbjct: 309 FYLSRTINVQASLMNPIITPTQQTALKHSQ 338

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/164 (29%), Positives = 75/164 (45%), Gaps = 4/164 (2%)

Query: 503 TGGXXXXXXXXXXXXXXXXXXRSQSPIKSRQNTGDSIRSAFNKVRQGINLRS-SRISS-- 559
           TGG                  R+ SPI+SRQNTG SIRSAF+ +R GI   + SR+SS  
Sbjct: 466 TGGSITQFFTSTLKRVVTGESRNTSPIRSRQNTGGSIRSAFDALRSGITGNTNSRVSSLA 525

Query: 560 NDSVVRNSEQFGGIPELSNDNKYQFDTTSKNRHEYXXXXXXXXXXXXXXXXXXXXTSNDP 619
           +     +S         ++D   +     K  H                      +SN P
Sbjct: 526 SSVRNVSSSSKHSKHSDADDEPNKIKIRMKKAHRRSVPPNLYSDFYANEDTPKLYSSNSP 585

Query: 620 IILITNLEAKKSIKDRVQALMKS-SSDNHVIISAHGYGKYTDNK 662
           + L +    ++SI++RV+AL+++   +   I +A GYGKYTD++
Sbjct: 586 VKLKSLSTQRESIQNRVKALLETFEEEPSTIKTASGYGKYTDSE 629

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  375 bits (964), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 228/320 (71%), Gaps = 1/320 (0%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSL 66
           + +  G  L V SH   +  YLTSGG+AQVY   I+     +   + CLKRVIVP+K SL
Sbjct: 7   ETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIVPDKPSL 66

Query: 67  NILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXX 126
           N LRAEVDAMK+LKNN+++VSYIDSHA++      +Y V +LME+C   GL+DFMN    
Sbjct: 67  NTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDFMNSRLQ 126

Query: 127 XXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLR 186
                      M+  SQG+  MH+LQP LLHRDIKIENVL+S +  +K+CDFGSV G++R
Sbjct: 127 HRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGSVCGIVR 186

Query: 187 SPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPF 246
            P + +EF ++ +DI+KNTTAQYRSPEM++L+ G PINEKSDIWALG+ LYKLCYYTTPF
Sbjct: 187 PPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLCYYTTPF 246

Query: 247 EEHGSR-AIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSP 305
           E++G   AI++ +F YP+YP Y+D LKN+IRV+LS NP  RPN+CQ+LEE+ R+Q    P
Sbjct: 247 EKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRLQGIPCP 306

Query: 306 LPNFYVQRAMSSLQMDTTQP 325
           + NFY+ RAM + +    QP
Sbjct: 307 IRNFYLLRAMENNKRTIEQP 326

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 86/197 (43%), Gaps = 19/197 (9%)

Query: 529 IKSRQNTGDSIRSAFNKVRQGI--NLRSSRISSNDSVVR----NSEQFGGIPELSNDNKY 582
           IKSRQNTGDSIRSA N +R G   N  ++R +S D+  R    N      I E  + +++
Sbjct: 547 IKSRQNTGDSIRSAMNSIRSGFTGNNNNTRSASYDNGKRLSSVNLHMHSAILEQDDSDEF 606

Query: 583 QFDTTSKNRHEYXXXXXXXXXXXXXXXXXXXXTSNDPIILITNLEAKKSIKDRVQALMKS 642
           +    +                           S  P+ +  N E K SI+ RVQ L+K+
Sbjct: 607 EMPRYNSVSSNTLKDVEEHERRTVNTSSREYYRSQSPVRMSVNREMKNSIQKRVQDLLKN 666

Query: 643 SSDN--HVIISAHGYGKYTD---NKSSIKHFKSNIEHL----TAYGNMNGHLKTA----H 689
           + +N    + +A GYGKYTD   NK  I   KS +        A  +++G  K       
Sbjct: 667 AEENTTATVRTASGYGKYTDYNKNKDEISPTKSRVAQFNQSTAALASLSGKRKKPPVPYK 726

Query: 690 HLKAKPKVPTKPVFLRS 706
               KP  P KP FL S
Sbjct: 727 RDSLKPTPPAKPAFLSS 743

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  368 bits (944), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 175/320 (54%), Positives = 226/320 (70%), Gaps = 1/320 (0%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y  GT+L V SH+V I  YLTSGGFAQVY+A I+    + +  + CLKRVIVP+K SLN 
Sbjct: 9   YNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIVPDKPSLNT 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           LRAEVDAM++L+NN+Y+VSYIDSHA +      SY V +LMEYC   GL+DFMN      
Sbjct: 69  LRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNR 128

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    M+ V+QGV  MH LQPPL+HRDIKIENVL+S +  +KLCDFGSV GV+R P
Sbjct: 129 LHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGVIRPP 188

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
            + +E  Y+Q DI KNTTAQYRSPEMV++  G PI+EKSDIWALGI LYKLCYYTTPFE+
Sbjct: 189 RNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248

Query: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
            G  AI+ G F +P YP Y++ L+++IR +L  NP QRPN+ QLL+ +  +Q+   P+ +
Sbjct: 249 GGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQNVPCPISD 308

Query: 309 FYVQRAMSSLQMDTTQPHRI 328
             V +A  S  ++ T+ H++
Sbjct: 309 IQVPQAPDS-HLNLTELHQL 327

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  358 bits (920), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 175/331 (52%), Positives = 229/331 (69%), Gaps = 3/331 (0%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60
           M+Q   D Y  GT L V SH+V I  Y+TSGGFAQ+YT  I+         + CLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120
           P+K SLN LRAEVDAMK+L+NNK++VSYIDSHA++   +  SY V LLMEYC   GL+DF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180
           MN                + V+QG+  MH LQPPLLHRDIKIENVL+S    +K+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240
           VSG++R P + +E  Y+Q+D+LKNTTAQYRSPEM++   G PI+EKSDIWA+G+ LYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFEEHGSR-AIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRI 299
           YYTTPFE++G   AI+  ++ YP +P Y++ LK++I  +L  NP QRPNI Q++EE+ ++
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QHKSSPLPNFYVQRAMSSLQMDTTQPHRIPI 330
           Q+   P+ NFY+       +M   QP  IP+
Sbjct: 301 QNVPCPIVNFYLVTQQQKHKMVQLQP--IPV 329

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  365 bits (938), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 177/320 (55%), Positives = 225/320 (70%), Gaps = 1/320 (0%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y  GT+L V SH+V I  YLTSGGFAQVY+A I     +    + CLKRVIVP+K SLN 
Sbjct: 9   YNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNT 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           LRAEVDAM++LKNN+Y+VSYIDSHA +      SY V +LMEYC   GL+DFMN      
Sbjct: 69  LRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDFMNTRLQNR 128

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    M+ V+QGV  MH LQPPL+HRDIKIENVL+S +  +KLCDFGSV G++R P
Sbjct: 129 LHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPP 188

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
            +S+E  Y+Q DILKNTTAQYRSPEM++   G PI+EKSDIWALGI LYKLCYYTTPFE+
Sbjct: 189 RNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248

Query: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
            G  AI+ GKF +P YP Y++ LK +IR +L  +P  RPN+ QLL+ +  +Q+   P+ +
Sbjct: 249 GGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQNVPCPIND 308

Query: 309 FYVQRAMSSLQMDTTQPHRI 328
             V +A SS  ++ T+ H++
Sbjct: 309 IQVVQAPSS-HLNLTELHQL 327

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  383 bits (983), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 175/315 (55%), Positives = 229/315 (72%), Gaps = 2/315 (0%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARI--TSEHKNLYPELTCLKRV 58
           M+Q    KY+KG  L + +H+VIIE YL  GGFAQVY+ R+  +S  +N    + CLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 59  IVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLL 118
           IVP+K  LN LRAEVDAMK+LK NKYIVSYIDSHA R +  +  Y V LLMEYCS  G++
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 119 DFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDF 178
           DF+N               M+DV QGV  MH LQPPL+HRDIKIENVL+S +G++K+CDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 179 GSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYK 238
           GS   VLR P + +E  ++ +DI+ NTTAQYRSPEM++   G+PI+EKSDIWALG+ LYK
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 239 LCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFR 298
           LCYYTTPFE+ G  AI+  KF +P+YPQY+D ++NII ++L+ +PI+RPNICQ+LE++ +
Sbjct: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 299 IQHKSSPLPNFYVQR 313
           +Q    P+ NF + R
Sbjct: 301 LQGVPCPIENFMLTR 315

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 30/40 (75%), Gaps = 1/40 (2%)

Query: 622  LITNLEAKKSIKDRVQALMKSS-SDNHVIISAHGYGKYTD 660
            L++N +AK  IK RV  L+K+S +DN V  +AHGYGKYTD
Sbjct: 1200 LVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTD 1239

 Score = 35.0 bits (79), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 44/68 (64%), Gaps = 5/68 (7%)

Query: 525 SQSPIKSRQNTGDSIRSAFNKVRQGINLRS-SRISSND--SVVRN-SEQFGGIPELSN-D 579
           + SP+ SRQNTGDSI+SAF+K+R+ ++  + SRI S+D  S  +N S  F  + E S  D
Sbjct: 865 TASPLSSRQNTGDSIKSAFSKLRRSLSSSNPSRIISSDTSSTRKNKSSNFRNVSEPSTCD 924

Query: 580 NKYQFDTT 587
            +Y F  T
Sbjct: 925 PQYTFSIT 932

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  365 bits (937), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 174/309 (56%), Positives = 220/309 (71%), Gaps = 4/309 (1%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y  GT L V +H   I  Y+ SGGFAQVY+A +            CLKRVI+P K  LN 
Sbjct: 9   YTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNA 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANR--LQNSEDSYVVLLLMEYCSGAGLLDFMNXXXX 126
           LRAEV+AMK+LK +K++V YIDSHA R  LQN   +Y V LLME+C+  GL+DFMN    
Sbjct: 69  LRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNG--TYEVFLLMEFCTAGGLIDFMNTRLQ 126

Query: 127 XXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLR 186
                      M+ V+QG+  MH LQPPL+HRDIKIENVL+S DG +K+CDFGSVSG +R
Sbjct: 127 NRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIR 186

Query: 187 SPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPF 246
            P + +EF ++Q+DILKNTTAQYRSPEM++L     I+EKSDIWALGI LYKLCYYTTPF
Sbjct: 187 PPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPF 246

Query: 247 EEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPL 306
           E+ G +AI+  ++ + A+P Y+D LKN+I  +LS  P+QRPNICQ+LEE+ R+Q  SSP+
Sbjct: 247 EKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQGVSSPM 306

Query: 307 PNFYVQRAM 315
            NFY+ RAM
Sbjct: 307 RNFYLLRAM 315

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  361 bits (927), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 174/320 (54%), Positives = 226/320 (70%), Gaps = 1/320 (0%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68
           Y  GT+L V SH+V I  YLTSGGFAQVY+  I+    +    + CLKRVIVP+K SLN 
Sbjct: 9   YNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIVPDKPSLNT 68

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           LRAEVDAM++LKNN+Y+VSYIDSHA +      SY V +LMEYC   GL+DFMN      
Sbjct: 69  LRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDFMNTRLQNR 128

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    ++ V+QGV  MH LQPPL+HRDIKIENVL+S +  +KLCDFGSV G++R P
Sbjct: 129 LHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGSVCGIIRLP 188

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
            +S+E  Y+Q DILKNTTAQYRSPEM+++  G PI+EKSDIWALGI LYKLCYYTTPFE+
Sbjct: 189 RNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLCYYTTPFEK 248

Query: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
            G  AI+ GKF +P YP Y++ LK++IR +L  NP  RP++ QLL+ +  +Q+   P+ +
Sbjct: 249 GGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQNVPCPIND 308

Query: 309 FYVQRAMSSLQMDTTQPHRI 328
               +A SS  ++ T+ H++
Sbjct: 309 IQTVQAPSS-HLNLTELHQL 327

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  359 bits (922), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 176/321 (54%), Positives = 222/321 (69%), Gaps = 1/321 (0%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60
           M+Q     Y  GT+L V SH+V I  YLTSGGFAQVY+A I+    +    + CLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120
           P+K SLN LRAEVDAMK+L+NN+Y+VSYIDSHA +      SY V +LMEYC   GL+DF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180
           MN               M  V+QGV  MH LQPPL+HRDIKIENVL+S    +KLCDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240
           V GV+R P + +E  Y++ D+LKNTTAQYRSPEMV++  G PI+EKSDIWALGI LYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
           YYTTPFE+ G  AI+ G+F +  YP Y++ L+N+I  LL  NP QRPN+ QLL+++  +Q
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 HKSSPLPNFY-VQRAMSSLQM 320
           +   P+ +   VQR  + L +
Sbjct: 301 NAPYPIRDVQTVQRPSNHLNL 321

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  357 bits (916), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 169/328 (51%), Positives = 225/328 (68%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60
           M+Q     Y +GT L V SH+V I  YLT+GGFAQ+Y   I+         + CLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120
           P+K SLN+LRAEVDAMK+L+NN+ +VSYIDSHA +      +Y V LLMEYC   GL++F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180
           +N               M  VSQGV  MH LQPPL+HRDIKIENVLLS +  FKLCDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240
           VSG +R P++ +E   +QNDI++NTTAQYRSPEM++++ GFPI+EKSDIWALG+ LYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
           YYTTPFE+ G   I+  ++ +PA+P Y+D L+++I  LL+  P  RPNI  +++EL  ++
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 HKSSPLPNFYVQRAMSSLQMDTTQPHRI 328
           + S P+ NFY++  M+    +    H I
Sbjct: 301 NISCPIINFYLKPNMTDASNNIQHLHSI 328

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  353 bits (905), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 164/309 (53%), Positives = 218/309 (70%)

Query: 8   KYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLN 67
           KY+ GT + V SH V I  YLTSGG+AQ+Y+A+I    + L   +  LKRVIVP+K  LN
Sbjct: 8   KYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLN 67

Query: 68  ILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXX 127
            LRAEVDAMK LK++KYIVSYIDSHA + Q  + +Y V L+MEYCS  GL+DFMN     
Sbjct: 68  TLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQN 127

Query: 128 XXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRS 187
                        +SQGV  MH LQPPL+HRDIKIENVL+S D  +KLCDFGSVSG +R 
Sbjct: 128 RLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRP 187

Query: 188 PTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFE 247
           P + EE  Y+++DI+ +TTAQYR+PEM++L  GF +N+KSDIWALG+ LYKLCYYTTPFE
Sbjct: 188 PKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFE 247

Query: 248 EHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLP 307
           + G   I+ G   +P YP Y+D++K +I  +L+ NP+ RPNI Q+++ + ++ + + P+P
Sbjct: 248 QTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVNCPIP 307

Query: 308 NFYVQRAMS 316
           N +V   +S
Sbjct: 308 NIHVPTDIS 316

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  341 bits (875), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 164/317 (51%), Positives = 217/317 (68%), Gaps = 6/317 (1%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60
           M+Q     Y  G  ++V SH+  I  YLTSGGFAQ+Y+  I+ + +     + CLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120
           PNK  LN+LR EVDAMK+LKNN+++VSYIDS+A + +    SY V LLMEYC    LLDF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180
           MN               M  V QG+  MH+L PPL+HRDIKIENVL+SGDG FK+CDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKS---DIWALGILLY 237
           V G++R P + +E  Y+Q+D++KNTTAQYRSPEM++L  GFPI  K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 238 KLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
            L +YT  F E    AI+ G++ YPAYP Y+D LKN++RVLLS +P++RPNICQLLEE+ 
Sbjct: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297

Query: 298 RIQHKSSPLPNFYVQRA 314
           +IQ+   P+ NFY++R+
Sbjct: 298 KIQNIPCPIDNFYLERS 314

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%)

Query: 616 SNDPIILITNLEAKKSIKDRVQALMKSSSDNHVIISAHGYGKYT 659
           S  P+    + + K SI+ RV  L+K++ D+ V  +A GYGKYT
Sbjct: 622 SPSPLKYAVDRKMKASIEKRVLNLLKNAEDSPVKKTAAGYGKYT 665

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  258 bits (658), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 139/312 (44%), Positives = 182/312 (58%), Gaps = 9/312 (2%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYP--------ELTCLKRV 58
           +K   GT + V SH+V I  YL  GGFA +Y  +       L          +L CLKRV
Sbjct: 30  EKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRV 89

Query: 59  IVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLL 118
           +V ++  LN LR EV+ MK LKN+  IV Y DS+A+R ++    Y VLLLME C    LL
Sbjct: 90  LVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLL 149

Query: 119 DFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDF 178
           D+MN               M DV++ V  MH L  PL+HRDIKIENVL+  + NFKLCDF
Sbjct: 150 DYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDF 209

Query: 179 GSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYK 238
           GS S      T+ ++   L N+I  +TT QYR+PEM++L    PI+EKSDIWALGI LYK
Sbjct: 210 GSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYK 269

Query: 239 LCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFR 298
           L +YTTPFE  G  AI+  K+  PA   Y+  L N+I ++L+ NP  RPNI Q++ ++  
Sbjct: 270 LLFYTTPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQVCA 328

Query: 299 IQHKSSPLPNFY 310
           I     P  + Y
Sbjct: 329 IMKVDVPFEDKY 340

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  256 bits (653), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 135/313 (43%), Positives = 181/313 (57%), Gaps = 10/313 (3%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNL---------YPELTCLKR 57
           ++ K G+++ V +H V I  YL  GGFA +Y  +       L           E  CLKR
Sbjct: 27  ERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETACLKR 86

Query: 58  VIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGL 117
           V+V ++  LN +R EV  MK L     IV Y DSHA+R ++    + V+LLME C    L
Sbjct: 87  VLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPNNSL 146

Query: 118 LDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCD 177
           LD+MN               M DV++ +  MH L  PL+HRD+KIENVL+ GD NFKLCD
Sbjct: 147 LDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFKLCD 206

Query: 178 FGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLY 237
           FGS S  L    + +E   L N+I  +TT QYRSPEM++L    PI+EKSDIWALGI LY
Sbjct: 207 FGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLY 266

Query: 238 KLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           KL +YTTPFE  G  AI+  K+ +P    Y+  L N+I ++L+ NP  RPNI Q+++ L 
Sbjct: 267 KLLFYTTPFELTGQFAILHSKYEFPIN-NYSSKLINLIIIMLAENPNLRPNIYQIMDNLC 325

Query: 298 RIQHKSSPLPNFY 310
            I    +P+ + Y
Sbjct: 326 SIMKVENPIEDKY 338

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  258 bits (658), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 135/304 (44%), Positives = 180/304 (59%), Gaps = 13/304 (4%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYP-----------ELTCL 55
           +K+  G+ + V + +V I  YLT GGFAQ+Y  +   E+ N +            +L CL
Sbjct: 23  EKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFL-ENSNEFDSNNSNIPLKIGDLACL 81

Query: 56  KRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGA 115
           KRV+V ++  LN +R EV+ MK+LK    IV Y DS+A+R ++  + + VLLLME C   
Sbjct: 82  KRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNK 141

Query: 116 GLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKL 175
            LLDFMN               M DV+  V  MH L PPL+HRDIKIENVL+     FKL
Sbjct: 142 SLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKL 201

Query: 176 CDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGIL 235
            DFGS S    + ++ ++   L  DI  +TT QYRSPEM++L    PI+EKSDIWALGI 
Sbjct: 202 ADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIF 261

Query: 236 LYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEE 295
           LYKL +Y TPFE  G  AI+  K+ +P    Y+  L N+I ++LS NP  RPNI Q+L E
Sbjct: 262 LYKLLFYITPFEMTGQFAILHSKYDFPQT-NYSSRLINLIIIMLSENPNLRPNIYQVLHE 320

Query: 296 LFRI 299
           +  I
Sbjct: 321 ICSI 324

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  257 bits (656), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 185/317 (58%), Gaps = 31/317 (9%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARI--------------TSEHKNL-YPE 51
           +KYK+GT L V    + I  YLT GGFAQ+YT R                +  +NL   +
Sbjct: 38  EKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIGD 97

Query: 52  LTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSED---------- 101
           + CLKRV+VP++  L+ +R EVD MK L N   IV Y DS+A++++++ +          
Sbjct: 98  VACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNNNDNN 157

Query: 102 -----SYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLL 156
                 + +LLLMEYC    LLDFMN               MTD++  V  MH L  PL+
Sbjct: 158 KNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQPLI 217

Query: 157 HRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVN 216
           HRDIKIENVL+  + NFKL DFGS + +    T+ ++   L  DI  NTT QYRSPEM++
Sbjct: 218 HRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSPEMID 277

Query: 217 LALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIR 276
           L    PI+EKSDIWALG+LLYKL +YTTPFE  G  AI+  K+ +PA   Y+    N+I 
Sbjct: 278 LYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPAN-NYSSKFINLII 336

Query: 277 VLLSTNPIQRPNICQLL 293
           ++L+ NP  RPNI Q+L
Sbjct: 337 IMLAENPNLRPNIFQVL 353

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  254 bits (650), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 142/324 (43%), Positives = 186/324 (57%), Gaps = 22/324 (6%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYP--------------EL 52
           +KY+ G  + V SH V I  Y+  GGFAQ+Y+ +   E+ N +               +L
Sbjct: 16  EKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFL-EYANEFDREESPGSKDQLQVGDL 74

Query: 53  TCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDS------YVVL 106
            CLKRVIV ++  LN LR EV+ MK L     IV Y DS+A+RL+N  DS      + VL
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVL 134

Query: 107 LLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVL 166
           LLME C    LLD+MN               M DVS  +  MH L+ PL+HRDIKIENVL
Sbjct: 135 LLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVL 194

Query: 167 LSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEK 226
           +     FKLCDFGS S       +  +  YL  +I  +TT QYRSPEM++L    PI+EK
Sbjct: 195 VDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 254

Query: 227 SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQR 286
           SDIWALGI LYKL ++TTPFE  G  AI+  KF +P    Y+  L N+I V+LS NP  R
Sbjct: 255 SDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPNLR 313

Query: 287 PNICQLLEELFRIQHKSSPLPNFY 310
           PNI Q+L ++ +++    P+ + Y
Sbjct: 314 PNIYQVLHQICQLKQVPIPIADKY 337

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  255 bits (651), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 187/316 (59%), Gaps = 13/316 (4%)

Query: 6   EDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPEL-----------TC 54
           E+KY  G  + V +H V I +YL  GGFAQ+Y  +   E+ N +  L            C
Sbjct: 17  EEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFV-EYLNEFESLGSKSAITVGDIAC 75

Query: 55  LKRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSG 114
           LKRVIV ++  LN +R EV+ MK LK++  IV Y DS+A+R  + +  + VLLLME C  
Sbjct: 76  LKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLMELCPN 135

Query: 115 AGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFK 174
             LLD+MN               M DVS G+ +MH L  PL+HRDIKIENVL+  + NFK
Sbjct: 136 KSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFK 195

Query: 175 LCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGI 234
           LCD GS S       S+++   +  +I  +TT QYR+PEM++L    PINEKSDIWALGI
Sbjct: 196 LCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGI 255

Query: 235 LLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLE 294
            LYKL +YTTPFE  G  AI+  K+ +P   +Y+  + N+I ++L+ NP  RPNI Q++ 
Sbjct: 256 FLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIFQVVY 314

Query: 295 ELFRIQHKSSPLPNFY 310
            +  I +   P+ + Y
Sbjct: 315 HICSIMNLPVPIEDRY 330

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  253 bits (646), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 135/313 (43%), Positives = 179/313 (57%), Gaps = 10/313 (3%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNL---------YPELTCLKR 57
           ++ K G+++ V +H V I  YL  GGFA +Y  R       L           +L CLKR
Sbjct: 69  EQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKR 128

Query: 58  VIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGL 117
           V+V ++  LN +R EV  MK L     IV Y DSHA+R ++    + V LLME C    L
Sbjct: 129 VLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSL 188

Query: 118 LDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCD 177
           LD+MN               M DV++ +  MH L  PL+HRD+KIENVL+  + NFKLCD
Sbjct: 189 LDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCD 248

Query: 178 FGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLY 237
           FGS S       + +E   L N+I  +TT QYRSPEM++L    PINEKSDIWALGI LY
Sbjct: 249 FGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 308

Query: 238 KLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           KL +YTTPFE  G  AI+  K+ +P    Y+  L N+I ++L+ NP  RPNI Q+++ L 
Sbjct: 309 KLLFYTTPFELTGQFAILHSKYEFPVN-NYSSKLINLIIIMLAENPNLRPNIYQVMDNLC 367

Query: 298 RIQHKSSPLPNFY 310
            I    +PL + Y
Sbjct: 368 SILKVKNPLEDKY 380

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  253 bits (647), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 133/292 (45%), Positives = 177/292 (60%), Gaps = 9/292 (3%)

Query: 10  KKGTKLQVASHEVIIENYLTSGGFAQVY-------TARITSEHKNLYP-ELTCLKRVIVP 61
           + G+ + V  H+V +  YL  GGFA +Y       T  +  + + L P +  CLKRV V 
Sbjct: 30  QAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVS 89

Query: 62  NKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFM 121
           ++  LN LR EV+ MK L+N   IV Y DS+A+RL + +  Y VLLLME C    LLD+M
Sbjct: 90  DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM 149

Query: 122 NXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSV 181
           N               M D++ G+ HMH  + PL+HRDIKIENVL+  D NFKLCDFGS 
Sbjct: 150 NQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGST 209

Query: 182 SGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCY 241
           S  L +  S +E   L N+I  +TT QYRSPEM++L    PINEKSDIWALGI LYKL +
Sbjct: 210 SPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 269

Query: 242 YTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLL 293
           YTTPFE  G  AI+  K+  P    ++  L N++ ++L+ NP  RPN+ Q++
Sbjct: 270 YTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVM 320

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  253 bits (647), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 184/317 (58%), Gaps = 18/317 (5%)

Query: 6   EDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITS-----EHKN-------LYP-EL 52
           E+K+  G  + V SH V + +YL  GGFAQ+Y  +        E KN       L P   
Sbjct: 93  EEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSP 152

Query: 53  TCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQ----NSEDSYVVLLL 108
            CLKRV+V ++  LN +R+EV+ MK L+    IV Y DS+A+RL+    N    + VLLL
Sbjct: 153 ACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLL 212

Query: 109 MEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLS 168
           ME C    LLD+MN               M D++  V  MH L  PL+HRDIKIENVL+ 
Sbjct: 213 MELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVD 272

Query: 169 GDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSD 228
            + NFKLCDFGS S    + TS ++   L  D+  +TT QYRSPEM++L    PINEKSD
Sbjct: 273 ANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSD 332

Query: 229 IWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPN 288
           IWALG+ LYKL ++TTPFE  G  A++  KF +P    Y+  L N+I V+L+ NP  RPN
Sbjct: 333 IWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPSLRPN 391

Query: 289 ICQLLEELFRIQHKSSP 305
           I Q+L  L  + ++  P
Sbjct: 392 IYQVLYYLSEVTNREVP 408

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  253 bits (645), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 135/321 (42%), Positives = 189/321 (58%), Gaps = 18/321 (5%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTAR---ITSEHKN--------------LY 49
           +K++KG  L V +H+V I +YLT GGFAQ+Y  +   + +E  N                
Sbjct: 29  EKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLKL 88

Query: 50  PELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLM 109
            ++ CLKRV+V ++  LN +R EV+ MK L+    IV Y DS+A R  N    Y VLLLM
Sbjct: 89  GDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLLM 148

Query: 110 EYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSG 169
           E CS   LL++MN               M DV+ GV  MH L+ PL+HRDIKIENVL+  
Sbjct: 149 ELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVDS 208

Query: 170 DGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDI 229
           + NFKLCDFGS +      T+ ++   L  ++  +TT QYRSPEM++L    PINEKSDI
Sbjct: 209 NNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSDI 268

Query: 230 WALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNI 289
           WALG+ LYKL +YTTPFE  G  A++  KF  PA  +Y+  + N++ ++LS N   RPNI
Sbjct: 269 WALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPAN-KYSSKIINLVIIMLSENLNLRPNI 327

Query: 290 CQLLEELFRIQHKSSPLPNFY 310
            Q++  + ++    +P+ + Y
Sbjct: 328 YQVMHYICQLIQVDTPILDIY 348

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  254 bits (650), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 136/316 (43%), Positives = 183/316 (57%), Gaps = 11/316 (3%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITS-----EHKNLYPEL-----TCLK 56
           ++Y  GT++ V +H+V I  Y+  GGFAQ+Y  +        E+  + P+L      CLK
Sbjct: 20  ERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLK 79

Query: 57  RVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAG 116
           RV+V ++  LN +R EV+ MK L+    IV Y DS+A+R  N    + VLLLME C    
Sbjct: 80  RVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKS 139

Query: 117 LLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLC 176
           LLD+MN               M DV+  V  MH L  PLLHRDIKIENVL+    NFKLC
Sbjct: 140 LLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLC 199

Query: 177 DFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILL 236
           DFGS S      T+ ++   L  +I  +TT QYRSPEM++L    PI+EKSDIWALGI L
Sbjct: 200 DFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFL 259

Query: 237 YKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEEL 296
           YKL ++TTPFE  G  AI+  K+ +P    Y+  L N+I ++L+ NP  RPNI Q+L  +
Sbjct: 260 YKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQVLHNI 318

Query: 297 FRIQHKSSPLPNFYVQ 312
             I     P+ + Y +
Sbjct: 319 CSISGMKVPIEDQYAE 334

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  252 bits (643), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 178/311 (57%), Gaps = 22/311 (7%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARI------------TSEHKN------- 47
           +K+  G  + V  H+V I  YL  GGFAQ+Y+               ++E  N       
Sbjct: 17  EKFNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQF 76

Query: 48  -LYP-ELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVV 105
            L P  L CLKRV+VP++  LN LR EV+ M+ LK    IV Y DS+A+R  +    + V
Sbjct: 77  KLEPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEV 136

Query: 106 LLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENV 165
           LLLME C    LLD+MN               M DV+ G+  MH LQ PL+HRDIKIENV
Sbjct: 137 LLLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENV 196

Query: 166 LLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINE 225
           L+    NFKLCDFGS S      TS +E   L  +I  +TT QYRSPEM++L    PI+E
Sbjct: 197 LVDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDE 256

Query: 226 KSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQ 285
           KSDIWALG+ LYKL +YTTPFE  G  AI+  K+  P    Y+  L N+I ++L+ NP  
Sbjct: 257 KSDIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPNL 315

Query: 286 RPNICQLLEEL 296
           RPNI Q++ ++
Sbjct: 316 RPNIYQVMHQV 326

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  251 bits (642), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 140/314 (44%), Positives = 182/314 (57%), Gaps = 9/314 (2%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVY-------TARITSEHKNLY-PELTCLKRV 58
           +K   G+ L V  H V I  YL  GGFA +Y       T  +   H  L   ++ CLKRV
Sbjct: 26  EKLTAGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRV 85

Query: 59  IVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLL 118
            V ++  LN LR EV+ MK LK    +V Y DS+A+R  +    + VLLLME CS   LL
Sbjct: 86  QVNDENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLL 145

Query: 119 DFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDF 178
           D+MN               M D+++G+ HMH L+ PL+HRDIKIENVL+    NFKLCDF
Sbjct: 146 DYMNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDF 205

Query: 179 GSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYK 238
           GS S  L + ++ +E   L N+I  +TT QYRSPEM++L     INEKSDIWALGI LYK
Sbjct: 206 GSTSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYK 265

Query: 239 LCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFR 298
           L +YTTPFE  G  AI+  K+  P    ++  L N+I V+L+ NP  RPNI Q+L  +  
Sbjct: 266 LLFYTTPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHICS 324

Query: 299 IQHKSSPLPNFYVQ 312
           I     P+ + Y Q
Sbjct: 325 IMECDVPIEDHYGQ 338

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  254 bits (649), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 137/330 (41%), Positives = 188/330 (56%), Gaps = 25/330 (7%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARI-----------TSEHKNL------- 48
           +K+  GT++ V SH+V I  Y+  GGFAQ+Y  +            T E+ +L       
Sbjct: 22  EKFPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAP 81

Query: 49  ------YPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDS 102
                   ++ CLKRV+V ++  LN +R EV+ MK LK    +V Y DS+A+R  N    
Sbjct: 82  NPMILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASG 141

Query: 103 YVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKI 162
           + VLLLME C    LLD+MN               M D++  V HMH L+ PLLHRDIKI
Sbjct: 142 FEVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKI 201

Query: 163 ENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFP 222
           ENVL+    NFKLCDFGS S  L   T+ ++   L  +I  +TT QYRSPEM++L    P
Sbjct: 202 ENVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP 261

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTN 282
           I+EKSDIWALGI LYKL ++ TPFE  G  AI+  K+ +P    Y+  L N+I ++L+ N
Sbjct: 262 IDEKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAEN 320

Query: 283 PIQRPNICQLLEELFRIQHKSSPLPNFYVQ 312
           P  RPNI Q+L+ +  + +   P+ + Y Q
Sbjct: 321 PNLRPNIYQVLDNICSMMNVEVPIEDIYEQ 350

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  250 bits (638), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 135/313 (43%), Positives = 179/313 (57%), Gaps = 10/313 (3%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYP---------ELTCLKR 57
           D Y  GT + V  H+V +  YL  GGFA++Y  +       + P         +  CLKR
Sbjct: 27  DSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKR 86

Query: 58  VIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGL 117
           V+V +   LN +R EV+ M+ LK    +V Y DS+A+R  +    Y VLLLME CS   L
Sbjct: 87  VLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNSL 146

Query: 118 LDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCD 177
           LD+MN               M DV+  V  MH L  PL+HRDIKIENVL+    NFKLCD
Sbjct: 147 LDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLCD 206

Query: 178 FGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLY 237
           FGS S  L   +S ++   L  +I  +TT QYRSPEM++L    P+NEKSDIWALG+ LY
Sbjct: 207 FGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFLY 266

Query: 238 KLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           KL +YTTPFE  G  AI+  K+ +P    Y+  L N+I V+L+ NP  RPNI Q+L ++ 
Sbjct: 267 KLMFYTTPFERTGQFAILHSKYEFPLN-NYSSKLINLIIVMLAENPNLRPNIYQVLNQIC 325

Query: 298 RIQHKSSPLPNFY 310
            I    +P+ + Y
Sbjct: 326 YISGIKNPMDDAY 338

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  252 bits (644), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 135/326 (41%), Positives = 191/326 (58%), Gaps = 18/326 (5%)

Query: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYP---------- 50
           +S +  +K+  G  + V SH V I  YLT GGFAQ+Y  ++T E+ N +           
Sbjct: 21  ISNLAIEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLT-EYLNEFDAIDIQNQRQQ 79

Query: 51  ------ELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYV 104
                 +L CLKRV+V ++  L+ ++ EV+ MK L+    +V Y DS+A R + +   + 
Sbjct: 80  QELKIGDLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFE 139

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V LLMEYC    LLD+MN               M D++ GV  +H L  PL+HRDIKIEN
Sbjct: 140 VFLLMEYCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIEN 199

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPIN 224
           VL+  +  FKLCDFGS +      T++++   L +DI  +TT QYRSPEM++L    P+N
Sbjct: 200 VLVDHNNRFKLCDFGSTNICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVN 259

Query: 225 EKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPI 284
           EK+DIWALG+ LYKL +YTTPFE  G  AI+  K+  P    Y++ L N+I V+L+ NP 
Sbjct: 260 EKADIWALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQS-HYSERLLNLIVVMLAENPN 318

Query: 285 QRPNICQLLEELFRIQHKSSPLPNFY 310
            RPNI Q+L E+  I +   P+P+ Y
Sbjct: 319 LRPNIYQVLSEICSILNVEVPIPDIY 344

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  249 bits (635), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 184/313 (58%), Gaps = 10/313 (3%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTAR---ITSEHKN-----LYP-ELTCLKR 57
           D Y  GT + V + +V I +++  GGFAQ+Y+ +      E  N     L P ++ CLKR
Sbjct: 20  DGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGDIACLKR 79

Query: 58  VIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGL 117
           V+VP++  L+ +R EV+ MK L+  K I+ Y DS+A+R  + +  Y VLLLME C    L
Sbjct: 80  VLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMELCPNNSL 139

Query: 118 LDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCD 177
           LD+MN               M D +  +  MH L  PL+HRDIKIENVL+    NFKLCD
Sbjct: 140 LDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQNNFKLCD 199

Query: 178 FGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLY 237
           FGS S      T+ ++   L  +I  NTT QYRSPEM++L    PINEKSDIWALGI LY
Sbjct: 200 FGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 259

Query: 238 KLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           KL ++ TPFE  G  +I+  K+ +PA  +Y+  L N+I ++L+ NP  RPNI Q++  + 
Sbjct: 260 KLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQVMHHIC 318

Query: 298 RIQHKSSPLPNFY 310
            +     P+ + Y
Sbjct: 319 SVIGCEVPIEDKY 331

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  248 bits (633), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 186/318 (58%), Gaps = 12/318 (3%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYP----------ELTCLK 56
           ++Y  G  + V +H+V I NYL  GGFAQ+Y  +   E+ N +           ++ CLK
Sbjct: 20  ERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFL-EYLNEFDNTASLPLKIGDVACLK 78

Query: 57  RVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAG 116
           RV+V ++  LN +R EV+ MK LK    +V Y DS+A+R ++    + VLLLME C    
Sbjct: 79  RVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMELCPNKS 138

Query: 117 LLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLC 176
           LLD+MN               M DV+  +  MH L  PL+HRDIKIENVL+  + NFKL 
Sbjct: 139 LLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAENNFKLA 198

Query: 177 DFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILL 236
           DFGS S      T+ ++   L  +I  +TT QYRSPEM++L    PINEKSDIWALGI L
Sbjct: 199 DFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 258

Query: 237 YKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEEL 296
           YKL ++TTPFE  G  AI+  K+ +P   +Y+  L N+I ++L+ NP  RPNI Q+L  +
Sbjct: 259 YKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQVLYHI 317

Query: 297 FRIQHKSSPLPNFYVQRA 314
             I +   P+ + Y + A
Sbjct: 318 CDILNAEVPIEDKYSEGA 335

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  247 bits (631), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 134/316 (42%), Positives = 184/316 (58%), Gaps = 12/316 (3%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYP----------ELTCLK 56
           ++Y  G  + V +H+V I NYL  GGFAQ+Y  +   E+ N +           +L CLK
Sbjct: 20  ERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFL-EYLNEFDNAASVPLKIGDLACLK 78

Query: 57  RVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAG 116
           RV+V ++  LN +R EV+ MK LK    +V Y DS+A+R ++    + VLLLME C    
Sbjct: 79  RVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMELCPNKS 138

Query: 117 LLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLC 176
           LLD+MN               M DV+  +  MH L  PL+HRDIKIENVL+    +FKL 
Sbjct: 139 LLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKDSFKLA 198

Query: 177 DFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILL 236
           DFGS S      T+ ++   L  +I  +TT QYRSPEM++L    PINEKSDIWALGI L
Sbjct: 199 DFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 258

Query: 237 YKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEEL 296
           YKL ++TTPFE  G  AI+  K+ +P   +Y+  L N+I ++L+ NP  RPNI Q+L  L
Sbjct: 259 YKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQVLCHL 317

Query: 297 FRIQHKSSPLPNFYVQ 312
             I +   P+ + Y +
Sbjct: 318 CDILNVEVPIEDKYAE 333

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  247 bits (630), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 180/316 (56%), Gaps = 15/316 (4%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSE-------------HKNLYP-ELTC 54
           Y  GT + V SH+V +  Y+  GGFAQ+YT +                  K L P ++ C
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 55  LKRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSG 114
           LKRV+V +   LN +R EV+ M+ L+    +V Y DS+A+   +S   Y VLLLME+C  
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 115 AGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFK 174
             LLD+MN               M D + G+  +H L+ PL+HRDIKIENVL+  + NFK
Sbjct: 219 NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 175 LCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGI 234
           LCDFGS S      T+  +      +I  NTT QYRSPEM++L    PI+EKSDIWALG+
Sbjct: 279 LCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGV 338

Query: 235 LLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLE 294
            LYKL ++TTPFE  G  AI+  K+ +P    Y+  L N+I ++L+ NP  RPNI Q+L+
Sbjct: 339 FLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVLQ 397

Query: 295 ELFRIQHKSSPLPNFY 310
            L  I     PL + Y
Sbjct: 398 YLCSINGWKVPLNDKY 413

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  247 bits (631), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 133/318 (41%), Positives = 185/318 (58%), Gaps = 12/318 (3%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYP----------ELTCLK 56
           +++  G  + V +H+V + NYL  GGFAQ+Y  +   E+ N +           ++ CLK
Sbjct: 20  ERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFV-EYLNEFDNAASVPLKIGDVACLK 78

Query: 57  RVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAG 116
           RV+V ++  LN +R EV+ MK LK    +V Y DS+A+R ++    + VLLLME C    
Sbjct: 79  RVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMELCPNKS 138

Query: 117 LLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLC 176
           LLD+MN               M DV   +  MH L  PL+HRDIKIENVL+  + NFKL 
Sbjct: 139 LLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANNNFKLA 198

Query: 177 DFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILL 236
           DFGS S      T+ ++   L  +I  +TT QYRSPEM++L    PINEKSDIWALGI L
Sbjct: 199 DFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 258

Query: 237 YKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEEL 296
           YKL ++TTPFE  G  AI+  K+ +P   +Y+  L N+I ++L+ NP  RPNI Q+L  L
Sbjct: 259 YKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQVLYHL 317

Query: 297 FRIQHKSSPLPNFYVQRA 314
             I +   P+ + Y + A
Sbjct: 318 CEILNIEVPIEDKYTEGA 335

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  243 bits (620), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 135/308 (43%), Positives = 179/308 (58%), Gaps = 11/308 (3%)

Query: 13  TKLQVASHEVIIENYLTSGGFAQVYTAR---ITSE------HKNLYP-ELTCLKRVIVPN 62
           T++ V +H   I  +L  GGFA +Y  +   +T+E       K L   ++ CLKRVIVP+
Sbjct: 33  TQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPD 92

Query: 63  KQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMN 122
           +  LN LR EV+ MK L+ +  IV Y DS+A+R  +    + +LLLME C    LLD+MN
Sbjct: 93  ENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMN 152

Query: 123 XXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVS 182
                          M DVS  +  MH L  PL+HRDIKIENVL+  D NFKLCDFGS S
Sbjct: 153 NKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTS 212

Query: 183 GVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYY 242
                 ++ ++   L N+I  +TT QYRSPEM++L    PINEKSDIWALGI LYKL +Y
Sbjct: 213 MCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 272

Query: 243 TTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHK 302
           TTPFE  G  AI+  K+  P    Y+  L N+I ++L+ NP  RPNI Q++  +  I   
Sbjct: 273 TTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILKC 331

Query: 303 SSPLPNFY 310
             P  + Y
Sbjct: 332 DVPFTDKY 339

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  246 bits (627), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 130/296 (43%), Positives = 173/296 (58%), Gaps = 10/296 (3%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITS-----EHKNLYP----ELTCLKR 57
           +++  G  + V +H V + NYL  GGFAQ+Y  +        E+K+  P    ++ CLKR
Sbjct: 20  ERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVACLKR 79

Query: 58  VIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGL 117
           V+V ++  L+ +R EV+ MK L   + IV Y DS+A R  N    + VLLLME C    L
Sbjct: 80  VLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPNKSL 139

Query: 118 LDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCD 177
           LD+MN               M DVS  V  MH L+ PL+HRDIKIENVL+    +FKLCD
Sbjct: 140 LDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFKLCD 199

Query: 178 FGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLY 237
           FGS S      T+ +E   L  +I  +TT QYR PEM++L    PINEKSDIWALGI LY
Sbjct: 200 FGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGIFLY 259

Query: 238 KLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLL 293
           KL ++ TPFE  G  AI+  K+ +P    Y+  L N+I ++L+ NP  RPNI Q+L
Sbjct: 260 KLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVL 314

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  246 bits (628), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 133/318 (41%), Positives = 184/318 (57%), Gaps = 12/318 (3%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYP----------ELTCLK 56
           ++Y  G  + V +H+V + NYL  GGFAQ+Y  +   E+ N +           ++ CLK
Sbjct: 20  ERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFL-EYLNEFDNTASVPLKIGDVACLK 78

Query: 57  RVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAG 116
           RV+V ++  LN +R EV+ MK LK    IV Y DS+A+R ++    + VLLLME C    
Sbjct: 79  RVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKS 138

Query: 117 LLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLC 176
           LLD+MN               M DV+  +  MH L   L+HRDIKIENVL+    NFKL 
Sbjct: 139 LLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLA 198

Query: 177 DFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILL 236
           DFGS S      T+ ++   L  +I  +TT QYRSPEM++L    PINEKSDIWALG+ L
Sbjct: 199 DFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFL 258

Query: 237 YKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEEL 296
           YKL ++TTPFE  G  AI+  K+ +P   +Y+  L N+I ++L+ NP  RPNI Q+L  L
Sbjct: 259 YKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRPNIYQVLYHL 317

Query: 297 FRIQHKSSPLPNFYVQRA 314
             I +   P+ + Y + A
Sbjct: 318 CEILNVEVPIEDKYAEGA 335

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  246 bits (627), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 134/314 (42%), Positives = 181/314 (57%), Gaps = 14/314 (4%)

Query: 5   FEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARIT---SEHKNLYPEL--------T 53
           F +KYK G  + V +H+V IE+YL  GGFAQ+Y  +     +E +N   +L         
Sbjct: 31  FIEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIA 90

Query: 54  CLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCS 113
           CLKRV+V ++  LN +R EV+ MK+L+    IV Y DS+A R  +  + Y +LLLME C 
Sbjct: 91  CLKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCP 150

Query: 114 GAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNF 173
              LLD+MN               M D +  V  MH L  PL+H+DIK+EN+L+  + NF
Sbjct: 151 NNSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNF 210

Query: 174 KLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALG 233
           KLCDFGS S      TS  +   L  +I  +TT QYRSPEM++L    PINE SDIWALG
Sbjct: 211 KLCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALG 270

Query: 234 ILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLL 293
           + LYKL ++ TPFE  G  +I+  KF  P    Y   L N+I ++LS N   RPNI Q++
Sbjct: 271 VFLYKLLFFITPFERTGQFSILHAKFDIPVN-NYHPKLINLIIIMLSENLNLRPNIYQVM 329

Query: 294 EELFRIQHKSSPLP 307
            E+  I +  +PLP
Sbjct: 330 YEICSITN--TPLP 341

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  240 bits (613), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 135/313 (43%), Positives = 178/313 (56%), Gaps = 10/313 (3%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKN--------LYP-ELTCLKR 57
           D Y  G  ++V  H+V I  YL  GGFA++Y A+     K         L P +L CLKR
Sbjct: 97  DTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLKR 156

Query: 58  VIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGL 117
           V+V +   LN +R EV  MK L     IV   DS+A+R  +    Y VLLLME CS   L
Sbjct: 157 VLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKSL 216

Query: 118 LDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCD 177
           LD+MN               M DV+  V  MH L  PL+HRDIKIENVL+    NFKLCD
Sbjct: 217 LDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLCD 276

Query: 178 FGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLY 237
           FGS S  +   T+  +   L  ++  +TT QYRSPEM+++     INEKSDIWALGI LY
Sbjct: 277 FGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFLY 336

Query: 238 KLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           KL +Y TPFE  G  AI+  K+ +P +  Y+  L N+I ++L+ NP  RPNI Q+L  + 
Sbjct: 337 KLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYIC 395

Query: 298 RIQHKSSPLPNFY 310
           +I +  +P+ + Y
Sbjct: 396 KIINIKTPIDDIY 408

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 97.4 bits (241), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 81/151 (53%), Gaps = 7/151 (4%)

Query: 157 HRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVN 216
           H+DIK  N++ S DG   +CD GS S      +S  + V  Q    ++ T  +RSPE++N
Sbjct: 212 HKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLVEFQEWCNEHCTLPFRSPELLN 271

Query: 217 LALGFPINEKSDIWALGILLYKLCYYTTPFEEHG-------SRAIMEGKFTYPAYPQYTD 269
           + L   I+EK DIW+LG  LY +C+  +PFE          + AI  GKF+ P    Y+ 
Sbjct: 272 VTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGASMTYAIATGKFSIPPNTNYSP 331

Query: 270 SLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
            L  II+  +  +  +RP+I +LL  L  +Q
Sbjct: 332 ELIKIIKDCIEVDSKKRPSIDELLARLQDLQ 362

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 98.6 bits (244), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 136/290 (46%), Gaps = 32/290 (11%)

Query: 24  IENYLTSGGFAQVYTARITSEHKNLYPELTCLKRV-IVPNKQSLNILRAEVDAMKILKNN 82
           I++ +  G F  VY A        L  E+  +K V +  + + + ++  E+  +  LK+ 
Sbjct: 23  IQDCVGRGNFGDVYKA-----IDKLTGEIVAIKVVNLESSDEDIELIAQEIFFLAELKS- 76

Query: 83  KYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVS 142
            YI +YI +    +        + ++MEYC G    D +                  +V 
Sbjct: 77  PYITNYITTMLEDVS-------MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVL 129

Query: 143 QGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDIL 202
           +G+ ++H+ +   +HRD+K  NVLL+ DG  KL DFG VSG LRS      FV       
Sbjct: 130 RGLQYLHEQRK--IHRDVKAANVLLTDDGLVKLADFG-VSGQLRSTAKRNTFV------- 179

Query: 203 KNTTAQYRSPEMV-NLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG---K 258
              T  + +PE++ N + G+  NEK+DIW+LGI +Y+L     P+ ++ +  +M     K
Sbjct: 180 --GTPYWMAPEIISNSSHGY--NEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKK 235

Query: 259 FTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
                   ++D+ K  I   L  +P +RP   +LL++ F    K + L N
Sbjct: 236 NLQDCMVSFSDAAKLFISACLIKDPDERPTATELLQQPFVKNIKITDLRN 285

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 136/283 (48%), Gaps = 34/283 (12%)

Query: 24  IENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPN--KQSLNILRAEVDAMKILKN 81
           I+  +  G F  V+ A       N+  E+  +K + + +  +++  I++ E+  M +LK+
Sbjct: 18  IDKCVGKGNFGDVFKA-----MNNVTKEVVAIKIINLDDSEEETFEIIK-EMRLMSLLKS 71

Query: 82  NKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDV 141
             YI  YI +         + Y++ ++MEYC G    D +                +  V
Sbjct: 72  -PYIARYITT-------INEDYLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSV 123

Query: 142 SQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDI 201
             G+ ++H      +HRDIK  N+LL+  G  K+ DFG VS  +RS   ++ FV      
Sbjct: 124 LLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFG-VSAEMRSTMKAKTFV------ 174

Query: 202 LKNTTAQYRSPEMV-NLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG--K 258
               T  + +PE+V N  +G+  NEKSDIW+LGI  Y+L     P  ++ +  +M    K
Sbjct: 175 ---GTPYWMAPEVVMNEGMGY--NEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPK 229

Query: 259 FTYPA-YPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
              P  +  YT+ +K+ I   L  +P +RP+  +LLE  F ++
Sbjct: 230 RKPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLEHDFMVK 272

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 84/333 (25%), Positives = 145/333 (43%), Gaps = 61/333 (18%)

Query: 13  TKLQVASHEVIIENYLTSGGFAQVYTARITS-----EHKNLYPELTCLKRVIVPNKQSLN 67
           T ++V      I+  L  GG + VY  ++       E+  + PE+  LK++I P+ +S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESIS 80

Query: 68  ILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXX 127
               E++  K  ++  Y++  IDS   + +N   S ++ +++ Y S   L D +N     
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVTQEKNG--SKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 128 XX--XXXXXXXXMTDVSQGVYHMHQ-------LQP----------------------PL- 155
                       M  V++G+  +H        + P                      PL 
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 156 --------------LHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDI 201
                          HRDI   N+L S +G   + D GS S       S  +   LQ  +
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWV 257

Query: 202 LKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE----HGSR---AI 254
             N T  Y +PE++NL L   ++ K DIW++G   Y L +  +PFE     HG+    AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 MEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRP 287
             GK+++P   +++++L N+I+  +  +PIQRP
Sbjct: 318 NTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 135/306 (44%), Gaps = 58/306 (18%)

Query: 50  PELTCLKRVIVP--NKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLL 107
           PEL  LKR+  P  N +S++    EVD  K  ++  YI++ +DS    +Q  + S  + +
Sbjct: 68  PELYALKRIRCPFGNIESISAAMKEVDNYKRFQS-PYIITLVDSQV--VQEKDGSKTLCI 124

Query: 108 LMEYCSGAGLLDFMN--XXXXXXXXXXXXXXXMTDVSQGVYHMHQLQP------------ 153
           L+ Y     L D +N                 M  +++G+  +H                
Sbjct: 125 LLPYFPLGSLQDMVNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDT 184

Query: 154 ----------------PL----------------LHRDIKIENVLLSGDGNFKLCDFGSV 181
                           PL                +HRDI++ N+L S +G   + D GS 
Sbjct: 185 VSLSYSDEAAFLLDDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSC 244

Query: 182 SGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCY 241
                + ++  +   LQ+ +  N +  Y +PE++N+ L   I+ K+DIW++G   Y + +
Sbjct: 245 CKADITVSTKHQLNELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLF 304

Query: 242 YTTPFEEH----GSR---AIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLE 294
             +PFE      G+    AI  GK+T+P   +Y++SL  +I+  L  +P  RP+I +LL+
Sbjct: 305 GMSPFERELQVSGASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLD 364

Query: 295 ELFRIQ 300
            L  +Q
Sbjct: 365 TLQDLQ 370

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 94.4 bits (233), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 84/339 (24%), Positives = 144/339 (42%), Gaps = 61/339 (17%)

Query: 13  TKLQVASHEVIIENYLTSGGFAQVYTARITS-----EHKNLYPELTCLKRVIVPNKQSLN 67
           T ++V      I+  L  GG + VY  ++       E+    PEL  LK++I PN +S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  ILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXX 127
               E++  K  ++  Y++  IDS    +Q  + S  + +++ + +   L D +N     
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQV--MQEKDGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 128 XX--XXXXXXXXMTDVSQGVYHMHQ---------------------------------LQ 152
                       M  V +G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 153 PPLL-----------HRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDI 201
             +L           HRDI   N+L S DG   + D GS S    +  +  +   LQ  +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 LKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE----HGSR---AI 254
             N T  Y +PE++ L L   ++ K DIW+LG   Y L +  +PFE     HG+    AI
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 MEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLL 293
             GK+++P   ++++ L ++I+  +  +P+QRP   QLL
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 95.5 bits (236), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 81/282 (28%), Positives = 131/282 (46%), Gaps = 38/282 (13%)

Query: 24  IENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPN-KQSLNILRAEVDAMKILKNN 82
           I++ +  G F  VY A   +E K     +  +K V + N  + + +L  E+  +  LK+ 
Sbjct: 17  IQDCVGRGNFGDVYKAIDKNESK-----VVAIKIVNLENTDEDIELLTQEIFFLSELKS- 70

Query: 83  KYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVS 142
            +I +YI +       +ED   + ++MEYC G    D +                + D  
Sbjct: 71  PFITNYITTL------TED-VTMWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTV 123

Query: 143 QGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDIL 202
           +G+ ++H  +   +HRDIK  N+LL+  G  KL DFG VSG +R+      FV       
Sbjct: 124 KGLKYLHDQKK--IHRDIKAANILLTDCGKVKLGDFG-VSGQIRATMKRGTFV------- 173

Query: 203 KNTTAQYRSPEMVNLAL-GFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTY 261
              T  + +PE++N    G+  NEK+DIW+LGI  Y+L     P  ++    +M      
Sbjct: 174 --GTPYWMAPEVINKQCKGY--NEKADIWSLGITAYELLKGVPPLSKYDPFKVM---LNI 226

Query: 262 PA------YPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           P       + QY++  K  + + L  +P QRP+I  LLE  F
Sbjct: 227 PKRKPPKLHGQYSEKAKYFVSLCLIKDPKQRPSIEALLETDF 268

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 81/322 (25%), Positives = 139/322 (43%), Gaps = 61/322 (18%)

Query: 24  IENYLTSGGFAQVYTARITS-----EHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKI 78
           I+  L  GG + VY  +++      ++    PEL  LK++I P+ +S++    E++  K 
Sbjct: 32  IQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNGMREIENYKR 91

Query: 79  LKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMN--XXXXXXXXXXXXXX 136
            ++  Y++  IDS    +Q  + S  + +++ Y S   L D +N                
Sbjct: 92  FQS-PYVIKSIDSQV--MQEKDGSKTIYIVLPYYSLGSLQDSINRRLLEGTFVSEAECVR 148

Query: 137 XMTDVSQGVYHMHQ---------------------------------LQPPLL------- 156
            M  V++G+  +H                                  L+  +L       
Sbjct: 149 IMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMDMLSSNSAGS 208

Query: 157 ----HRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSP 212
               HRDI   N+L S DG   + D GS S    +  +  +   LQ  +  N T  Y  P
Sbjct: 209 IAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVNDNCTLPYTPP 268

Query: 213 EMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE----HGSR---AIMEGKFTYPAYP 265
           E++NL L   ++ K DIW+LG   Y L +  +PFE     HG+    AI  GK+++P   
Sbjct: 269 ELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINTGKYSFPRNS 328

Query: 266 QYTDSLKNIIRVLLSTNPIQRP 287
           ++++ L ++I+  +  +PIQRP
Sbjct: 329 RFSEGLLSVIKKCIQVDPIQRP 350

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 91.3 bits (225), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 81/333 (24%), Positives = 143/333 (42%), Gaps = 61/333 (18%)

Query: 13  TKLQVASHEVIIENYLTSGGFAQVYTARI-----TSEHKNLYPELTCLKRVIVPNKQSLN 67
           T ++V      I+  L  GG + VY  ++     + E+     EL  LK++I P+ ++++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  ILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXX 127
               E++  K  ++  Y++  IDS    +Q  + S  + +++ Y S   L D +N     
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQV--MQEKDGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 128 XX--XXXXXXXXMTDVSQGVYHMHQ---------------------------------LQ 152
                       M  V++G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 153 PPLL-----------HRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDI 201
             +L           HRDI   N+L S DG   + D GS S    +  +  +   LQ  +
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 LKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE----HGSR---AI 254
             N T  Y +PE++NL L   ++ K DIW++G   Y L +  +PFE     HG+    AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 255 MEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRP 287
             GK+++P   ++++ L ++I+  +  +PIQRP
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 129/278 (46%), Gaps = 29/278 (10%)

Query: 24  IENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSLNILRAEVDAMKILKNN 82
           I+  +  G F  VY A       N+  +   +K + +  + + +++L  E+  +  LK++
Sbjct: 18  IKECVGRGNFGDVYKA-----IDNITKKYVAIKVINLEYSDEDIDLLAQEIFFLAELKSD 72

Query: 83  KYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVS 142
            YI++YI +    +        + ++M+YC G    D +                + +V 
Sbjct: 73  -YIINYITTIMEDVS-------MWIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVL 124

Query: 143 QGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDIL 202
            G+ ++H+ +   +HRDIK  N+LL+ DG  KL DFG VSG +++    + FV       
Sbjct: 125 LGLQYLHEQKK--IHRDIKAANILLTDDGQVKLGDFG-VSGQIKATLKRDTFV------- 174

Query: 203 KNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG--KFT 260
              T  + +PE++N  +    +EK DIW+LGI  Y+L     P  ++    +M    K  
Sbjct: 175 --GTPYWMAPEVINKEINNGYDEKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRK 232

Query: 261 YPA-YPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
            P  +  Y D  K+ I   L  +P  RPN+  LL+  F
Sbjct: 233 PPKLHGPYNDFTKSFISFCLIKDPKLRPNVQNLLKTDF 270

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 78/153 (50%), Gaps = 7/153 (4%)

Query: 157 HRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVN 216
           HRD+K  N+++S +    + D GS S       S +  +  Q     N T  Y +PE+++
Sbjct: 191 HRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCTLSYAAPEILD 250

Query: 217 LALGFPINEKSDIWALGILLYKLCYYTTPFEEHG-------SRAIMEGKFTYPAYPQYTD 269
           + L   I EK DIW+ G  +Y +C+  +PFE          + AI  GK+T P    Y+ 
Sbjct: 251 VKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRGTSYSS 310

Query: 270 SLKNIIRVLLSTNPIQRPNICQLLEELFRIQHK 302
           SL  +I   LS NP QRP++ +L+  L  +Q +
Sbjct: 311 SLIELIGKCLSVNPEQRPSVNELIALLMELQGQ 343

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 89.7 bits (221), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 134/283 (47%), Gaps = 30/283 (10%)

Query: 19  SHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKI 78
           S+  II+  +  G F  VY A    E K +  ++  L+     +++ +++L  E+  +  
Sbjct: 12  SNTYIIQQCVGRGNFGDVYKACDKVEGKVVAVKVVNLEH----SEEDIDLLAQEIFFLAE 67

Query: 79  LKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXM 138
           L++  +I +YI +    +        + ++MEYC G    D +                 
Sbjct: 68  LRS-PFITNYITTLTEDVS-------MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFIT 119

Query: 139 TDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQ 198
           + V +G+ ++H+ +   +HRDIK  N+LL+ +G  KL DFG VSG +R+      FV   
Sbjct: 120 SQVLRGLVYLHEQKK--IHRDIKAANILLTDEGTVKLGDFG-VSGQIRATLKRGTFV--- 173

Query: 199 NDILKNTTAQYRSPEMVNLA-LGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG 257
                  T  + +PE+V+    G+  +EK+DIW+LGI +Y+L     P  +     +M  
Sbjct: 174 ------GTPYWMAPEVVSKENDGY--DEKADIWSLGITVYELLKGAPPLSKCDPMKVMIN 225

Query: 258 --KFTYPA-YPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
             K   PA +  Y+ S KN +   L  NP+ R +  +++E  F
Sbjct: 226 LPKRKPPALHGHYSHSAKNFVSSCLVKNPVGRASAYEMVEHNF 268

>TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.262
           YPL236C
          Length = 413

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 84/157 (53%), Gaps = 7/157 (4%)

Query: 154 PLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPE 213
           P  HRD+   N+L + DG   L D GS      S T++ + +  ++ I ++ T  Y +PE
Sbjct: 257 PYAHRDLTPSNILFASDGYPILSDLGSCIPANVSITTNSQLIKWKDWIAESCTLPYTAPE 316

Query: 214 MVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHG-------SRAIMEGKFTYPAYPQ 266
           ++N+ L   I  KSDIW++G + Y + +  +PFE          + A+  G +++P+  +
Sbjct: 317 ILNIRLNSHITTKSDIWSVGCIFYCILFGISPFEREEQLRGASITYALSTGHYSFPSQNR 376

Query: 267 YTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKS 303
           Y++ L N+I+  L  +P  RP+   L ++L  + H S
Sbjct: 377 YSNDLLNVIKACLQIDPTARPSADTLFQQLETLSHTS 413

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 128/278 (46%), Gaps = 30/278 (10%)

Query: 24  IENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNK 83
           I+  +  G F  VY A      K +  ++  L+       + +N+L  E+  +  LK+  
Sbjct: 19  IKQCVGRGNFGDVYKACEKVSGKVVAVKVVNLEH----TDEDINLLAQEIFFLAELKS-P 73

Query: 84  YIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQ 143
           YI +YI +    +        + ++MEYC G    D +                  +V +
Sbjct: 74  YITNYITTMTEDVS-------MWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLK 126

Query: 144 GVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILK 203
           G+ ++H+ +   +HRDIK  N+LL+ +G  KL DFG VSG +R+      FV        
Sbjct: 127 GLEYLHEQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATLKRGTFV-------- 175

Query: 204 NTTAQYRSPEMVNL-ALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG--KFT 260
             T  + +PE+V+  + G+  +EK+DIW+LGI +Y+L   + P  +     +M    K  
Sbjct: 176 -GTPFWMAPEVVSKDSDGY--DEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRK 232

Query: 261 YPA-YPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
            P  +  Y+ + K+ +   L  NP  RP+  +LL   F
Sbjct: 233 PPVLHGHYSSAAKHFVASCLVKNPKNRPSAVELLNSEF 270

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 84.3 bits (207), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 82/334 (24%), Positives = 141/334 (42%), Gaps = 55/334 (16%)

Query: 15  LQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP--NKQSLNILRAE 72
           + V  H   I+  L  GGF+ VY   +    +N    L  LK++  P  +  S++    E
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVY---LVESREN---GLMALKKIRCPFGSIGSISPAMKE 72

Query: 73  VDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMN--XXXXXXXX 130
           VD  +  K+  YI   IDS    +Q  + S  V +L+ Y S   L D +N          
Sbjct: 73  VDNYQKFKS-PYIAQIIDSQV--VQERDGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 131 XXXXXXXMTDVSQGVYHMHQLQPP-------------------LL--------------- 156
                     V++G+  +H   P                    LL               
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 157 -HRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMV 215
            H DIK  N+++S +G   + D GS S       S +  +  Q    ++ T  + +PE++
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEIL 249

Query: 216 NLALGFPINEKSDIWALGILLYKLCYYTTPF--EEHGSRA-----IMEGKFTYPAYPQYT 268
           ++ L   I EK D+W+ G  +Y +C+  +PF  EE  S A     +  GK++ P+   Y+
Sbjct: 250 DVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYS 309

Query: 269 DSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHK 302
             L ++++  L+ +P  RP++ +L+  L  +Q +
Sbjct: 310 SGLIDVVKKCLNVDPDGRPSVDELISLLMDLQSQ 343

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 130/281 (46%), Gaps = 44/281 (15%)

Query: 24  IENYLTSGGFAQVYTA--RITSEHKNLYPELTCLKRV-IVPNKQSLNILRAEVDAMKILK 80
           I++ +  G F  VY A  R+T E       +  +K V +  + + + +L  E+  +  LK
Sbjct: 20  IQSCIGRGNFGDVYKAVDRVTQE-------IVAIKVVNLEHSDEDIELLAQEIFFLAELK 72

Query: 81  NNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTD 140
           +   I +YI   A  L++      + ++MEYC G    D +                + +
Sbjct: 73  S-PLITNYI---ATMLEDVS----MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHE 124

Query: 141 VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
           V+ G+ ++H+ +   +HRDIK  N+LL+ +G  KL DFG VSG +RS    + FV     
Sbjct: 125 VTLGLKYLHEQRK--IHRDIKAANILLNEEGMVKLGDFG-VSGHIRSTLKRDTFV----- 176

Query: 201 ILKNTTAQYRSPEMVNLAL-GFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG-- 257
                T  + +PE+V   + G+  NEK+DIW+LGI  Y+L     P  ++    +M    
Sbjct: 177 ----GTPYWMAPEVVCCEVDGY--NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLP 230

Query: 258 -----KFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLL 293
                K   P    ++D+ K+ +   L   P  RP+   LL
Sbjct: 231 KRKPPKLQGP----FSDAAKDFVAGCLVKTPADRPSAYNLL 267

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 126/281 (44%), Gaps = 36/281 (12%)

Query: 24  IENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNK 83
           I+  +  G F  VY A   +    +  ++  L+      ++ +++L  E+  +  L++  
Sbjct: 17  IQECVGRGNFGDVYKAFDKTNGAIVAVKVVNLEHT----EEDIDLLAQEIFFLAELRS-P 71

Query: 84  YIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQ 143
           YI +YI +    +        + ++MEYC G    D +                  +V +
Sbjct: 72  YITNYITTMIEDVS-------MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLK 124

Query: 144 GVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILK 203
           G+ ++H  +   +HRDIK  N+LL+ +G  KL DFG VSG +R+      FV        
Sbjct: 125 GLKYLHDQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATMKRGTFV-------- 173

Query: 204 NTTAQYRSPEMVNL-ALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYP 262
             T  + +PE+VN  + G+  NEK+DIW+LGI +Y+L     P  +     +M    + P
Sbjct: 174 -GTPYWMAPEVVNKESNGY--NEKADIWSLGITVYELLKGLPPLSKCDPMKVM---VSLP 227

Query: 263 ------AYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
                  + QY+D  K  +   L  +P  RP+   LL   F
Sbjct: 228 RRKPPKLHGQYSDVAKGFVAACLVKDPNLRPSAEMLLTNEF 268

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 135/282 (47%), Gaps = 34/282 (12%)

Query: 19  SHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNK-QSLNILRAEVDAMK 77
           +H  I++  +  G F  VY A   + +K     +  +K V + N  + L +L  E+  + 
Sbjct: 19  AHNYIVKECVGRGNFGDVYRAIDRTTNK-----VVAIKVVDLENTNERLEVLAQEIFFLA 73

Query: 78  ILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXX 137
            LK+  YI++YI +        ED+  + ++MEYC G    D +                
Sbjct: 74  ELKS-PYIINYITTLL------EDA-SMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYI 125

Query: 138 MTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYL 197
             ++ +G+ ++H+ +   +HRDIK  N+LL+ +G+ KL DFG VSG L+S       V  
Sbjct: 126 TREILKGLQYLHEQKK--IHRDIKAANILLTEEGHVKLGDFG-VSGQLKSTLRRGTIV-- 180

Query: 198 QNDILKNTTAQYRSPEMVNLAL-GFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME 256
                   T  + +PE+ +  + G+  +EK DIW+LGI +++L     P  +     ++ 
Sbjct: 181 -------GTPYWMAPEVASQNIEGY--DEKIDIWSLGITVFELLKGVPPLVKLDPIRVL- 230

Query: 257 GKFTYPAYPQ----YTDSLKNIIRVLLSTNPIQRPNICQLLE 294
              +  + P+    Y+D+ K+ + + L  NP +RP    LL+
Sbjct: 231 ANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 127/280 (45%), Gaps = 35/280 (12%)

Query: 25  ENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKY 84
           E++L  GGFA+ +  +I  E   ++   T  K  I   K    +L +E+   K +K++  
Sbjct: 98  EHFLGEGGFARCF--QIKDESGKIFAAKTVAKISIKSEKTKRKLL-SEIQIHKSMKHSN- 153

Query: 85  IVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQG 144
           IV +ID         ED   V +L+E C    L+D +                 T +   
Sbjct: 154 IVQFIDCF-------EDDANVYILLEICPNGSLMDLLKKRKSLTEPEVRFFT--TQICGA 204

Query: 145 VYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKN 204
           + ++H  +  ++HRD+K+ N+    D N K+ DFG ++ VL +    +  V         
Sbjct: 205 IKYLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFG-LAAVLANDRERKYTVC-------- 253

Query: 205 TTAQYRSPEMV---NLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----G 257
            T  Y +PE++   +    F +    DIW++G+++Y L     PF+      I E     
Sbjct: 254 GTPNYIAPEVLMGKHSGHSFEV----DIWSIGVMIYALLVGKPPFQAKDVNVIYERIKLC 309

Query: 258 KFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           K+ YP     +   + +I  +LS NP+QRP I  ++++++
Sbjct: 310 KYGYPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDVW 349

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/281 (23%), Positives = 128/281 (45%), Gaps = 36/281 (12%)

Query: 24  IENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNK 83
           ++  +  G F  VY A   S    +  ++  L+         +++L  E+  +  L ++ 
Sbjct: 36  VQECVGKGNFGDVYKAIDKSTGNTVAIKVVNLEE----TDDEIDLLAQEIYFLAEL-HSP 90

Query: 84  YIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQ 143
           YI +Y  +    +        + ++MEYC G    D +                  ++ +
Sbjct: 91  YITNYFSTFVEDVS-------MWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILR 143

Query: 144 GVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILK 203
           G+ ++H  +   +HRDIK  N+LL+ DG  KL DFG VSG + +    + FV        
Sbjct: 144 GLEYLHSQRK--IHRDIKAANILLTDDGKVKLGDFG-VSGQMMATRRRDTFV-------- 192

Query: 204 NTTAQYRSPEMVNLA-LGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYP 262
             T  + +PE++  +  G+  NEK+DIW+LGI +++L     P  +H    ++    + P
Sbjct: 193 -GTPFWMAPEVIARSEQGY--NEKADIWSLGITVFELLKGQPPLSQHDPMKVL---MSIP 246

Query: 263 AY------PQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           +        +Y+ +++  + + L+ +P +RP   +LL+  F
Sbjct: 247 SRRPPKLEDRYSHAIREFVSLCLNKDPAKRPTASELLKHRF 287

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 73/140 (52%), Gaps = 7/140 (5%)

Query: 157 HRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVN 216
           HRDIK  N+L S DG   + + GS S    S  +  +   LQ  +  + T  Y +PE+++
Sbjct: 217 HRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAWVSDHCTVAYTAPELLH 276

Query: 217 LALGFPINEKSDIWALGILLYKLCYYTTPFEEH----GSR---AIMEGKFTYPAYPQYTD 269
           + L   ++ K DIW+LG   Y + +  +PFE      G+    AI  G F++P+  +Y++
Sbjct: 277 ITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYAIGTGNFSFPSQDRYSE 336

Query: 270 SLKNIIRVLLSTNPIQRPNI 289
            L  +I   L  NP  RP+I
Sbjct: 337 GLLKLITKCLQVNPAARPDI 356

>CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} similar
           to uniprot|P08458 Saccharomyces cerevisiae YDR523c SPS1
           ser/thr protein kinase
          Length = 521

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 130/284 (45%), Gaps = 32/284 (11%)

Query: 19  SHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPN-KQSLNILRAEVDAMK 77
           S   +IEN +  G F  VY A+ T        E+  +K V + N ++ + +L  E+  + 
Sbjct: 2   SKRFVIENCIGRGNFGDVYKAKDT-----WLNEVVAVKVVNLENSEEEVELLAQEIFFLA 56

Query: 78  ILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXX 137
            LK+  Y+ +YI +    +        + + MEYC G  + D +                
Sbjct: 57  ELKS-PYVTNYIATVVEDVS-------MWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFI 108

Query: 138 MTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYL 197
             ++ +G+ ++H  +   +HRDIK  N+LL+ +G  KL DFG VSG L S    + FV  
Sbjct: 109 TREILKGLSYLHSQRK--IHRDIKAANILLTDEGKVKLSDFG-VSGKLLSSFRRDTFV-- 163

Query: 198 QNDILKNTTAQYRSPEMV-NLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME 256
                   T  + +PE+V + + G+  +E++DIW+LGI + ++   + P  ++    ++ 
Sbjct: 164 -------GTPYWMAPEIVAHDSEGY--DERADIWSLGITVIEMLRGSPPLSKYDPMKVIA 214

Query: 257 G--KFTYPA-YPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
              K   P  +  ++D  K+ + + L      RP    LL   F
Sbjct: 215 NLPKRKPPKLHGDFSDDAKHFVALCLIKESAIRPTAADLLTTRF 258

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 116/252 (46%), Gaps = 47/252 (18%)

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           ++ E+  +  LK    I  Y  S+ N  +       + ++MEYC+G  L   +       
Sbjct: 62  VQKEIQFLSSLKQVPNITHYYGSYLNDTK-------LWVIMEYCAGGSLRTLLRPGKIGE 114

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    M ++   + H+H+    ++HRDIK  NVL++ DG+ KLCDFG V+  L   
Sbjct: 115 QYIGVI---MRELLTALMHIHKDG--VIHRDIKAANVLITNDGHIKLCDFG-VAAQLS-- 166

Query: 189 TSSEEFVYLQNDILKNTTAQ---YRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTP 245
                    Q  I + T A    + +PE++   + +  + K DIW+LGI  Y++     P
Sbjct: 167 ---------QTKIRRQTMAGTPYWMAPEVIMEGVYY--DTKVDIWSLGITAYEIATGNPP 215

Query: 246 F-EEHGSRAI----------MEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLE 294
           + E    RA+          +EG+       Q++ +LK II + L  +P +RP+   LL+
Sbjct: 216 YCEVEALRAMQLITKSKPPRLEGR-------QHSSALKEIIALCLDEDPKERPSAEDLLK 268

Query: 295 ELFRIQHKSSPL 306
             F   HK+ P+
Sbjct: 269 TKFIKLHKNVPV 280

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 122/273 (44%), Gaps = 36/273 (13%)

Query: 23  IIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNN 82
           ++E  +  G F  VY A      K +  ++  L+       + + +L  E+  +  L++ 
Sbjct: 16  LMEKCVGRGNFGDVYKAVEIKSGKIVAIKVVNLEH----TNEDIELLSQEIFFLAELRS- 70

Query: 83  KYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVS 142
            Y+  Y+ +    +        + ++MEYC G    D +                  +V 
Sbjct: 71  PYVTKYLTTLLEDVS-------IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVL 123

Query: 143 QGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDIL 202
           +G+ ++H+ +   +HRDIK  N+LL+ DG  KL DFG VSG +++    + FV       
Sbjct: 124 KGLRYLHEQKK--IHRDIKAANILLTDDGMVKLGDFG-VSGQIKATLKKDTFV------- 173

Query: 203 KNTTAQYRSPEMVNL-ALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTY 261
              T  + +PE+V     G+  NEK+DIW+LGI +Y+L     P  ++    +M    + 
Sbjct: 174 --GTPYWMAPEVVKKDESGY--NEKADIWSLGITVYELLKGCPPLAKYDPMKVM---ISV 226

Query: 262 PA------YPQYTDSLKNIIRVLLSTNPIQRPN 288
           P       +  Y++  K+ I   L  +P  RPN
Sbjct: 227 PKRRAPKLHGHYSEDAKSFISHCLIKDPNARPN 259

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 124/275 (45%), Gaps = 32/275 (11%)

Query: 24  IENYLTSGGFAQVYTARITSEHKNLYPELTCLKRV-IVPNKQSLNILRAEVDAMKILKNN 82
           I++ +  G F  VY A   +       E+  +K V +  + + + +L  E+  +  LK+ 
Sbjct: 15  IQSCIGRGNFGDVYKAMDRTTQ-----EIVAIKVVNLEHSDEDIELLAQEIFFLAELKS- 68

Query: 83  KYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVS 142
             I +YI +    +        + ++MEYC G    D +                +  V+
Sbjct: 69  PLITNYITTMLEDVS-------MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVT 121

Query: 143 QGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDIL 202
            G+ ++H+ +   +HRDIK  N+LL+ +G  KL DFG VSG LRS    + FV       
Sbjct: 122 LGLKYLHEQRK--IHRDIKAANILLNEEGMVKLGDFG-VSGHLRSTMKRDTFV------- 171

Query: 203 KNTTAQYRSPEMVNLAL-GFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG--KF 259
              T  + +PE+V   + G+  NEK+DIW+LGI  Y+L     P  ++    +M    K 
Sbjct: 172 --GTPYWMAPEVVCCEVDGY--NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKR 227

Query: 260 TYPAYP-QYTDSLKNIIRVLLSTNPIQRPNICQLL 293
             P     ++D+ K  +   L   P  RP+   LL
Sbjct: 228 KPPKLQGSFSDAAKEFVAGCLVKVPADRPSAYDLL 262

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 125/290 (43%), Gaps = 48/290 (16%)

Query: 16  QVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDA 75
           +V +++++ +  +  G F +VY A     H+ +     CLK     +K   NI+R     
Sbjct: 37  EVGNYKILKQ--IGEGSFGKVYLALHRPTHRKV-----CLK---TSDKNDPNIVR----- 81

Query: 76  MKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXX 135
            ++  + ++   YI      +        V + +EYC G  L D  +             
Sbjct: 82  -EVFYHRQFDFPYITKLYEVIVTESK---VWMALEYCPGKELYD--HLLSLRRISLLECG 135

Query: 136 XXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFV 195
                +S  VY+ H +    +HRD+K+EN+LL  +GN KL DFG     + + T+ E   
Sbjct: 136 ELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGFTRECM-TKTTLETVC 192

Query: 196 YLQNDILKNTTAQYRSPEMVNLAL--GFPINEKSDIWALGILLYKLCYYTTPFEEHGSRA 253
                     T  Y +PE++      GF I    DIW+LG++LY L     PF++     
Sbjct: 193 ---------GTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGYLPFDDDDEAK 239

Query: 254 IM------EGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
                   E K+     P   D  +++I  LL+ NP +RP++ Q+L   F
Sbjct: 240 TKWKIVNEEPKYDAKVIP---DDARDLISRLLAKNPGERPSLSQVLRHPF 286

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 127/292 (43%), Gaps = 52/292 (17%)

Query: 16  QVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDA 75
           +V +++++ +  +  G F +VY A     H+ +     CLK     +K   NI+R     
Sbjct: 37  EVGNYKILKQ--IGEGSFGKVYLALHRPTHRKV-----CLK---TSDKNDPNIVR----- 81

Query: 76  MKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXX 135
            ++  + ++   YI      +        V + +EYC G  L D +              
Sbjct: 82  -EVFYHRQFDFPYITKLYEVIVTESK---VWMALEYCPGKELYDHL--LSLHRISLLECG 135

Query: 136 XXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFV 195
                +S  VY+ H +    +HRD+K+EN+LL  +GN KL DFG     + + T+ E   
Sbjct: 136 ELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGFTRECM-TKTTLETVC 192

Query: 196 YLQNDILKNTTAQYRSPEMVNLAL--GFPINEKSDIWALGILLYKLCYYTTPFEEHGSRA 253
                     T  Y +PE++      GF I    D W+LG++LY L   + PF++     
Sbjct: 193 ---------GTTVYMAPELIGRKTYDGFKI----DTWSLGVILYTLITGSLPFDDDD--- 236

Query: 254 IMEGKFTYPAY---PQYT-----DSLKNIIRVLLSTNPIQRPNICQLLEELF 297
             E K  +      P+Y      D  K++I  LL+ NP +RP++ Q+L   F
Sbjct: 237 --EAKTKWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVLRHPF 286

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/281 (26%), Positives = 126/281 (44%), Gaps = 44/281 (15%)

Query: 24  IENYLTSGGFAQVYTA--RITSEHKNLYPELTCLKRV-IVPNKQSLNILRAEVDAMKILK 80
           I++ +  G F  VY A  R+T E       +  +K V +  + + + +L  E+  +  LK
Sbjct: 20  IQSCIGRGNFGDVYKAMDRVTQE-------IVAIKVVNLEHSDEDIELLAQEIFFLAELK 72

Query: 81  NNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTD 140
           +   I +YI +    +        + ++MEYC G    D +                +  
Sbjct: 73  S-PLITNYITTMLEDVS-------MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQ 124

Query: 141 VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
           V+ G+ ++H+ +   +HRDIK  N+LL+ +G  KL DFG VSG +RS    + FV     
Sbjct: 125 VTLGLKYLHEQRK--IHRDIKAANILLNEEGMVKLGDFG-VSGHIRSTFKRDTFV----- 176

Query: 201 ILKNTTAQYRSPEMVNLAL-GFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG-- 257
                T  + +PE+V   + G+  NEK+DIW+LGI  Y+L     P  ++    +M    
Sbjct: 177 ----GTPYWMAPEVVCCEVDGY--NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLP 230

Query: 258 -----KFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLL 293
                K   P    ++++ K  +   L   P  RP+   LL
Sbjct: 231 KRKPPKLQGP----FSEAAKEFVAGCLVKTPADRPSAYDLL 267

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 129/279 (46%), Gaps = 35/279 (12%)

Query: 26  NYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYI 85
           ++L  GGFA+ +  +I  +  +++   T  K  I   K    +L +E+   K + +   I
Sbjct: 86  HFLGEGGFARCF--QIKDDSGDIFAAKTVAKASIKSEKTRKKLL-SEIQIHKSMAHPN-I 141

Query: 86  VSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGV 145
           V +ID         ED   V +L+E C    L++ +                 T +   +
Sbjct: 142 VQFIDCF-------EDDSNVYILLEICPNGSLMELLKRRKVLSEPEVRFFT--TQICGAI 192

Query: 146 YHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT 205
            +MH  +  ++HRD+K+ N+    + N K+ DFG ++ VL + +  +  +          
Sbjct: 193 KYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLANESERKYTIC--------G 241

Query: 206 TAQYRSPEMV---NLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG----K 258
           T  Y +PE++   +    F +    DIW+LG++LY L     PF+      I E      
Sbjct: 242 TPNYIAPEVLMGKHSGHSFEV----DIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRD 297

Query: 259 FTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           F++P     +D  K +IR +LS +PI+RP++ ++++ ++
Sbjct: 298 FSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYVW 336

>ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {ON}
           some similarities with uniprot|Q03306 Saccharomyces
           cerevisiae YDR466W
          Length = 890

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 134/291 (46%), Gaps = 31/291 (10%)

Query: 13  TKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAE 72
           ++++ + H+ + +  L +G +++VY A   S+ + +Y    C KR I+ ++  +  +  E
Sbjct: 3   SRIKRSPHDFVFKEELGNGSYSRVYKAVDRSDPQRVYAVKVCSKRHII-HENKVKYVTIE 61

Query: 73  VDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXX-X 131
            + + +L    +    +  H+    + E+ Y VL   ++ +G  LL  +N          
Sbjct: 62  KNTLNLLARANH-PGIVKLHST-FHDEENLYFVL---DFAAGGELLSLLNRVGKFTEPCA 116

Query: 132 XXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPT-S 190
                 + D ++ ++        ++HRD+K ENVLL  DG   + DFG+ + + +  T  
Sbjct: 117 RHFIAQLIDTTEFIHSQG-----VIHRDLKPENVLLHRDGRLMVTDFGTATNITKENTEG 171

Query: 191 SEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPF---- 246
              FV          TA+Y SPE++   L       SD+WALG +LY+      PF    
Sbjct: 172 GASFV---------GTAEYVSPELL---LYNQCQFASDVWALGCMLYQFIEGVPPFRGEN 219

Query: 247 EEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           E H    I+     YP        + +++R +L+ +P QRP++  + ++ +
Sbjct: 220 ELHTFEKIVA--LEYPWANNNKGGVVSLVRRILTLDPSQRPSLTSIKQDKW 268

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 119/282 (42%), Gaps = 60/282 (21%)

Query: 31  GGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRA-----EVDAMKILKNNKYI 85
           G F +VY A     H+ +     CLK     +K   NI+R      + D   I K  + I
Sbjct: 50  GSFGKVYLALHRPTHRKV-----CLK---TSDKNDPNIVREVFYHRQFDFPYITKLYEVI 101

Query: 86  VSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGV 145
           V+                 V + +EYC G  L D +                   +S  V
Sbjct: 102 VTETK--------------VWMALEYCPGKELYDHL--LSLHRISLLECAELFAQISGAV 145

Query: 146 YHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT 205
           Y+ H +    +HRD+K+EN+LL  +GN KL DFG     + + T+ E             
Sbjct: 146 YYAHSMH--CVHRDLKLENILLDKNGNAKLTDFGFTRECM-TKTTLETVC---------G 193

Query: 206 TAQYRSPEMVNLAL--GFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPA 263
           T  Y +PE++      GF I    DIW+LG++LY L   + PF++       E K  +  
Sbjct: 194 TTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGSLPFDDDD-----EVKTKWKI 244

Query: 264 Y---PQYTDSL-----KNIIRVLLSTNPIQRPNICQLLEELF 297
               P Y  +L     K++I  LL+ NP +RP++ Q+L   F
Sbjct: 245 VNEEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVLHHQF 286

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 88/207 (42%), Gaps = 41/207 (19%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V +++EYC    L D++                   +   VY+ H L    +HRD+K+EN
Sbjct: 105 VWMVIEYCPNKELYDYL--LSKKRISLDESARIFAQIVGAVYYAHSLS--CVHRDLKLEN 160

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT-------TAQYRSPEMVNL 217
           +LL  D N KL DFG                    D  KNT       T  Y +PE++  
Sbjct: 161 ILLDKDNNAKLTDFG-----------------FTRDFSKNTQLETICGTTVYMAPELLRR 203

Query: 218 AL--GFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQY-----TDS 270
               G+ I    DIWALGILLY +   T PF+E   +   E K    A P Y      D 
Sbjct: 204 EKYDGYKI----DIWALGILLYTIINGTMPFDEDDPKK-TELKII-SASPDYDNKYFNDD 257

Query: 271 LKNIIRVLLSTNPIQRPNICQLLEELF 297
             +++  LLS +P  RP I Q+L   F
Sbjct: 258 SIDLVNRLLSKDPSMRPTIEQILMHPF 284

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 125/275 (45%), Gaps = 29/275 (10%)

Query: 27  YLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIV 86
           +L  GGFA+ +  +   +   ++   T  K  I   K    +L +E+   K +KN   IV
Sbjct: 88  FLGEGGFARCF--QFNDDSGKIFAAKTVAKLSIKSEKTRRKLL-SEIQIHKSMKNVN-IV 143

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
            +ID         ED   V +L+E C    L+D +                 T +   + 
Sbjct: 144 QFIDCF-------EDDTNVYILLEICPNGSLMDLLKKRKSLTEPEVRFFT--TQICGAIK 194

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           +MH  +  ++HRD+K+ N+    D N K+ DFG ++ VL +    +  V          T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFG-LAAVLANDRERKYTVC--------GT 243

Query: 207 AQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKFTYP 262
             Y +PE++ +      + + DIW++G++LY L     PF+      I E      FT+P
Sbjct: 244 PNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFTFP 302

Query: 263 AYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
                +   K +I+ LLS +P++RP++ ++++ ++
Sbjct: 303 KDKYISPEAKILIQDLLSLDPLERPSVDEIIDYVW 337

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 127/281 (45%), Gaps = 44/281 (15%)

Query: 24  IENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVI-VPNKQSLNILRAEVDAMKILKNN 82
           I  ++  G F +VY A     H+     LT  K V+   NK+  N++R      ++  + 
Sbjct: 39  ISKFIGEGSFGKVYLA----THR-----LTHQKVVLKTGNKRDPNVVR------EVFYHR 83

Query: 83  KYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVS 142
           ++   YI      +      ++VL   EYCSG  L + +                 + ++
Sbjct: 84  QFDFPYITKLYEVIVTESRVWMVL---EYCSGHELYEHL--LKEQRLSLEESKKLFSQIA 138

Query: 143 QGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDIL 202
             VY+ H+L+   +HRD+K+ENVLL G+G+ KL DFG          + E     Q + +
Sbjct: 139 SAVYYAHELK--CVHRDLKLENVLLDGNGHAKLTDFG---------FTREMATRSQLETI 187

Query: 203 KNTTAQYRSPEMVNLAL--GFPINEKSDIWALGILLYKLCYYTTPFEEHGS----RAIME 256
             TT  Y +PE++      GF    K DIW+LGI+LY +     PF+E         I+ 
Sbjct: 188 CGTTV-YMAPELIERKCYDGF----KVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVN 242

Query: 257 GKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
            +  +      +D   ++I+ +L  NP +R ++ Q+L   F
Sbjct: 243 DELDF-NQEWISDDAIDLIQGMLRKNPNERISLAQVLSHPF 282

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 129/279 (46%), Gaps = 35/279 (12%)

Query: 26  NYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYI 85
           ++L  GGFA+ +  +I  +   ++   T  K  I   K    +L +E+   K + ++  I
Sbjct: 86  HFLGEGGFARCF--QIKDDSGEIFAAKTVAKASIKSEKTRKKLL-SEIQIHKSM-SHPNI 141

Query: 86  VSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGV 145
           V +ID         ED   V +L+E C    L++ +                 T +   +
Sbjct: 142 VQFIDCF-------EDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFT--TQICGAI 192

Query: 146 YHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT 205
            +MH  +  ++HRD+K+ N+    + N K+ DFG ++ VL + +  +  +          
Sbjct: 193 KYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLANESERKYTIC--------G 241

Query: 206 TAQYRSPEMV---NLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG----K 258
           T  Y +PE++   +    F +    DIW+LG++LY L     PF+      I E      
Sbjct: 242 TPNYIAPEVLMGKHSGHSFEV----DIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRD 297

Query: 259 FTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           F++P     +D  K +IR +LS +PI+RP++ ++++ ++
Sbjct: 298 FSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYVW 336

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 111/235 (47%), Gaps = 32/235 (13%)

Query: 72  EVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXX 131
           E++  K++  +K I+S ID         E    + +++E C    L D +          
Sbjct: 99  EIEIHKLVNGHKNIISMIDHF-------EIDATMYMVLELCGAGSLYDII-CRSKRSLRE 150

Query: 132 XXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSS 191
                 M  +   V  +H+    ++H D+K+ N+L+    N +LCDFG       S  S+
Sbjct: 151 WEAKRLMIQLCGAVDWIHE--KNIVHADLKLSNILIDSSNNLQLCDFG------HSFVST 202

Query: 192 EEFVYLQNDILKNTTAQYRSPEMV-NLALG------FPINEKSDIWALGILLYKLCYYTT 244
           +      N I K  T  Y SPE++ N  L       FP  ++SDIW++GI+LY + +  T
Sbjct: 203 D---IDNNSINKFGTPNYLSPEIISNFILSDKKDLYFP--KESDIWSIGIVLYAMIFDKT 257

Query: 245 PFEEHGSRA----IMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEE 295
           PFE    R+    I+E K+ +    + ++ +K +I+ +L   P++R  I +++ +
Sbjct: 258 PFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIVSD 312

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 88/313 (28%), Positives = 133/313 (42%), Gaps = 68/313 (21%)

Query: 16  QVASHEVI-IENY-----LTSGGFAQVYTARITSEHKNLYPELTCLKRVI-VPNKQSLNI 68
           Q +S+E++ I NY     +  G F +VY A     H+     LT  K V+   NK   N+
Sbjct: 25  QFSSNELVDIGNYKIVKLIGEGSFGKVYLAN----HR-----LTHQKVVLKTGNKNDPNV 75

Query: 69  LRA-----EVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNX 123
           +R      + D   I K  + IV+                 V + +EYC G  L +++  
Sbjct: 76  VREVFYHRQFDFPHITKLYEVIVT--------------ESKVWMALEYCPGKELYEYL-- 119

Query: 124 XXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSG 183
                            +   VY+ H LQ   +HRD+K+EN+LL   G  K+ DFG    
Sbjct: 120 LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLENILLDKKGRAKITDFG---- 173

Query: 184 VLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLAL--GFPINEKSDIWALGILLYKLCY 241
                 + E       + +  TT  Y +PE++      GF I    DIW+LG++LY + +
Sbjct: 174 -----FTRECATKTMLETVCGTTV-YMAPELIERKSYDGFKI----DIWSLGVILYTMIH 223

Query: 242 YTTPFEEHGSRAIMEGKFTYP---AYPQYTDSL-----KNIIRVLLSTNPIQRPNICQLL 293
            T PF+E       E K  +      P Y D +     K++I  LL  +P QRP + Q+L
Sbjct: 224 GTMPFDEED-----ETKTKWKIINEEPFYNDDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

Query: 294 EELFRIQHKSSPL 306
              F   + SS L
Sbjct: 279 AHPFLQPYGSSLL 291

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 129/279 (46%), Gaps = 35/279 (12%)

Query: 26  NYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYI 85
           ++L  GGFA+ +  +I  +   ++   T  K  I   K    +L +E+   K + ++  I
Sbjct: 86  HFLGEGGFARCF--QIKDDSGEIFAAKTVAKASIKSEKTRKKLL-SEIQIHKSM-SHPNI 141

Query: 86  VSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGV 145
           V +ID         ED   V +L+E C    L++ +                 T +   +
Sbjct: 142 VQFIDCF-------EDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFT--TQICGAI 192

Query: 146 YHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT 205
            +MH  +  ++HRD+K+ N+    + N K+ DFG ++ VL + +  +  +          
Sbjct: 193 KYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLANESERKYTIC--------G 241

Query: 206 TAQYRSPEMV---NLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG----K 258
           T  Y +PE++   +    F +    DIW+LG++LY L     PF+      I E      
Sbjct: 242 TPNYIAPEVLMGKHSGHSFEV----DIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRD 297

Query: 259 FTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           F++P     +D  K +IR +LS +PI+RP++ ++++ ++
Sbjct: 298 FSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYVW 336

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 125/271 (46%), Gaps = 28/271 (10%)

Query: 27  YLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIV 86
           +L  GGFA+ +  ++  +   ++   T  K + + ++++ N L +E+   K +++   IV
Sbjct: 103 FLGEGGFARCF--QMKDDDGKVFAAKTVAK-ISIKSEKARNKLLSEIQIHKNMRHQN-IV 158

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
            +ID         ED   V +L+E C    L+D +                 T +   + 
Sbjct: 159 HFIDCF-------EDDINVYILLEICPNGSLMDLLKRRKILTEPEVRFFT--TQICGALD 209

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           HMH     ++HRD+K+ N+    D N K+ DFG ++ ++ +    +  +          T
Sbjct: 210 HMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAIINNENERKYTIC--------GT 258

Query: 207 AQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKFTYP 262
             Y +PE++        + + DIW+LG++++ +     PF+      I +      +++P
Sbjct: 259 PNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYSFP 318

Query: 263 AYPQYTDSLKNIIRVLLSTNPIQRPNICQLL 293
                +  +K +I+ +LS NP++RP I ++L
Sbjct: 319 TDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 128/279 (45%), Gaps = 35/279 (12%)

Query: 26  NYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYI 85
           ++L  GGFA+ +  +I  +   ++   T  K  I   K    +L +E+   K + +   I
Sbjct: 86  HFLGEGGFARCF--QIKDDSGEIFAAKTVAKASIKSEKTRKKLL-SEIQIHKSMAHPN-I 141

Query: 86  VSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGV 145
           V ++D         ED   V +L+E C    L++ +                 T +   +
Sbjct: 142 VQFVDCF-------EDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFT--TQICGAI 192

Query: 146 YHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT 205
            +MH  +  ++HRD+K+ N+    + N K+ DFG ++ VL + +  +  +          
Sbjct: 193 KYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLANESERKYTIC--------G 241

Query: 206 TAQYRSPEMV---NLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG----K 258
           T  Y +PE++   +    F +    DIW+LG++LY L     PF+      I E      
Sbjct: 242 TPNYIAPEVLMGKHSGHSFEV----DIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRD 297

Query: 259 FTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           F++P     +D  K +IR +LS +PI+RP++ ++++ ++
Sbjct: 298 FSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYVW 336

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 124/275 (45%), Gaps = 32/275 (11%)

Query: 24  IENYLTSGGFAQVYTARITSEHKNLYPELTCLKRV-IVPNKQSLNILRAEVDAMKILKNN 82
           I++ +  G F  VY A   +       E+  +K V +  + + + +L  E+  +  LK+ 
Sbjct: 15  IQSCIGRGNFGDVYKAMDRTTQ-----EIVAIKVVNLEHSDEDIELLAQEIFFLAELKS- 68

Query: 83  KYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVS 142
             I +YI +    +        + ++MEYC G    D +                +  V+
Sbjct: 69  PLITNYITTMLEDVS-------MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVT 121

Query: 143 QGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDIL 202
            G+ ++H+ +   +HRDIK  N+LL+ +G  KL DFG VSG +RS    + FV       
Sbjct: 122 LGLKYLHEQRK--IHRDIKAANILLNEEGMVKLGDFG-VSGHIRSTMKRDTFV------- 171

Query: 203 KNTTAQYRSPEMVNLAL-GFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG--KF 259
              T  + +PE+V   + G+  NEK+DIW+LGI  Y+L     P  ++    +M    K 
Sbjct: 172 --GTPYWMAPEVVCCEVDGY--NEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKR 227

Query: 260 TYPAYP-QYTDSLKNIIRVLLSTNPIQRPNICQLL 293
             P     ++++ K  +   L   P  RP+   LL
Sbjct: 228 KPPKLQGSFSEAAKEFVAGCLVKAPADRPSAYDLL 262

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 125/290 (43%), Gaps = 48/290 (16%)

Query: 16  QVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDA 75
           +V +++++ +  +  G F +VY A     H+ +     CLK     +K   NI+R     
Sbjct: 37  EVGNYKILKQ--IGEGSFGKVYLALHRPTHRKV-----CLK---TSDKNDPNIVR----- 81

Query: 76  MKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXX 135
            ++  + ++   YI      +        V + +EYC G  L D  +             
Sbjct: 82  -EVFYHRQFDFPYITKLYEVIVTESK---VWMALEYCPGKELYD--HLLSLRRLSLLECG 135

Query: 136 XXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFV 195
                +S  VY+ H +    +HRD+K+EN+LL  +GN KL DFG     + + T+ E   
Sbjct: 136 ELFAQISGAVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDFGFTRECM-TKTTLETVC 192

Query: 196 YLQNDILKNTTAQYRSPEMVNLAL--GFPINEKSDIWALGILLYKLCYYTTPFEEHGSRA 253
                     T  Y +PE++      GF I    DIW+LG++LY L     PF++     
Sbjct: 193 ---------GTTVYMAPELIERKTYDGFKI----DIWSLGVILYTLITGYLPFDDDDEVK 239

Query: 254 IM------EGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
                   E K+     P   D  K++I  LL+ NP +RP++ Q+L   F
Sbjct: 240 TKWKIVNEEPKYDSKFIP---DDAKDLISRLLAKNPGERPSLPQVLRHPF 286

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 129/275 (46%), Gaps = 29/275 (10%)

Query: 27  YLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIV 86
           +L  GGFA+ +  +I  +   ++   T  K + + ++++   L +E+   K + +   IV
Sbjct: 86  FLGEGGFARCF--QIKDDSGKIFAAKTVAK-ISIKSEKTRKKLLSEIQIHKSMSHTN-IV 141

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
            +ID         ED+  V +L+E C    L++ +                MT +  G+ 
Sbjct: 142 QFIDCF-------EDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFF--MTQICGGIQ 192

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           +MH  +  ++HRD+K+ N+      N K+ DFG ++ VL +    +  +          T
Sbjct: 193 YMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFG-LAAVLANDRERKFTIC--------GT 241

Query: 207 AQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG----KFTYP 262
             Y +PE++ +      + + DIW++G++LY L     PF+      I E      F YP
Sbjct: 242 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAYP 300

Query: 263 AYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
              + +   K +I  +LS NP++RP+I ++++ ++
Sbjct: 301 KDKKISQDAKYLIDDILSLNPMERPSIQEIMDYVW 335

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 67/276 (24%), Positives = 128/276 (46%), Gaps = 29/276 (10%)

Query: 26  NYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYI 85
           ++L  GGFA+ +  +I  +   ++   T  K  I   K    +L +E+   K +K+   +
Sbjct: 86  HFLGEGGFARCF--QIKDDSGKIFAAKTVAKLSIKSEKTRKKLL-SEIQIHKSMKHQN-V 141

Query: 86  VSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGV 145
           V +ID         ED   V +L+E C    L+D +                 T +   +
Sbjct: 142 VQFIDCF-------EDDTNVYILLEICPNGSLMDLLKKRKLLTEPEVRFFT--TQICGAI 192

Query: 146 YHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT 205
            +MH  +  ++HRD+K+ N+    + N K+ DFG ++ VL +    +  V          
Sbjct: 193 KYMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVLANDRERKYTVC--------G 241

Query: 206 TAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKFTY 261
           T  Y +PE++ +      + + DIW++G++LY L     PF+      I E      F++
Sbjct: 242 TPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFSF 300

Query: 262 PAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           P     ++  K +I+ LLS +P++RP+I ++++ ++
Sbjct: 301 PKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYVW 336

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 84/162 (51%), Gaps = 22/162 (13%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            +  G+ H+H+    ++HRDIK ENV++   G  KL DFGS + V   P   + FV     
Sbjct: 1120 IISGISHLHE--SGIVHRDIKDENVIVDAKGFVKLIDFGSAAYVKNGPF--DVFV----- 1170

Query: 201  ILKNTTAQYRSPEMVNLAL--GFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGK 258
                 T  Y SPE++      G P     DIWALGILLY + +   PF  +    I+EG 
Sbjct: 1171 ----GTIDYASPEVLRGEKYEGKP----QDIWALGILLYTIVFKENPF--YNIDEILEGD 1220

Query: 259  FTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLE-ELFRI 299
              +P     + +  ++I+++L+ + ++RP+I  + E E  R+
Sbjct: 1221 MKFPETENISANCIDLIKLILNRSALERPSITDISEHEWLRV 1262

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 95/208 (45%), Gaps = 43/208 (20%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V + +EYC G  L +++                 + +   VY+ H ++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LAKKHIPLEECSELFSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 165 VLLSGDGNFKLCDFG-----SVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLA- 218
           +LL   G+ KL DFG     +  G+L +                  T  Y +PE++    
Sbjct: 159 ILLDKKGHAKLTDFGFTRECATKGILETICG---------------TTVYMAPELIERKP 203

Query: 219 -LGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTY------PAYP-QYTDS 270
             G+ I    D W+LGI+LY + + T PF+E     + E K  Y      P Y   Y DS
Sbjct: 204 YEGYKI----DTWSLGIILYTMIHGTMPFDE-----VDEVKTKYKIVHYNPTYDNDYIDS 254

Query: 271 -LKNIIRVLLSTNPIQRPNICQLLEELF 297
             K +I  LL  +P QRP++ Q+L+  F
Sbjct: 255 NGKELISQLLEKDPNQRPSLTQVLQHPF 282

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 82/158 (51%), Gaps = 19/158 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            V  G+ H+H+    ++HRDIK ENV++   G  KL DFGS + V   P   + FV     
Sbjct: 1095 VISGIKHLHE--QGIVHRDIKDENVIVDSKGFVKLIDFGSAAYVKSGPF--DVFV----- 1145

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEK-SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE++    G P   K  DIWA+GILLY + +   PF  +    IMEG  
Sbjct: 1146 ----GTIDYAAPEVLG---GEPYEGKPQDIWAVGILLYTIVFKENPF--YNIDEIMEGTL 1196

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
             +    + ++   N+I+ +L+ N  +RP I  + ++++
Sbjct: 1197 KFSIGSEVSEECVNLIKKILNKNAPKRPTIQDIYDDVW 1234

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 124/278 (44%), Gaps = 31/278 (11%)

Query: 24  IENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQS-LNILRAEVDAMKILKNN 82
           I+  +  G F  VY A I  E      E+  +K + +   Q  +++L  E+  +  L+  
Sbjct: 38  IKECVGKGSFGDVYRA-IDKETG----EMVAVKIINLEETQDDIDVLAQEIYFLSELRA- 91

Query: 83  KYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVS 142
            ++ +Y  ++   +        + ++ME+C G    D +                + +V 
Sbjct: 92  PFVTTYYKTYVEDVS-------MWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVL 144

Query: 143 QGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDIL 202
            G+ ++H  +   +HRD+K  N+LL+ +G  KL DFG VSG + +      FV       
Sbjct: 145 YGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG-VSGQIMATLKRNTFV------- 194

Query: 203 KNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGS-RAIMEGKFTY 261
              T  + +PE++    G+  +EK+DIW+LGI   +L     P+ ++   + +M      
Sbjct: 195 --GTPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRK 250

Query: 262 PAYPQ--YTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           P   Q  +T S ++ I + L+ +P  RP    LL   F
Sbjct: 251 PPRLQGRFTSSARDFIALCLTKDPALRPTASDLLSHKF 288

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 131/276 (47%), Gaps = 29/276 (10%)

Query: 26  NYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYI 85
           ++L  GGFA+ +  +I  E   ++   T  K + + ++++   L +E+   K +++   +
Sbjct: 95  HFLGEGGFARCF--QIKDESGKIFAAKTVAK-ISIKSEKTRKKLLSEIQIHKSMRHFN-V 150

Query: 86  VSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGV 145
           V +ID         ED   V +L+E C    L++ +                MT +   +
Sbjct: 151 VQFIDCF-------EDDTNVYILLEICPNGSLMELLKKRRTVTEPEVRYF--MTQICGAI 201

Query: 146 YHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT 205
            +MH  +  ++HRD+K+ N+    + N K+ DFG ++ VL +    +  V          
Sbjct: 202 KYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVLANDRERKYTVC--------G 250

Query: 206 TAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG----KFTY 261
           T  Y +PE++ +      + + DIW++G+++Y L     PF+      I E      F +
Sbjct: 251 TPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNMIYERIKNRDFAF 309

Query: 262 PAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           P     ++  K +I  +LST+P++RP+I ++++ ++
Sbjct: 310 PKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYVW 345

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 128/278 (46%), Gaps = 35/278 (12%)

Query: 27  YLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIV 86
           +L  GGFA+ +  +I  E   ++   T  K + +  +++   L +E+   K +K+   IV
Sbjct: 97  FLGEGGFARCF--QIKDESGKIFAAKTVAK-ISIKTEKTKKKLLSEIQIHKSMKHPN-IV 152

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
            ++D         ED   V +L+E CS   L+D M                 T +   V 
Sbjct: 153 HFVDCF-------EDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFT--TQICGAVK 203

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           +MH  +  ++HRD+K+ N+    D N K+ DFG ++ VL +    +  V          T
Sbjct: 204 YMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFG-LAAVLANNRERKYTVC--------GT 252

Query: 207 AQYRSPEMV---NLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKF 259
             Y +PE++   +    F +    DIW++G+++Y L     PF+      I +     ++
Sbjct: 253 PNYIAPEVLMGKHAGHSFEV----DIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQY 308

Query: 260 TYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
            YP     +   K +I  +L  +P++RP+I +++++++
Sbjct: 309 GYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDVW 346

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 88/201 (43%), Gaps = 37/201 (18%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V + +EYC G  L D +                   ++  V++ H L    +HRD+K+EN
Sbjct: 108 VWMALEYCPGKELYDHL--LSKSRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLEN 163

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLAL--GFP 222
           VLL  +GN KL DFG          + E       + +  TT  Y +PEM+      GF 
Sbjct: 164 VLLDKNGNAKLTDFG---------FTRESMTKAVLETVCGTTV-YMAPEMIQHKPYDGF- 212

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEH----------GSRAIMEGKFTYPAYPQYTDSLK 272
              K DIW+LG++LY L     PF+E               +++ + T P         +
Sbjct: 213 ---KVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIP-------EAQ 262

Query: 273 NIIRVLLSTNPIQRPNICQLL 293
           N+I  LLS +P +RPN   +L
Sbjct: 263 NLIEQLLSKDPTERPNTSAIL 283

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 115/248 (46%), Gaps = 47/248 (18%)

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           ++ EV  +  LK    I  Y  S+   L N+E    + ++MEYC+G  L   +       
Sbjct: 62  VQKEVQFLSSLKQVPNITHYYGSY---LNNTE----LWVIMEYCAGGSLRTLLRPGKIGE 114

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    M ++   + H+H+    ++HRDIK  NVL++ DG+ KLCDFG V+  L   
Sbjct: 115 QYIGVI---MRELLIALMHIHKDG--VIHRDIKAANVLITNDGHIKLCDFG-VAAQLS-- 166

Query: 189 TSSEEFVYLQNDILKNTTAQ---YRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTP 245
                    Q  I + T A    + +PE++   + +  + K DIW+LGI  Y++     P
Sbjct: 167 ---------QTKIRRQTMAGTPYWMAPEVIMEGVYY--DTKVDIWSLGITAYEIATGNPP 215

Query: 246 F-EEHGSRAI----------MEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLE 294
           + +    RA+          +EG+       Q++ +LK  I + L  +P +RP+  +LL+
Sbjct: 216 YCDVEALRAMQLITKSKPPRLEGR-------QHSSALKEFIALCLDEDPKERPSAEELLK 268

Query: 295 ELFRIQHK 302
             F   HK
Sbjct: 269 TKFIRLHK 276

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 92/200 (46%), Gaps = 27/200 (13%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V +  EYC G  L D +                 T +   VY+ H L    +HRD+K+EN
Sbjct: 104 VWMAQEYCPGKDLYDHV--LSLQRVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLEN 159

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLAL--GFP 222
           +LL  +GN KL DFG     + + TS E             T  Y +PE++      GF 
Sbjct: 160 ILLDKNGNAKLTDFGFTRECM-TKTSLETIC---------GTTVYMAPELIKRESYDGFK 209

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSL-----KNIIRV 277
           I    DIW+LG++LY +   + PF+E       E K      P + D++     K+++  
Sbjct: 210 I----DIWSLGVILYTMLNGSMPFDED-DETKTEWKI-MNEMPVFNDTILSEDAKDLLIK 263

Query: 278 LLSTNPIQRPNICQLLEELF 297
           LLS +P +RP++ ++L   F
Sbjct: 264 LLSKDPNERPSMQEILHHPF 283

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/348 (21%), Positives = 139/348 (39%), Gaps = 69/348 (19%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARIT--SEHKNLYPELTCLKRVIVPNKQSL 66
           +  G ++ +     ++   L  G    +Y  +    S    +Y     LK+V  P  ++ 
Sbjct: 18  WFDGVRISINGKSYLVTTLLREGELTALYQVKCPKRSHSGGVYA----LKKVTCPIGRAD 73

Query: 67  NILRAEVDAMKILK-NNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXX 125
            + RA  +     + N+ YI + +D      Q+   + ++ +L+ Y     L D +N   
Sbjct: 74  FVTRAMTEISNYQRFNSPYITNILDFQVA--QHDNGTKIIYMLLPYFPAGSLQDLINNMI 131

Query: 126 XX--XXXXXXXXXXMTDVSQGVYHMHQ--------------------------------- 150
                         M D+ +GV  MH+                                 
Sbjct: 132 IRGDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAM 191

Query: 151 ----LQPPL--------LHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP---TSSEEFV 195
               L PPL        +H  +  EN++LS +G   L    +++  +R+P   TS+ + +
Sbjct: 192 ELDLLSPPLTNSEPSAYVHCGLNPENIMLSSEG---LPVIYNMASCVRAPLELTSNSKLL 248

Query: 196 YLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGS---- 251
            LQ  + +N+   Y  PE+++L     I  + DIW+LG + Y L Y  + F         
Sbjct: 249 GLQEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGT 308

Query: 252 ---RAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEEL 296
               +I  G F++P  P+Y+ SLK I++  L  +P +RP+I + L + 
Sbjct: 309 PIKHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQF 356

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 92/200 (46%), Gaps = 27/200 (13%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V + +EYC G  L D +                   +  GV++ H L    +HRD+K+EN
Sbjct: 104 VWMALEYCPGKELYDRV--LSMHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLEN 159

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLAL--GFP 222
           +LL   G+ KL DFG     + + T+ E             T  Y +PE++      GF 
Sbjct: 160 ILLDKSGDAKLTDFGFTRECM-TKTTLETIC---------GTTVYMAPELIERKSYDGFK 209

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSL-----KNIIRV 277
           I    DIW+LG++LY +   + PF+E       E K  +   PQ  +++     K++I  
Sbjct: 210 I----DIWSLGVILYTMINGSMPFDED-DETKTEWKIVHQT-PQLNENIVTADAKDLILR 263

Query: 278 LLSTNPIQRPNICQLLEELF 297
           LL+ NP  RP + Q+L+  F
Sbjct: 264 LLAKNPNDRPTVEQILKHPF 283

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 92/203 (45%), Gaps = 33/203 (16%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V + +EYC G  L + +                   +   V++ H L    +HRD+K+EN
Sbjct: 103 VWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLEN 158

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLAL--GFP 222
           +LL  +GN KL DFG     + S +S E             T  Y +PE++      GF 
Sbjct: 159 ILLDKNGNAKLTDFGFTRECV-SKSSLETIC---------GTTVYMAPELIQRQAYDGFK 208

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPA---YPQYTDSL-----KNI 274
           I    DIW+LG++LY +   T PF+E       E K  +     +P + D+      K++
Sbjct: 209 I----DIWSLGVILYTMINGTMPFDEDD-----ETKTKWKIVNDFPNFNDNFVSHEAKDL 259

Query: 275 IRVLLSTNPIQRPNICQLLEELF 297
           I+ LL+  P +RP + Q+L   F
Sbjct: 260 IKRLLAKCPSERPTMEQILSHPF 282

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 77/150 (51%), Gaps = 19/150 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            +  G+ H+H     ++HRDIK ENV++   G  KL DFGS + V   P   + FV     
Sbjct: 1298 IVSGIKHLHD--QAIIHRDIKDENVIVDATGFVKLIDFGSAAHVKSGPF--DVFV----- 1348

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEK-SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE+++   G P   K  DIWA+GILLY + +   PF  +    I+EG+ 
Sbjct: 1349 ----GTIDYAAPEVLS---GDPYEGKPQDIWAIGILLYTIVFKENPF--YNIDEILEGEL 1399

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNI 289
            T+      +   K +I ++L+ N  +RP I
Sbjct: 1400 TFSESSDVSAECKALISMILNRNVQKRPTI 1429

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 94/214 (43%), Gaps = 37/214 (17%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V + +EYC G  L +++                 + +   V++ H ++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 165 VLLSGDGNFKLCDFG-----SVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLA- 218
           +LL   G  KL DFG     +  G+L +                  T  Y +PE++    
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGILETVCG---------------TTVYMAPELIERKP 203

Query: 219 -LGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSL-----K 272
             G+ I    D W+LGI+LY + +   PF+E     I          P Y D+      K
Sbjct: 204 YEGYKI----DTWSLGIILYTMIHGAMPFDEEDD--IKTKYRIVNNEPFYDDNFIDANGK 257

Query: 273 NIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPL 306
           ++I  LL  +P QRP++ Q+L+  F   H SS L
Sbjct: 258 DLIMQLLQKDPSQRPSLTQVLQHPFMFPHGSSIL 291

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 101/241 (41%), Gaps = 58/241 (24%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V + +EYC G  L + +                   +   +Y+ H L    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEHL--LALKRISLDECSRLFAQIVGAIYYAHSLN--CVHRDLKLEN 158

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLAL--GFP 222
           +LL   GN KL DF    G  R   S  +      D +  TT  Y +PE+       GF 
Sbjct: 159 ILLDKKGNAKLTDF----GFTRECVSKSQL-----DTICGTTV-YMAPELTERKSYDGFK 208

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYP---AYPQYTDSL-----KNI 274
           I    DIWALG++LY +   + PF+E       E K  +      P+  + L     K++
Sbjct: 209 I----DIWALGVILYTMINGSMPFDEDD-----EAKTKWKIVNEMPEINEDLVSPDAKDL 259

Query: 275 IRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPNFYVQRAMSSLQMDTTQPHRIPILKYT 334
           I  LL+ +P +RP+I ++L   F                          QP+ IP+++ T
Sbjct: 260 IEQLLAKDPNERPSIEKILTHPF-------------------------LQPYGIPLMEKT 294

Query: 335 Q 335
           Q
Sbjct: 295 Q 295

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 98/204 (48%), Gaps = 26/204 (12%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           + ++MEYC+G  +   +                M ++   ++++H+    ++HRDIK  N
Sbjct: 114 LWIIMEYCAGGSVRTLL---RPGKIDEKYIAVIMRELLVALHYIHKDN--VIHRDIKAAN 168

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQ---YRSPEMVNLALGF 221
           +L++ +GN KLCDFG V+  L            QN + + T A    + +PE++    G 
Sbjct: 169 LLITNEGNVKLCDFG-VAAQLN-----------QNTMRRQTMAGTPYWMAPEVI--MEGI 214

Query: 222 PINEKSDIWALGILLYKLCYYTTPF-EEHGSRAIMEGKFTYPAYPQ---YTDSLKNIIRV 277
             + K+DIW++GI  Y++     PF E    RA+     + PA  +   +   LK  I +
Sbjct: 215 SYDTKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKPARLEGKNHDPLLKEFIAM 274

Query: 278 LLSTNPIQRPNICQLLEELFRIQH 301
            L  +P +RP   +LL E   I+H
Sbjct: 275 CLDEDPQERPTADKLLHESAFIKH 298

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 92/200 (46%), Gaps = 27/200 (13%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V + +EYC G  L D++                   +   VY+ H L    +HRD+K+EN
Sbjct: 103 VWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLEN 158

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLAL--GFP 222
           +LL   GN KL DF    G  R   +  +      + +  TT  Y +PE++      GF 
Sbjct: 159 ILLDMQGNAKLADF----GFTRECATKNQL-----ETICGTTV-YMAPELLRRDTYDGFK 208

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKN-----IIRV 277
           I    DIW+LG++LY L   + PF+E       E K      P Y + + N     +I+ 
Sbjct: 209 I----DIWSLGVILYTLINGSMPFDEE-DETRTEWKIINEE-PDYNEKIFNANSIELIKS 262

Query: 278 LLSTNPIQRPNICQLLEELF 297
           LL  +P +RP++ ++L+  F
Sbjct: 263 LLIKDPKKRPSMTEILKHKF 282

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 126/275 (45%), Gaps = 29/275 (10%)

Query: 27  YLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIV 86
           +L  GGFA+ +  +I  +   ++   T  K  I   K    +L +E+   K +++   IV
Sbjct: 106 FLGEGGFARCF--QIKDDSGKIFAAKTVAKLSIKTEKTRKKLL-SEIQIHKSMRHAN-IV 161

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
            +ID         ED   V +L+E C    L++ +                 T +  G+ 
Sbjct: 162 QFIDCF-------EDETNVYILLEICPNGSLMELLKKRKTLTEPEVRFFT--TQICGGIK 212

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           +MH  +  ++HRD+K+ N+    + N K+ DFG ++ VL +    +  V          T
Sbjct: 213 YMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVLANDRERKYTVC--------GT 261

Query: 207 AQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKFTYP 262
             Y +PE++ +      + + DIW++G+++Y L     PF+      I E      F +P
Sbjct: 262 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFVFP 320

Query: 263 AYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
                +   + +++ LLS +P++RP+I ++L+ ++
Sbjct: 321 KEKYISSEARILVQDLLSLDPLERPSIMEVLDYVW 355

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 79/153 (51%), Gaps = 19/153 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            V   + H+H     ++HRDIK ENV++   G  KL DFGS + V   P   + FV     
Sbjct: 1120 VVSAIRHLHSQG--IVHRDIKDENVVVDSKGFVKLIDFGSAAYVKSGPF--DVFV----- 1170

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEK-SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE+++   G P + K  DIWA+G+LLY + +   PF  +    I+E   
Sbjct: 1171 ----GTIDYAAPEVLS---GEPFDGKPQDIWAIGVLLYTIVFKENPF--YNIDEILEVNL 1221

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQL 292
             +      ++   N+I+++L+ NP QRP I ++
Sbjct: 1222 KFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 95/205 (46%), Gaps = 20/205 (9%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           + ++MEYC+G  L   +                M +V   +  +H+    ++HRDIK  N
Sbjct: 95  LWIIMEYCAGGSLRSLL---RPGKIDEKYIGVIMREVLVALKCIHKDN--VIHRDIKAAN 149

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPIN 224
           VL++ +GN KLCDFG  + V ++    +             T  + +PE++    G   +
Sbjct: 150 VLITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYD 198

Query: 225 EKSDIWALGILLYKLCYYTTPF-EEHGSRA---IMEGKFTYPAYPQYTDSLKNIIRVLLS 280
            K DIW+LGI  Y++     P+ E    RA   I++ K        Y+ SLK  I + L 
Sbjct: 199 TKVDIWSLGITTYEIATGNPPYCEVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLD 258

Query: 281 TNPIQRPNICQLLEELFRIQHKSSP 305
            +P +R +   LL+  F   HK++P
Sbjct: 259 EDPKERLSADDLLKSKFIKNHKTTP 283

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 80/158 (50%), Gaps = 19/158 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            +  G+ H+H     ++HRDIK ENV++   G  KL DFGS + V   P   + FV     
Sbjct: 1064 IVSGIKHLHD--QGIVHRDIKDENVIVDSKGFVKLIDFGSAAYVKSGPF--DVFV----- 1114

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEKS-DIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE++    G P   KS DIWA+GILLY L Y   PF  +    I+EG+ 
Sbjct: 1115 ----GTIDYAAPEVLG---GNPYEGKSQDIWAIGILLYTLIYKENPF--YNIDEILEGEL 1165

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
             +      +   K +I  +L+    +RP I ++ ++++
Sbjct: 1166 RFNDSADVSQECKALITKILNRCVRKRPTIDEICQDVW 1203

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 78/154 (50%), Gaps = 19/154 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            +  G+ ++H     ++HRDIK ENV++  +G  KL DFGS +     P   E FV     
Sbjct: 913  IVSGIKYLHD--QGIVHRDIKDENVIVDSNGFVKLIDFGSAAYTKTGPF--EVFV----- 963

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEK-SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE++    G P   K  DIWALG+LLY L Y   PF  +    I+EG+ 
Sbjct: 964  ----GTIDYAAPEILG---GNPYKGKPQDIWALGVLLYTLIYKENPF--YNVDEILEGQL 1014

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLL 293
             +      T    ++IR +L+ +   RP+I +++
Sbjct: 1015 RFDGTCNVTQDCIDLIRWILTKSVNDRPSIDEIV 1048

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 118/268 (44%), Gaps = 38/268 (14%)

Query: 51   ELTCLKRVIVPNKQS--------LNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDS 102
            E+  +K+V VP   S        L  LR+EV  +K L ++  IV Y+       +N   +
Sbjct: 1170 EMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDL-DHTNIVQYLG-----FENK--N 1221

Query: 103  YVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKI 162
            YV  L +EY +G  +   +                   V +G+ ++H  +  +LHRD+K 
Sbjct: 1222 YVYSLFLEYVAGGSVGSLIRLYGKFDENLIRFL--AVQVLRGLSYLHSKK--ILHRDMKA 1277

Query: 163  ENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFP 222
            +N+LL  DG  K+ DFG         +     +Y  +D+    T  + +PEMV+   G+ 
Sbjct: 1278 DNLLLDVDGICKISDFGI--------SKKSNNIYSNSDMTMRGTVFWMAPEMVDTKQGY- 1328

Query: 223  INEKSDIWALGILLYKLCYYTTPFEEHGSRAIM--EGKF-TYPAYPQYTDSL-----KNI 274
             + K DIW+LG ++ ++     P+      A M   GKF + P  P+ T  +     K  
Sbjct: 1329 -SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKEF 1387

Query: 275  IRVLLSTNPIQRPNICQLLEELFRIQHK 302
            +      NP +RP   +LL   F I  K
Sbjct: 1388 LDACFEINPEKRPTADELLSHPFCIVDK 1415

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 101/212 (47%), Gaps = 22/212 (10%)

Query: 107 LLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVL 166
           +L EY SG  LLD++                   V+  + ++H     ++HRD+KIEN++
Sbjct: 202 MLFEYVSGGQLLDYI--IQHGSLREHHARKFARGVASALQYLHANN--IVHRDLKIENIM 257

Query: 167 LSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEK 226
           +S  G  K+ DFG +S V  +      F           +  + +PE+  L     I  +
Sbjct: 258 ISTSGEIKIIDFG-LSNVFDTRKQLHTFC---------GSLYFAAPEL--LKANPYIGPE 305

Query: 227 SDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKFTYPAYPQYTDSLKNIIRVLLSTN 282
            DIW+ G++LY L     PF++  S      I +GK  YP +   +  + +++  +L  +
Sbjct: 306 VDIWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPNH--LSIEVISLLSKMLVVD 363

Query: 283 PIQRPNICQLLEELFRIQHKSSPLPNFYVQRA 314
           P++R N+ +++E  + I+    P P++  +R+
Sbjct: 364 PLKRANLTKVIEHPWMIRGYDFPPPSYLPKRS 395

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 125/275 (45%), Gaps = 29/275 (10%)

Query: 27  YLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIV 86
           +L  GGFA+ +  +I  +   L+   T  K  I   K    +L +E+   K +K+   IV
Sbjct: 150 FLGEGGFARCF--QIRDDSGKLFAAKTVAKLSIKTEKTRKKLL-SEIQIHKSMKHQN-IV 205

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
            +ID         ED   V +L+E C    L++ +                 T +   + 
Sbjct: 206 QFIDCF-------EDDTNVYILLEICPNGSLMELLKKRKQLTEPEVRFFT--TQICGAIK 256

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           +MH  +  ++HRD+K+ N+    + N K+ DFG ++ VL +    +  V          T
Sbjct: 257 YMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVLANDRERKFTVC--------GT 305

Query: 207 AQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKFTYP 262
             Y +PE++ +      + + D+W++G+++Y L     PF+      I E      F +P
Sbjct: 306 PNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDFIFP 364

Query: 263 AYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
                +   K +++ LLS +P++RP+I ++++ ++
Sbjct: 365 KEKPISHEAKVLVQDLLSLDPLERPSISEIMDYVW 399

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 95/212 (44%), Gaps = 34/212 (16%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           + ++MEYC+G  L   +                M ++   + ++H+    ++HRDIK  N
Sbjct: 98  LWIIMEYCAGGSLRTLLRPGKIDEKYIGVI---MRELLVALLYIHKDN--VIHRDIKAAN 152

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPIN 224
           VL++ DG  KLCDFG  + + +S    +             T  + +PE++    G   +
Sbjct: 153 VLITNDGRVKLCDFGVAAQLTQSNVRRQTMA---------GTPYWMAPEVI--MEGVYYD 201

Query: 225 EKSDIWALGILLYKLCYYTTPF-EEHGSRAI----------MEGKFTYPAYPQYTDSLKN 273
            K DIW+LGI  Y++     P+ +    RA+          +EG+       QY+  LK 
Sbjct: 202 TKVDIWSLGITTYEITTGNPPYCDVEALRAMQLITKSKPPRLEGR-------QYSPLLKE 254

Query: 274 IIRVLLSTNPIQRPNICQLLEELFRIQHKSSP 305
            I + L  +P +R     LL+  F   HKSSP
Sbjct: 255 FIALCLDEDPKERLAAEDLLKTRFIKTHKSSP 286

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 124/279 (44%), Gaps = 32/279 (11%)

Query: 24  IENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQS-LNILRAEVDAMKILKNN 82
           I+  +  G F  V+ A     H+    E+  +K + +   Q  +++L  E+  +  L+  
Sbjct: 41  IKECVGKGSFGDVFRAT----HRQT-GEVVAIKIINLEETQDDIDVLAQEIYFLSELRA- 94

Query: 83  KYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVS 142
            ++ +Y  +    +        + ++ME+C G    D +                + +V 
Sbjct: 95  PFVTTYFKTFVEDVS-------MWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVL 147

Query: 143 QGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDIL 202
            G+ ++H  +   +HRDIK  N+LL+ DG  KL DFG VSG + +      FV       
Sbjct: 148 FGLDYLHSQKK--IHRDIKAANILLTDDGEVKLGDFG-VSGQIMATLKRTTFV------- 197

Query: 203 KNTTAQYRSPEMVNLAL-GFPINEKSDIWALGILLYKLCYYTTPFEEHGS-RAIMEGKFT 260
              T  + +PE++     G+  NEK+DIW+LGI   +L     P+ +H   + ++     
Sbjct: 198 --GTPYWMAPEIIAKKDNGY--NEKADIWSLGITAIELLTGQPPYAKHDPMKVLVNIPLR 253

Query: 261 YPAYPQ--YTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
            P   Q  +T S ++ I + L  +P  RP+  +LL   F
Sbjct: 254 KPPKLQGRFTGSARDFIALCLIKDPDLRPSAAELLGHKF 292

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 93/203 (45%), Gaps = 33/203 (16%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V + +EYC G  L D +                 + +   VY+ H L    +HRD+K+EN
Sbjct: 112 VWMALEYCPGRELYDHV--LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKLEN 167

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLAL--GFP 222
           +LL  DGN KL DFG     +       E V L+   +  TT  Y +PE+       GF 
Sbjct: 168 ILLDKDGNAKLTDFGFTRECM-------EKVNLE--TICGTTV-YMAPELTERKPYDGFK 217

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYP---AYPQY-----TDSLKNI 274
           I    DIW+LG++LY +   + PF+E       E K  +      P+Y     T   +++
Sbjct: 218 I----DIWSLGVILYTMLSGSMPFDEDD-----EAKTKWKIINEEPEYNSKFMTAEGEDL 268

Query: 275 IRVLLSTNPIQRPNICQLLEELF 297
           +R LL  +   RP++ ++L+  F
Sbjct: 269 VRKLLQKDSNLRPSVREILQHEF 291

>NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {ON}
           Anc_6.262 YPL236C
          Length = 406

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 76/153 (49%), Gaps = 9/153 (5%)

Query: 157 HRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVN 216
           HR+IK  N+L S DG+  + D  S S       + ++ +  +  I    +  + SPE+++
Sbjct: 251 HRNIKPSNILFSSDGSQVISDLSSTSKSNIHLKTGKQILDFKEWIDSCCSVPFMSPELLD 310

Query: 217 LALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRA-------IMEGKFTYPAYPQYTD 269
           L +G  I+EK DIW+LG  +Y +    +PFE             I+   FT+P   +   
Sbjct: 311 LKMGSKIDEKVDIWSLGCTIYTIILGVSPFEREVQLTGKSIRMLILSANFTFPEGMERHA 370

Query: 270 S--LKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
           S  L + I+  L  +P +RP I QLL +L  +Q
Sbjct: 371 SRELIDTIKQCLQVDPTKRPTINQLLNDLQALQ 403

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 109/244 (44%), Gaps = 33/244 (13%)

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           ++ E+  +  LK    I  Y  S+   LQ++     + ++MEYC+G  L   +       
Sbjct: 87  VQREIQFLASLKQVPNITRYYGSY---LQDTN----LWIIMEYCAGGSLRTLLRPGMIDE 139

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    +    Q ++  +     ++HRDIK  NVL++ +G  KLCDFG V+  L   
Sbjct: 140 KYIGVIMRELLTALQCIHKDN-----VIHRDIKAANVLITNEGKVKLCDFG-VAAQLN-- 191

Query: 189 TSSEEFVYLQNDILKNTTAQ---YRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTP 245
                    Q  + + T A    + +PE++    G   + K DIW+LGI  Y++     P
Sbjct: 192 ---------QTSLRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPP 240

Query: 246 F-EEHGSRAIMEGKFTYPAY---PQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQH 301
           + E    RA+     + PA     QY+  LK  I + L  +P +R +  +L +  F   H
Sbjct: 241 YCEIEALRAMQLITKSKPARLEGRQYSSGLKEFIALCLDEDPKERLSAEELQKSKFIKAH 300

Query: 302 KSSP 305
           KSSP
Sbjct: 301 KSSP 304

>KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86
           YAL017W
          Length = 368

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 72/141 (51%), Gaps = 17/141 (12%)

Query: 155 LLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEM 214
           ++HRDIK EN+++   G+ +L DFGS +  +R P  +    +L        T  Y  PE+
Sbjct: 238 IVHRDIKDENIIMDARGHIQLIDFGSATNAVRGPFRT----FL-------GTIDYEPPEV 286

Query: 215 VNLALGFP-INEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKN 273
              A G P + +  DIWALGILLY L +   PF +   +AI+ G   +P          +
Sbjct: 287 ---ARGEPFLGKPQDIWALGILLYILRFKEPPFLDQ--KAILTGDLKFPQGTSVNTDCID 341

Query: 274 IIRVLLSTNPIQRPNICQLLE 294
           +I  +LS    +RP I  ++E
Sbjct: 342 LINAILSPRVDERPTIDDIVE 362

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 124/276 (44%), Gaps = 39/276 (14%)

Query: 28  LTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAE---VDAMKILKNNKY 84
           L  GGFA+ +  +      ++     C     + +K+S+   R +   +  ++I +N +Y
Sbjct: 99  LGEGGFARCFHIK-----DDVGISFACK----IVSKKSIKTERTKFKLLSEIQIHQNLRY 149

Query: 85  --IVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVS 142
             IV ++D         ED   V +L+E C    L+D +                 T V 
Sbjct: 150 SHIVKFMDCF-------EDELNVYILLELCPNGSLMDLL--KKRKILTEAEVKFMTTQVC 200

Query: 143 QGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDIL 202
             + +MH     ++HRD+K+ NV    + N K+ DFG  + +  S  S +++        
Sbjct: 201 GAINYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL--SNVSEKKYTMC----- 251

Query: 203 KNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG----K 258
              T  Y +PE++ L+     + ++DIW+LGI++Y +     PF+      I E     +
Sbjct: 252 --GTPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQ 308

Query: 259 FTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLE 294
           + +P     T+ +K +I+ LL  +P QRP I  +L+
Sbjct: 309 YEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 93/198 (46%), Gaps = 23/198 (11%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V + +EYC G  L D++                   +   V++ H LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLAL--GFP 222
           +LL  +G   L DFG          + E     Q + +  TT  Y +PE++      G+ 
Sbjct: 159 ILLDKNGYAMLTDFG---------FTRECATKTQLETVCGTTV-YMAPELIKREAYDGYK 208

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGS-RAIMEGKFTYPA-YPQYTD-SLKNIIRVLL 279
           +    D W+LGI+LY + +   PF+E  + R  ++     PA   +YT    K++I  LL
Sbjct: 209 V----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLL 264

Query: 280 STNPIQRPNICQLLEELF 297
             N  QRPN+ ++L+  F
Sbjct: 265 DKNAAQRPNLNEVLQHPF 282

>Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205W
           (REAL)
          Length = 815

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 124/282 (43%), Gaps = 29/282 (10%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSLN 67
           YK+  K      +  +   L  G F QVY  +   + K +Y      K+VIV  N+ +  
Sbjct: 390 YKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVK-KKDTKRIYAMKVLSKKVIVKKNEIAHT 448

Query: 68  ILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXX 127
           I    +      K++ +IV    S     Q   D Y+V    +Y SG  L  F +     
Sbjct: 449 IGERNILVTTASKSSPFIVGLKFS----FQTPADLYLV---TDYMSGGEL--FWHLQKEG 499

Query: 128 XXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRS 187
                     + ++   + H+H     +++RD+K EN+LL  +GN  LCDFG     L+ 
Sbjct: 500 RFSEDRAKFYIAELVLALEHLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLKD 557

Query: 188 PTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTP-F 246
            T++  F           T +Y +PE++    G+   +  D W+LG+L++++C   +P F
Sbjct: 558 RTNT--FC---------GTTEYLAPELLLDETGY--TKMVDFWSLGVLIFEMCCGWSPFF 604

Query: 247 EEHGSRAIMEGKFTYPAYPQ--YTDSLKNIIRVLLSTNPIQR 286
            E+  +   +  F    +P+   +   ++ ++ LL+ NP  R
Sbjct: 605 AENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHR 646

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 109/232 (46%), Gaps = 31/232 (13%)

Query: 73  VDAMKILKNNKY--IVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXX 130
           ++ + ++K +K+  IV++IDS+   L + +    + ++MEY  G  L D +         
Sbjct: 670 INEILVMKGSKHPNIVNFIDSY---LLDGD----LWVIMEYMEGGSLTDVV---THCILT 719

Query: 131 XXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTS 190
                    +   G+  +H     +LHRDIK +N+LLS +GN KL DFG  + V  +   
Sbjct: 720 EGQIGAVCRETLSGLQFLHSKG--VLHRDIKSDNILLSINGNIKLTDFGFCAQVNETTLK 777

Query: 191 SEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPF-EEH 249
               V          T  + +PE+V+     P   K DIW+LGI++ ++     P+  E 
Sbjct: 778 RTTMV---------GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNET 825

Query: 250 GSRAI----MEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
             RA+      G        + +D LK+ +   LS NP QR +  +LLE++F
Sbjct: 826 PLRALYLIATNGTPELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDVF 877

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/278 (22%), Positives = 127/278 (45%), Gaps = 35/278 (12%)

Query: 27  YLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIV 86
           +L  GGFA+ +  ++  +   ++   T  K + + ++++   L +E+   K +K+   IV
Sbjct: 78  FLGEGGFARCF--QMKDDSGKVFAAKTVAK-ISIKSEKTRKKLLSEIQIHKSMKHPN-IV 133

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
            + D         ED   V +L+E C    L+D +                 T +   + 
Sbjct: 134 QFTDCF-------EDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFT--TQIVGAIK 184

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           +MH  +  ++HRD+K+ N+      N K+ DFG ++ VL +    +  +          T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVLANDRERKYTIC--------GT 233

Query: 207 AQYRSPEMV---NLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKF 259
             Y +PE++   +    F +    DIW++G+++Y L     PF+      I E      F
Sbjct: 234 PNYIAPEVLTGKHTGHSFEV----DIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDF 289

Query: 260 TYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           ++P     +   K +I+ +LS +P++RP++ +++E ++
Sbjct: 290 SFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYVW 327

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 127/272 (46%), Gaps = 32/272 (11%)

Query: 31  GGFAQVYTARITSEHKNLYPELTCLKRV-IVPNKQSLNILRAEVDAMKILKNNKYIVSYI 89
           G F  VY AR  + +     E+  +K V +    + +++L  E+  +  L++  YI +Y 
Sbjct: 29  GNFGDVYKARYLATN-----EIVAIKVVNLEDTDEPIDLLAQEIFFLSELRS-PYITNYK 82

Query: 90  DSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMH 149
            +    +        + ++MEYC G    + +                +++V  G+ ++H
Sbjct: 83  TAFLVDVS-------MWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVLVGLDYLH 135

Query: 150 QLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQY 209
             +   +HRDIK  N+LL+ +G+ KL DFG VSG +      + FV          T  +
Sbjct: 136 SQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV---------GTPFW 183

Query: 210 RSPEMVNL-ALGFPINEKSDIWALGILLYKLCYYTTPFEEHGS-RAIMEGKFTYPAY--P 265
            +PE+++    G+  NE +DIW+LGI + +L     P +++ + +A+M      P     
Sbjct: 184 MAPEVIDRNKKGY--NEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPPKLDK 241

Query: 266 QYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           +++   K+ +   L  +P QRP   +LL+  F
Sbjct: 242 RFSSHAKDFVAQCLIKDPSQRPTASELLKHRF 273

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 74/150 (49%), Gaps = 19/150 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            V  GV H+H     ++HRDIK EN+++   G  K+ DFGS + V   P   + FV     
Sbjct: 1239 VVSGVKHLHD--QGIVHRDIKDENIIVDNKGFIKIIDFGSAAYVKSGPF--DVFV----- 1289

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEK-SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE++    G P   K  DIWALGILLY + +   PF  +    I+EG  
Sbjct: 1290 ----GTIDYAAPEVLG---GNPYEGKPQDIWALGILLYTIVFKENPF--YNIDEILEGDL 1340

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNI 289
             +      +     +I+++L+ N  +RP I
Sbjct: 1341 KFNDPENISQDCIELIKLILNRNVFKRPTI 1370

>Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W
           (REAL)
          Length = 824

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 124/282 (43%), Gaps = 29/282 (10%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSLN 67
           YK+  K      +  +   L  G F QVY  +   + + +Y      K+VIV  N+ +  
Sbjct: 399 YKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVK-KKDTQRIYAMKVLSKKVIVKKNEIAHT 457

Query: 68  ILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXX 127
           I    +      K++ +IV    S     Q   D Y+V    +Y SG  L  F +     
Sbjct: 458 IGERNILVTTASKSSPFIVGLKFS----FQTPTDLYLV---TDYMSGGEL--FWHLQKEG 508

Query: 128 XXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRS 187
                     + ++   + H+H     +++RD+K EN+LL  +GN  LCDFG     L+ 
Sbjct: 509 RFSEDRAKFYIAELVLALEHLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLKD 566

Query: 188 PTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTP-F 246
            T++  F           T +Y +PE++    G+   +  D W+LG+L++++C   +P F
Sbjct: 567 RTNT--FC---------GTTEYLAPELLLDETGY--TKMVDFWSLGVLIFEMCCGWSPFF 613

Query: 247 EEHGSRAIMEGKFTYPAYPQ--YTDSLKNIIRVLLSTNPIQR 286
            E+  +   +  F    +P+   +   ++ ++ LL+ NP  R
Sbjct: 614 AENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHR 655

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 101/220 (45%), Gaps = 32/220 (14%)

Query: 85  IVSYIDSHAN---RLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDV 141
           ++  + SH N    L+  E+   + L++EY  G  L D++                 T +
Sbjct: 178 VIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYL--VSKGKLSEPEAVHYFTQI 235

Query: 142 SQGVYHMHQLQPPLLHRDIKIENVLLSGDGN-FKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            QGV + H     + HRD+K EN+LL       K+ DFG  +            + L N 
Sbjct: 236 IQGVSYCHSFN--ICHRDLKPENLLLDKKNKVIKIADFGMAA------------LELPNK 281

Query: 201 ILKNT--TAQYRSPEMVNLALGFPI-NEKSDIWALGILLYKLCYYTTPFEEHGSRAIM-- 255
           +L+ +  +  Y SPE+V   +G P     SD+W+ GI+L+ L     PF +   + ++  
Sbjct: 282 LLETSCGSPHYASPEIV---MGKPYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLK 338

Query: 256 --EGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLL 293
              G+F  P Y   T+  K++I  +L TNP +R  I ++L
Sbjct: 339 VQAGRFQLPPY--LTNDAKDLITRILVTNPEKRLTINEIL 376

>KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {ON}
           Anc_6.262 YPL236C
          Length = 366

 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 70/140 (50%), Gaps = 7/140 (5%)

Query: 164 NVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPI 223
            VL   DG   + D    S V    T S + +  +  I +N +  Y +PE+V+L  G  I
Sbjct: 224 TVLFRSDGTPLIGDLSICSKVKFEITESADLLAFKERIQENCSLPYLAPELVSLKKGSLI 283

Query: 224 NEKSDIWALGILLYKLCYYTTPFEEHGSR-------AIMEGKFTYPAYPQYTDSLKNIIR 276
            ++ DIW+LG +LY L Y  +PFE            AI +G++++P   +Y+ SL +II 
Sbjct: 284 TKEVDIWSLGAILYFLMYGVSPFEREEQLNGTPIKYAIKKGQYSFPQESEYSSSLNDIII 343

Query: 277 VLLSTNPIQRPNICQLLEEL 296
             L  +P  R +  QL+  L
Sbjct: 344 SCLQVDPSMRSSPIQLINAL 363

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 83/326 (25%), Positives = 141/326 (43%), Gaps = 55/326 (16%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSL 66
           D+ KK T       E I+E  +  G FA VY    ++E  N    +  + +  + NK+ L
Sbjct: 121 DQQKKST----MKKEYILEKEIGKGSFAVVYRG-YSNEDPNFKLAVKSVPKSKLKNKKIL 175

Query: 67  NILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXX 126
             L  E+  +K L N+K+IV+ ID   N+          LL+MEYCS  G L F+     
Sbjct: 176 ENLEIEISILKKL-NHKHIVNLIDCQRNKND-------FLLIMEYCS-LGDLTFLIKKRN 226

Query: 127 XXXXXXXXXXXM-------------TDVSQGVYHMHQLQPPL--------LHRDIKIENV 165
                      +              +++  + ++ QL   L        +HRDIK +N+
Sbjct: 227 ELIINHPLLNQIFQKFPSPNPDCNGLNIAFVLNYLQQLASALKFLRSRNLIHRDIKPQNL 286

Query: 166 LLS-------GDGNFKLCDFGSVSGVLRSPTSSEEFV-YLQNDILKNT---TAQYRSPEM 214
           LLS           FK   +  +S +     +   F  +L N  L  T   +  Y +PE+
Sbjct: 287 LLSTPYTDYHDQQTFKKLGYIGISCLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEI 346

Query: 215 VNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME------GKFTYPAYPQYT 268
           +N       N K+D+W++G +LY++ Y   PF+ +    +++          +P+Y +  
Sbjct: 347 LNYQ---KYNAKADLWSVGTVLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSYIEID 403

Query: 269 DSLKNIIRVLLSTNPIQRPNICQLLE 294
           D +K +I  LL  +PI+R +  +  E
Sbjct: 404 DDMKFLISRLLKFDPIKRMSFQEFFE 429

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 78/156 (50%), Gaps = 19/156 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            V  G+ H+H     ++HRDIK ENV++   G  K+ DFGS + V   P   + FV     
Sbjct: 1269 VVSGIKHLHH--QGIVHRDIKDENVIVDSKGLVKIIDFGSAAYVKSGPF--DVFV----- 1319

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEK-SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE+++   G P   K  DIWALGILLY + +   PF  +    I+EG  
Sbjct: 1320 ----GTIDYAAPEVLS---GEPYEGKPQDIWALGILLYTIVFKENPF--YNIDEILEGDL 1370

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEE 295
             + +  + T+    +I+ +L      RP I ++ ++
Sbjct: 1371 KFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEIFDD 1406

>YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC
           family protein kinase and functional ortholog of
           mammalian S6 kinase; phosphorylated by Tor1p and
           required for TORC1-mediated regulation of ribosome
           biogenesis, translation initiation, and entry into G0
           phase; involved in transactivation of
           osmostress-responsive genes; regulates G1 progression,
           cAPK activity and nitrogen activation of the FGM
           pathway; integrates nutrient signals and stress signals
           from sphingolipids to regulate lifespan
          Length = 824

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 124/282 (43%), Gaps = 29/282 (10%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSLN 67
           YK+  K      +  +   L  G F QVY  +   + + +Y      K+VIV  N+ +  
Sbjct: 399 YKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVK-KKDTQRIYAMKVLSKKVIVKKNEIAHT 457

Query: 68  ILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXX 127
           I    +      K++ +IV    S     Q   D Y+V    +Y SG  L  F +     
Sbjct: 458 IGERNILVTTASKSSPFIVGLKFS----FQTPTDLYLV---TDYMSGGEL--FWHLQKEG 508

Query: 128 XXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRS 187
                     + ++   + H+H     +++RD+K EN+LL  +GN  LCDFG     L+ 
Sbjct: 509 RFSEDRAKFYIAELVLALEHLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLKD 566

Query: 188 PTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTP-F 246
            T++  F           T +Y +PE++    G+   +  D W+LG+L++++C   +P F
Sbjct: 567 RTNT--FC---------GTTEYLAPELLLDETGY--TKMVDFWSLGVLIFEMCCGWSPFF 613

Query: 247 EEHGSRAIMEGKFTYPAYPQ--YTDSLKNIIRVLLSTNPIQR 286
            E+  +   +  F    +P+   +   ++ ++ LL+ NP  R
Sbjct: 614 AENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHR 655

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 63/276 (22%), Positives = 128/276 (46%), Gaps = 29/276 (10%)

Query: 26  NYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYI 85
           ++L  GGFA+ +  ++  +   ++   T  K + + ++++   L +E+   K +K+   I
Sbjct: 81  HFLGEGGFARCF--QMKDDSGKIFAAKTVAK-ISIKSEKTRKKLLSEIQIHKSMKHPN-I 136

Query: 86  VSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGV 145
           V +ID         ED   V +L+E C    L+D +                 T +   +
Sbjct: 137 VQFIDCF-------EDDTNVYILLEICPNGSLMDLLKKRKVLTEPEVRYFT--TQIVGAI 187

Query: 146 YHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT 205
            +MH  +  ++HRD+K+ N+    + N K+ DFG ++ VL +    +  V          
Sbjct: 188 KYMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVLANDRERKYTVC--------G 236

Query: 206 TAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKFTY 261
           T  Y +PE++         E  DIW++G+++Y L     PF+      I E    G + +
Sbjct: 237 TPNYIAPEVLAGKHSGHSYE-VDIWSIGVMIYALLIGKPPFQAKEVNIIYERIKSGDYIF 295

Query: 262 PAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           P     +  +  +I+ +LS +PI+RP++ ++++ ++
Sbjct: 296 PREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVW 331

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 80/156 (51%), Gaps = 19/156 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            V  G+ H+H     ++HRD+K ENV++   G  KL DFGS + V   P   + FV     
Sbjct: 1225 VVLGIKHLHD--SNIVHRDVKDENVIVDAKGFVKLIDFGSAAYVNSGPF--DVFV----- 1275

Query: 201  ILKNTTAQYRSPEMVNLALGFP-INEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE+++   G P + +  DIWA+GILLY + +   PF  +    I+E + 
Sbjct: 1276 ----GTIDYAAPEVLS---GEPYLGKPQDIWAIGILLYTIMFKENPF--YNIDEILEAEL 1326

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEE 295
                    +    ++I+ +L+ NP +RP I +++ +
Sbjct: 1327 KINNTSDASQDCIDLIKRILTKNPNKRPTIDEIVND 1362

>Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W
           (REAL)
          Length = 835

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 124/282 (43%), Gaps = 29/282 (10%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSLN 67
           YK+  K      +  +   L  G F QVY  +   + + +Y      K+VIV  N+ +  
Sbjct: 410 YKQTKKRHYGPQDFEVLRLLGRGTFGQVYQVK-KKDTQRIYAMKVLSKKVIVKKNEIAHT 468

Query: 68  ILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXX 127
           I    +      K++ +IV    S     Q   D Y+V    +Y SG  L  F +     
Sbjct: 469 IGERNILVTTASKSSPFIVGLKFS----FQTPTDLYLV---TDYMSGGEL--FWHLQKEG 519

Query: 128 XXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRS 187
                     + ++   + H+H     +++RD+K EN+LL  +GN  LCDFG     L+ 
Sbjct: 520 RFSEDRAKFYIAELVLALEHLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLKD 577

Query: 188 PTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTP-F 246
            T++  F           T +Y +PE++    G+   +  D W+LG+L++++C   +P F
Sbjct: 578 RTNT--FC---------GTTEYLAPELLLDETGY--TKMVDFWSLGVLIFEMCCGWSPFF 624

Query: 247 EEHGSRAIMEGKFTYPAYPQ--YTDSLKNIIRVLLSTNPIQR 286
            E+  +   +  F    +P+   +   ++ ++ LL+ NP  R
Sbjct: 625 AENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHR 666

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 133/290 (45%), Gaps = 46/290 (15%)

Query: 23  IIENYLTSGGFAQVYTARITSEHKNL-YPELTCLK---RVIVP--NKQSLNILRAEVDAM 76
           I+ + L  G F +V      +   ++  P+   +K   R  +P  +++ + I R E++A+
Sbjct: 41  IVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRRDTIPKNSEKEVKIYR-EINAL 99

Query: 77  KILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXX 136
           K L N+  IV   +     LQNS+  Y+ ++L EY SG     ++               
Sbjct: 100 KHL-NHPNIVRLEEV----LQNSK--YIGIVL-EYASGGEFYKYIQKKRRLKESAACRL- 150

Query: 137 XMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVY 196
               +  GVY+MH     L+HRD+K+EN+LL  + N  + DFG V+          EF+ 
Sbjct: 151 -FAQLISGVYYMHSKG--LVHRDLKLENLLLDKNENLLITDFGFVN----------EFL- 196

Query: 197 LQNDILKNTTAQ--YRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGS--- 251
            +N+++K +     Y +PE+V  A  +    K+DIW+ G+++Y +     P+++      
Sbjct: 197 PENELMKTSCGSPCYAAPELVVTARPYEA-RKADIWSCGVIMYAMLAGYLPWDDDPENPD 255

Query: 252 --------RAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLL 293
                   R I      +P Y       ++++R +L  +P +R  I Q L
Sbjct: 256 GDDIGKLYRYITRTPLKFPDY--IAPVPRDLLRAILVADPKKRITIAQTL 303

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 72/139 (51%), Gaps = 17/139 (12%)

Query: 155  LLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEM 214
            ++HRDIK ENV++   G  KL DFGS + V   P   + FV          T  Y +PE+
Sbjct: 1167 IVHRDIKDENVIVDSQGFIKLIDFGSAAYVKSGPF--DVFV---------GTIDYAAPEV 1215

Query: 215  VNLALGFP-INEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKN 273
            +    G P + +  DIWA+GILLY + +   PF  +    I+E +  +       +   +
Sbjct: 1216 LG---GEPYVGKPQDIWAIGILLYTIIFKENPF--YNIDEILEAELKFNTSTGACEDCVD 1270

Query: 274  IIRVLLSTNPIQRPNICQL 292
            +I+ +L+ NP +RP I ++
Sbjct: 1271 LIKRILTRNPTKRPTIDEI 1289

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 124/286 (43%), Gaps = 45/286 (15%)

Query: 31   GGFAQVYTA-RITSEHKNLYPELTCLKRVIVPNKQSLN--------ILRAEVDAMKILKN 81
            G F  VY    +T+       E+  +K+V VP   S N         LR+EV  +K L +
Sbjct: 1184 GSFGAVYLCLNVTTG------EMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-D 1236

Query: 82   NKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDV 141
            +  IV Y+       +N ++ Y   L +EY +G  +   +                 T V
Sbjct: 1237 HLNIVQYLG-----FENKDNIYS--LFLEYVAGGSVGSLIRMYGRFDEPLIKHLT--TQV 1287

Query: 142  SQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDI 201
             +G+ ++H     +LHRD+K +N+LL  DG  K+ DFG         +   + +Y  +D+
Sbjct: 1288 LKGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDFGI--------SRKSKDIYSNSDM 1337

Query: 202  LKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIM--EGKF 259
                T  + +PEMV+   G+  + K DIW+LG ++ ++     P+      A M   GK 
Sbjct: 1338 TMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKS 1395

Query: 260  -TYPAYPQYTDSL-----KNIIRVLLSTNPIQRPNICQLLEELFRI 299
             + P  P+ T  L     +  +      NP +RP   +LL   F +
Sbjct: 1396 KSAPPIPEDTLPLISQVGRGFLDACFEINPEKRPTATELLSHRFSV 1441

>ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {ON}
           similar to uniprot|P38147 Saccharomyces cerevisiae
           YBR274W CHK1 checkpoint kinase 1
          Length = 516

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 121/280 (43%), Gaps = 33/280 (11%)

Query: 18  ASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMK 77
           A  +V++++ +  G FAQV +A +  +       +  +K V +P  Q   +   +V    
Sbjct: 7   AIKDVVLDDTIGHGTFAQVKSAHLEIDTS----VIIAVKFVHIPTCQKYGLSEKDVVGEV 62

Query: 78  ILKNNKYIVSYIDSHANRLQ----NSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXX 133
           IL+      S    H N L+    N    Y+  + ME   G  L D              
Sbjct: 63  ILQ------SKCCKHHNVLKVIDCNIAHDYL-WIAMEMADGGDLFD--KIEPDVGVDSEV 113

Query: 134 XXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEE 193
                  +   V ++H+    + HRDIK EN+LL  +GN KL DFG  S   R    S+ 
Sbjct: 114 AQFYFQQLVSAVSYLHE-DCGVAHRDIKPENLLLDKNGNLKLADFGLASK-FRRKDGSKR 171

Query: 194 FVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTP-----FEE 248
             Y Q       + QY +PE+++    +   + +DIW++G+L++ +     P     FE+
Sbjct: 172 LCYDQ-----RGSPQYMAPEILHYDEYYA--DVTDIWSIGVLVFVILTGELPWDLPVFED 224

Query: 249 HGSRAIME--GKFTYPAYPQYTDSLKNIIRVLLSTNPIQR 286
              R  ME  GK     + +   +  N++R LL  NP++R
Sbjct: 225 ENFRCFMENNGKLNVGPWAKIDFTHLNLLRKLLQPNPLER 264

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 125/279 (44%), Gaps = 37/279 (13%)

Query: 27  YLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIV 86
           +L  GGFA+ +  R   +   ++   T  K + + ++++   L +E+   K +K+   IV
Sbjct: 100 FLGEGGFARCFQIR--DDSGKIFAAKTVAK-ISIKSEKTRKKLLSEIQIHKSMKHVN-IV 155

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
            +ID         ED   V +L+E C    L+D +                 T +   + 
Sbjct: 156 QFIDCF-------EDDTNVYILLEICPNGSLMDLLKKRKSLTEPEVRFFT--TQICGAIK 206

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           +MH  +  ++HRD+K+ N+      N K+ DFG  +              L ND  +  T
Sbjct: 207 YMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAAT-------------LANDRERKYT 251

Query: 207 A----QYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GK 258
                 Y +PE++ +      + + DIW++G+++Y L     PF+      I E      
Sbjct: 252 VCGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRD 310

Query: 259 FTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           F++P     +   K +I+ +LS +P++RP++ ++++ ++
Sbjct: 311 FSFPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYIW 349

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 127/272 (46%), Gaps = 32/272 (11%)

Query: 31  GGFAQVYTARITSEHKNLYPELTCLKRV-IVPNKQSLNILRAEVDAMKILKNNKYIVSYI 89
           G F  VY AR  + +     E+  +K V +    + +++L  E+  +  L++  YI +Y 
Sbjct: 29  GNFGDVYKARDLTSN-----EIVAIKVVNLEDTDEPIDLLAQEIFFLSELRS-PYITNYK 82

Query: 90  DSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMH 149
            +    +        + ++MEYC G    + +                +++V  G+ ++H
Sbjct: 83  TAFLVDVS-------MWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDYLH 135

Query: 150 QLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQY 209
             +   +HRDIK  N+LL+ +G+ KL DFG VSG +      + FV          T  +
Sbjct: 136 SQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV---------GTPFW 183

Query: 210 RSPEMVNL-ALGFPINEKSDIWALGILLYKLCYYTTPFEEHGS-RAIMEGKFTYPAY--P 265
            +PE+++    G+  NE +DIW+LGI + +L     P +++ + +A+M      P     
Sbjct: 184 MAPEVIDRNKQGY--NEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPPKLDK 241

Query: 266 QYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           +++   ++ +   L  +P QRP   +LL+  F
Sbjct: 242 RFSSHARDFVAQCLIKDPSQRPTAAELLKHRF 273

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 97/211 (45%), Gaps = 27/211 (12%)

Query: 107 LLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVL 166
           +L EY SG  LLD++                    +    H H +    +HRD+KIEN++
Sbjct: 177 MLFEYVSGGQLLDYIIQHGSLKESRARTFTRQICSALKYLHSHNI----VHRDLKIENIM 232

Query: 167 LSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQ--YRSPEMVNLALGFPIN 224
           +S DGN KL DFG  +            +Y + + LK       + +PE++  A  + I 
Sbjct: 233 ISKDGNIKLIDFGLSN------------LYDKCNKLKTYCGSLYFAAPELLK-ATPY-IG 278

Query: 225 EKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKFTYPAYPQYTDSLKNIIRVLLS 280
            + D+W+ G++LY L     PF++  S      I +GK  YP +   +  + +++  +L 
Sbjct: 279 PEIDVWSFGVVLYVLVCGKVPFDDENSNVLHEKIKQGKVFYPQF--LSIEVISLLSKMLV 336

Query: 281 TNPIQRPNICQLLEELFRIQHKSSPLPNFYV 311
            +P +R  + Q++   + ++    P P  Y+
Sbjct: 337 VDPFKRATLDQVMNHHWMVRDCDGP-PKSYI 366

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 79/156 (50%), Gaps = 19/156 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            V+ G+ H+H     ++HRDIK ENV++   G  KL DFGS + V   P   + FV     
Sbjct: 1087 VASGIKHLHD--NGIVHRDIKDENVIVDNKGFVKLIDFGSAAYVKSGPF--DVFV----- 1137

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEK-SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE++    G P   K  DIWA+G+LLY + Y   PF  +    I++G  
Sbjct: 1138 ----GTIDYAAPEVLG---GEPYEGKPQDIWAIGVLLYTIIYKENPF--YNIDEILDGDL 1188

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEE 295
               +  + +     +IR +L+ +  +RP I  ++E+
Sbjct: 1189 RIQSTHEVSAECVALIRKILNRSVSKRPTIDDIMED 1224

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/275 (24%), Positives = 128/275 (46%), Gaps = 26/275 (9%)

Query: 28  LTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVS 87
           L  G ++ V  A  + + K  Y      K  ++  K+ +  +  E +A++ + N+K IV 
Sbjct: 185 LGDGAYSTVMLA-TSIDSKKQYAVKVLNKEYLIKQKK-VKYVNIEKNALQRINNSKMIVK 242

Query: 88  YIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYH 147
              +        +D   +  L+EYC     L  M                   V   + +
Sbjct: 243 LFFTF-------QDESSLYFLLEYCPNGDFLSLMKKYGSLNETVACYYSAQ--VIDAIDY 293

Query: 148 MHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTA 207
           +H     ++HRDIK EN+LL  +   KL DFG+ + +L S T++ +F  L        TA
Sbjct: 294 LHTNG--IIHRDIKPENILLDKEFKIKLTDFGT-AKILDSSTNN-KFDLLTRSKSFVGTA 349

Query: 208 QYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKFTYPA 263
           +Y +PE++N +    ++ + D+WA G +LY++     PF+        + +M+ ++ + A
Sbjct: 350 EYVAPELLNDSF---VDYRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTA 406

Query: 264 -YPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
            +P     ++++++ +L  +  QRP+I Q+ +  F
Sbjct: 407 GFPLI---IRDLVKKILVKDLNQRPSISQIEKHHF 438

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/276 (22%), Positives = 126/276 (45%), Gaps = 29/276 (10%)

Query: 26  NYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYI 85
           ++L  GGFA+ +  +I  +   ++   T  K + + ++++   L +E+   K +++   I
Sbjct: 83  HFLGEGGFARCF--QIKDDSGKIFAAKTVAK-ISIKSEKTRKKLLSEIQIHKSMRHFN-I 138

Query: 86  VSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGV 145
           V +ID         ED   V +L+E C    L+D +                 T +   V
Sbjct: 139 VQFIDCF-------EDDTNVYILLEICPNGSLMDLLKRRKVLTEPEVRFFT--TQIVGAV 189

Query: 146 YHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT 205
            +MH  +  ++HRD+K+ N+      N K+ DFG ++ VL +    +  V          
Sbjct: 190 KYMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFG-LAAVLANDRERKYTVC--------G 238

Query: 206 TAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKFTY 261
           T  Y +PE++        + + DIW+ G+++Y L     PF+      I E    G + +
Sbjct: 239 TPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDYVF 297

Query: 262 PAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           P     +     +IR +LS +P++RP++ ++++ ++
Sbjct: 298 PRDKCISQEALTLIRDILSIDPLERPSLDEIIDYVW 333

>Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {ON}
           complement(36018..38015) [1998 nt, 666 aa]
          Length = 665

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 124/288 (43%), Gaps = 31/288 (10%)

Query: 4   IFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNK 63
           + E KYK   +   +  +  I   L  G F +VY      + K LY      KR ++  K
Sbjct: 244 LIEWKYKNTDQRHYSPEDFNILRMLGKGTFGRVYQVE-KKDTKTLYAMKVISKRNVIKRK 302

Query: 64  QSLNILRAEVDAMKILKNNK-YIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMN 122
           +    ++  ++   IL +N   + S+I       Q +ED Y+V    ++ SG  L  F++
Sbjct: 303 E----VKHTLNERNILVHNANKLCSFIVKLKFSFQTAEDLYLV---TDFMSGGEL--FLH 353

Query: 123 XXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVS 182
                             +   +  +H     +++RD+K EN+LL   GN  LCDFG   
Sbjct: 354 LQREGRFPEYRAKFYCAQLVMALEFLHD--NDIIYRDLKPENILLDAKGNIALCDFGLSK 411

Query: 183 GVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYY 242
             L   T++  F           T +Y +PE++  A G+   +  D W+LG+L++++C  
Sbjct: 412 LNLEGRTNT--FC---------GTTEYLAPELLLDATGY--TKMVDFWSLGVLMFEMCCG 458

Query: 243 TTPF----EEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQR 286
            +PF     +   + I   K  +P     +   +  I+ L++ NP+ R
Sbjct: 459 WSPFFAPTNQQMYQKIAYSKIKFPV-NSLSKGCRLFIKGLMNRNPLHR 505

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 123/284 (43%), Gaps = 45/284 (15%)

Query: 31   GGFAQVYTA-RITSEHKNLYPELTCLKRVIVPNKQSLN--------ILRAEVDAMKILKN 81
            G F  VY    +T+       E+  +K+V VP   S N         LR+EV  +K L +
Sbjct: 1184 GSFGAVYLCLNVTTG------EMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-D 1236

Query: 82   NKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDV 141
            +  IV Y+       +N  + Y   L +EY +G  +   +                 T V
Sbjct: 1237 HLNIVQYLG-----FENKNNIYS--LFLEYVAGGSVGSLIRMYGRFDEPLIKHL--TTQV 1287

Query: 142  SQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDI 201
             +G+ ++H     +LHRD+K +N+LL  DG  K+ DFG         +   + +Y  +D+
Sbjct: 1288 LKGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDFGI--------SRKSKDIYSNSDM 1337

Query: 202  LKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME--GKF 259
                T  + +PEMV+   G+  + K DIW+LG ++ ++     P+      A M   GK 
Sbjct: 1338 TMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKS 1395

Query: 260  -TYPAYPQYTDSL-----KNIIRVLLSTNPIQRPNICQLLEELF 297
             + P  P+ T  L     +N +      NP +RP   +LL   F
Sbjct: 1396 KSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSHPF 1439

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 126/287 (43%), Gaps = 29/287 (10%)

Query: 26  NYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYI 85
           ++L  GGFA+ +  ++  +   ++   T  K  I   K    +L +E+   K +K+   I
Sbjct: 94  HFLGEGGFARCF--QMKDDKGKVFAAKTVAKLSIKSEKTRRKLL-SEIQIHKSMKHPN-I 149

Query: 86  VSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGV 145
           V + D         ED   V +L+E C    +++ +                M  +   +
Sbjct: 150 VQFTDCF-------EDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFC--MIQIIGAI 200

Query: 146 YHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT 205
            +MH  +  ++HRD+K+ N+    + N K+ DFG ++ VL +    +  +          
Sbjct: 201 RYMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFG-LAAVLANDKERKYTIC--------G 249

Query: 206 TAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG----KFTY 261
           T  Y +PE++        + + DIW++G++LY L +   PF+      I E      F +
Sbjct: 250 TPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIF 308

Query: 262 PAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308
           PA    +   KN+I  LL  NP  RP++ ++ + ++      S LP+
Sbjct: 309 PADKPVSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRLPS 355

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 94/205 (45%), Gaps = 20/205 (9%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           + ++MEYC+G  L   +                M ++   +  +H+    ++HRDIK  N
Sbjct: 95  LWIIMEYCAGGSLRSLL---RPGKIDEKYIGVIMRELLVALKCIHKDN--VIHRDIKAAN 149

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPIN 224
           VL++ +GN KLCDFG  + V ++    +             T  + +PE++    G   +
Sbjct: 150 VLITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYD 198

Query: 225 EKSDIWALGILLYKLCYYTTPF-EEHGSRA---IMEGKFTYPAYPQYTDSLKNIIRVLLS 280
            K DIW+LGI  Y++     P+ +    RA   I++ K        Y+ SLK  I + L 
Sbjct: 199 TKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLD 258

Query: 281 TNPIQRPNICQLLEELFRIQHKSSP 305
            +P +R +   LL   F   H+++P
Sbjct: 259 EDPKERLSADDLLRSKFIKAHRATP 283

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 104/226 (46%), Gaps = 31/226 (13%)

Query: 107 LLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVL 166
           +L EY SG  LLD++                   ++  + ++H     ++HRD+KIEN++
Sbjct: 241 MLFEYVSGGQLLDYI--IQHGSLREHHARKFARGIASALQYLHANN--IVHRDLKIENIM 296

Query: 167 LSGDGNFKLCDFGSVSGVLRSPTSSEEFV----YLQNDILKNTTAQYRSPEMVNLALGFP 222
           +S  G  K+ DFG +S +    T    F     +   ++LK   + Y  PE+        
Sbjct: 297 ISTSGEIKIIDFG-LSNMFDPRTQLHTFCGSLYFAAPELLK--ASPYVGPEV-------- 345

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKFTYPAYPQYTDSLKNIIRVL 278
                D+W+ G++LY L     PF++  S      I +GK  YP +   +  + +++  +
Sbjct: 346 -----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPQH--LSIEVISLLSKM 398

Query: 279 LSTNPIQRPNICQLLEELFRIQHKSSPLPNFYVQR-AMSSLQMDTT 323
           L  +P +R ++ Q++E  + I+    P P++   R  MS   +D T
Sbjct: 399 LVVDPRKRASLKQVVEHHWMIRGYDFPAPSYVPNRIPMSPEMLDIT 444

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 76/308 (24%), Positives = 137/308 (44%), Gaps = 52/308 (16%)

Query: 7   DKYKKGTKLQVASHEVIIENYLTSGGFAQV---YTARITSEH---KNLYPELTCLKRVIV 60
           D+  K  + Q+      I + L  G F +V   +T   TS     K +  +L    +++ 
Sbjct: 29  DRLSKLKRKQITFGPYYIGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRRDKIVK 88

Query: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSE---DSYVVLLLMEYCSGAGL 117
            +++ + I R E++A+K L           +H N ++  E   +S  + +++EY SG   
Sbjct: 89  NSEKEIKIFR-EINALKHL-----------THPNIVKLEEVLQNSKYIGIVLEYASGGEF 136

Query: 118 LDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCD 177
             ++                 T +  GV +MH     L+HRD+K+EN+LL    N  + D
Sbjct: 137 YRYI--QRKRRLKETAGCRLFTQLVSGVNYMHS--KGLVHRDLKLENLLLDKHENLVITD 192

Query: 178 FGSVSGVLRSPTSSEEFVYLQNDILKNTTAQ--YRSPEMVNLALGFPINEKSDIWALGIL 235
           FG V+  L+            ND++K +     Y +PE+V     +    K+DIW+ GI+
Sbjct: 193 FGFVNEFLK-----------DNDLMKTSCGSPCYAAPELVISTKPYEA-RKADIWSCGII 240

Query: 236 LYKLCYYTTPFEEHGSRAIMEGK----------FTYPAYPQYTDSL-KNIIRVLLSTNPI 284
           LY +     P+++       EG            T   +P+Y   + ++++R LL ++P 
Sbjct: 241 LYAMLAGYLPWDDDPQNP--EGDDIARLYYFITRTSLKFPEYISPIPRDLLRRLLVSDPR 298

Query: 285 QRPNICQL 292
           +R NI Q+
Sbjct: 299 KRLNIRQI 306

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 91/199 (45%), Gaps = 31/199 (15%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V + +EYC G  L + +                   +S  +Y+ H L    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEHL--LRLHRIPVDECSRLFAQISGAMYYAHSLN--CVHRDLKLEN 158

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT--TAQYRSPEMVNLAL--G 220
           +LL   GN KL DF    G  R   S         +IL+    T  Y +PE++      G
Sbjct: 159 ILLDKVGNAKLTDF----GFTRECAS--------KNILETICGTTVYMAPELIKRERYDG 206

Query: 221 FPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSL-----KNII 275
           F I    D+W+LG++LY L     PF+E   +   E K      P +  +L      +++
Sbjct: 207 FKI----DVWSLGVILYTLLNGFMPFDEEQQKNT-EWKIVN-EMPSFDSTLLGPDAVDLL 260

Query: 276 RVLLSTNPIQRPNICQLLE 294
             LL+ +PI RP++ ++LE
Sbjct: 261 SKLLAKDPIDRPSMKEVLE 279

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 115/259 (44%), Gaps = 43/259 (16%)

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           ++ E+  +  LK    I  Y  S+   L+N+     + ++MEYC G  L   +       
Sbjct: 78  VQKEIQFLASLKQLPNITRYYGSY---LKNTS----LWIIMEYCGGGSLRSLL---RPGK 127

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    M ++   + ++H+    ++HRDIK  NVL++ DG+ KLCDFG  + + ++ 
Sbjct: 128 IDEKYIGVIMREILIALKYIHKDN--VIHRDIKAANVLINNDGSIKLCDFGVAAQLNQTK 185

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPF-E 247
           +  +             T  + +PE++    G   + K+DIW+ GI  Y++     P+ +
Sbjct: 186 SRRQTMA---------GTPYWMAPEVI--MEGVYYDTKADIWSTGITAYEVTTGNPPYCD 234

Query: 248 EHGSRAI----------MEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
               RA+          +EG+        Y+  +K  I   L  +P +RP   +LL+  F
Sbjct: 235 VEALRAMQLIAKSKPPRLEGR-------NYSALIKEFIATCLDEDPSERPTADELLKTAF 287

Query: 298 RIQHKSSPLPNFYVQRAMS 316
              +K  PLP   ++  +S
Sbjct: 288 IKTYK--PLPTSILKELIS 304

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 94/208 (45%), Gaps = 26/208 (12%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           + ++MEYC+G  L   +                +  V+  V H   +    +HRDIK  N
Sbjct: 88  LWIIMEYCAGGSLRSLLRPGKIDEKYIGVIMRELL-VALKVIHKDNV----IHRDIKAAN 142

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQ---YRSPEMVNLALGF 221
           VL++ +G  KLCDFG V+  L            Q  + + T A    + +PE++    G 
Sbjct: 143 VLITNEGQVKLCDFG-VAAQLN-----------QTSLRRQTMAGTPYWMAPEVI--MEGV 188

Query: 222 PINEKSDIWALGILLYKLCYYTTPF-EEHGSRA---IMEGKFTYPAYPQYTDSLKNIIRV 277
             + K DIW+LGI  Y++     P+ +    RA   I++ K        YT  LK  I +
Sbjct: 189 YYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIAL 248

Query: 278 LLSTNPIQRPNICQLLEELFRIQHKSSP 305
            L  +P +R +  +LL+  F   HK++P
Sbjct: 249 CLDEDPQERLSAEELLKTKFIKTHKATP 276

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 123/284 (43%), Gaps = 45/284 (15%)

Query: 31   GGFAQVYTA-RITSEHKNLYPELTCLKRVIVPNKQSLN--------ILRAEVDAMKILKN 81
            G F  VY    +T+       E+  +K+V VP   S N         LR+EV  +K L +
Sbjct: 1187 GSFGAVYLCLNVTTG------EMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDL-D 1239

Query: 82   NKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDV 141
            +  IV Y+       +N  + Y   L +EY +G  +   +                 T V
Sbjct: 1240 HLNIVQYLG-----FENKNNIYS--LFLEYVAGGSVGSLIRMYGRFDESLIRHLT--TQV 1290

Query: 142  SQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDI 201
             +G+ ++H     +LHRD+K +N+LL  DG  K+ DFG         +   + +Y  +D+
Sbjct: 1291 LKGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDFGI--------SRKSKDIYSNSDM 1340

Query: 202  LKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME--GKF 259
                T  + +PEMV+   G+  + K DIW+LG ++ ++     P+      A M   GK 
Sbjct: 1341 TMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKS 1398

Query: 260  -TYPAYPQYTDSL-----KNIIRVLLSTNPIQRPNICQLLEELF 297
             + P  P+ T  L     ++ +      NP +RP   +LL   F
Sbjct: 1399 KSAPPIPEDTLPLISQVGRSFLDACFEINPEERPTATELLSHQF 1442

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 75/150 (50%), Gaps = 19/150 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            V  GV H+H     ++HRDIK EN+++   G  K+ DFGS + V   P   + FV     
Sbjct: 1194 VVSGVKHLHD--QGIVHRDIKDENIIVDSQGFVKIIDFGSAAYVKSGPF--DVFV----- 1244

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEK-SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE++    G P   K  DIWA+GILLY + +   PF  +    I+EG+ 
Sbjct: 1245 ----GTIDYAAPEVLG---GSPYEGKPQDIWAIGILLYTIVFKENPF--YNIDEILEGEL 1295

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNI 289
             + +    ++    +I  +L+ N  +RP I
Sbjct: 1296 KFNSSELVSEQCTTLIAKILNRNVQKRPTI 1325

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/278 (21%), Positives = 126/278 (45%), Gaps = 35/278 (12%)

Query: 27  YLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIV 86
           +L  GGFA+ +  ++  +   ++   T  K + + ++++   L +E+   K +++   IV
Sbjct: 78  FLGEGGFARCF--QMKDDSGKIFAAKTVAK-ISIKSEKTRKKLLSEIQIHKSMRHPN-IV 133

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
            + D         ED   V +L+E C    L+D +                 T +   + 
Sbjct: 134 QFTDCF-------EDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFT--TQIVGAIK 184

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           +MH  +  ++HRD+K+ N+      N K+ DFG ++ VL +    +  +          T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVLANDRERKYTIC--------GT 233

Query: 207 AQYRSPEMV---NLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKF 259
             Y +PE++   +    F +    D+W++G+++Y L     PF+      I E      F
Sbjct: 234 PNYIAPEVLTGKHTGHSFEV----DVWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDF 289

Query: 260 TYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
            +P     +   K +I+ +LS +P++RP++ +++E ++
Sbjct: 290 NFPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYVW 327

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 124/275 (45%), Gaps = 34/275 (12%)

Query: 28  LTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVS 87
           L  G ++ V  A  TS   N    +  L +  +  ++ +  +  E + ++ LKN K I+S
Sbjct: 161 LGDGSYSTVLLA--TSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLKNTKGIIS 218

Query: 88  YIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYH 147
              +        +D   +  L+EY     LL  M                    + G  H
Sbjct: 219 LYFTF-------QDESSLYFLLEYAPNGDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMH 271

Query: 148 MHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT-- 205
                  ++HRD+K EN+LL  D   KL DFG+    L   TS ++  Y   D+L  +  
Sbjct: 272 ----DKGVIHRDLKPENILLDVDMKVKLTDFGTAR--LLDSTSEDDLKY---DLLTRSNS 322

Query: 206 ---TAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEGK 258
              TA+Y SPE++N      ++ + DIWA G +L+++     PF+ +      + +M+ +
Sbjct: 323 FVGTAEYVSPELLNDNY---VDFRCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVMKVQ 379

Query: 259 FTYPA-YPQYTDSLKNIIRVLLSTNPIQRPNICQL 292
           F + A +P    +++++++ +L  NP +R  I Q+
Sbjct: 380 FAFTAGFPM---TVRDLVKNILIKNPERRLLINQI 411

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 112/263 (42%), Gaps = 47/263 (17%)

Query: 56  KRVIVPNKQSLNILRAEVDAMKIL--KNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCS 113
           K+V  PNK++   +  E++  K++   ++ +IV+  D+     Q  ++S + ++L +YCS
Sbjct: 70  KKVHCPNKENKRKIIKELEIYKVICRSHHNHIVALRDA----FQWGKESCIYMIL-DYCS 124

Query: 114 GAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNF 173
              L   +                M  +  G+Y +H     ++H D+K+ N+L       
Sbjct: 125 NNSLQSILQYRGSLNEVECKEL--MIQLCGGIYWLHL--NNVIHGDLKLSNILFDEGQQL 180

Query: 174 KLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPE------------MVNLALGF 221
           K+CDFGS      SP    E +          T  Y +PE            M  L + F
Sbjct: 181 KICDFGSSFIATSSPRGPGEIM---------GTPYYLAPETVYTHKNINKSGMAILLISF 231

Query: 222 PINEKSDIWALGILLYKLCYYTTPF-----EEHGS------RAIMEGKFTYPAYPQYTDS 270
           PI    DIW++GI+LY L Y   PF     E H        + I  G   +P        
Sbjct: 232 PI----DIWSMGIVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAG 287

Query: 271 LKNIIRVLLSTNPIQRPNICQLL 293
            + +I  +LS NP++R  + +++
Sbjct: 288 AQQLILKMLSQNPLERITLVEIV 310

>CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12003 Saccharomyces cerevisiae
           YPL236c
          Length = 399

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 81/151 (53%), Gaps = 8/151 (5%)

Query: 157 HRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVN 216
           H+ +   N++ S +G   + + GS S       ++++   L+  +  N  + Y +PE ++
Sbjct: 249 HKMLSPSNIIFSSNGLPIISELGSCSKADVEIKTAKQLNRLREWVDDNFNS-YMAPEFLD 307

Query: 217 LALGFPINEKSDIWALGILLYKLCYYTTPFEE----HGSR---AIMEGKFTYPAYPQYTD 269
           L     ++ K D+W+ G + Y L +   PFE     +G+    AI  GKF++P+  +Y+D
Sbjct: 308 LKTNSKLSTKVDVWSFGCICYALLFGMNPFEREEQLYGASIKYAISTGKFSFPSQSRYSD 367

Query: 270 SLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300
           S+ +IIR  L  +P +RP++  +L  L ++Q
Sbjct: 368 SILDIIRSCLQVDPSERPSVSIVLNNLQQLQ 398

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 114/260 (43%), Gaps = 42/260 (16%)

Query: 68  ILRAEVD-----AMKILKNNKYI-----VSYIDSHANRLQ--NS-------------EDS 102
           +L   VD     A KIL N +Y+     V Y++   N LQ  NS             +D 
Sbjct: 217 VLATSVDSGKKYAAKIL-NKEYLIRQKKVKYVNIEKNTLQRLNSNHVPGIIKLFFTFQDE 275

Query: 103 YVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKI 162
             +  L+EY      L  M                   +  G+Y +H+    ++HRDIK 
Sbjct: 276 ANLYFLLEYAPNGDFLSIMKKYGSLNEECARYYG--AQILNGIYFLHRHG--IIHRDIKP 331

Query: 163 ENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFP 222
           EN+LL      KL DFG+   +L     +EE+           TA+Y SPE++N +    
Sbjct: 332 ENILLDKSMKVKLTDFGTAK-LLNRKDGTEEYDLTTRSKSFVGTAEYVSPELLNDSW--- 387

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKFTYPA-YPQYTDSLKNIIRV 277
           ++ K DIWA G +L+++     PF+        + +M+ ++ + A +P     ++++++ 
Sbjct: 388 VDHKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPMV---VRDLVKQ 444

Query: 278 LLSTNPIQRPNICQLLEELF 297
           +L   P  R  I Q+ + LF
Sbjct: 445 ILVKKPEHRLTIPQIEKHLF 464

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 114/276 (41%), Gaps = 45/276 (16%)

Query: 28  LTSGGFAQVYTARITSEHK--NLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYI 85
           L  G F +VY  R    HK   L   L  + ++ + N       + E+D    L +    
Sbjct: 124 LGKGKFGKVYCVR----HKPSGLICALKVMNKMEIVNFNVQKQFKREIDIQYHLNHKNLT 179

Query: 86  VSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXX-XXXXXXXXXXXXMTDVSQG 144
             Y   H        DS  V L+MEY  G  L   +                 MTD    
Sbjct: 180 KLYAFFH--------DSKNVYLVMEYLIGGELYKLLKKNGPMNDITASNYVYQMTD---A 228

Query: 145 VYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKN 204
           + +MH+ +  ++HRD+K EN+L+  +   KL DFG               +Y  N+  + 
Sbjct: 229 LNYMHKRK--IIHRDLKPENILIGFNNQIKLTDFGWS-------------IYNPNNQKRK 273

Query: 205 T---TAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEG 257
           T   T  Y SPE+++       +E  D+WALGIL Y+L     PFEE       + I + 
Sbjct: 274 TLCGTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIAKS 330

Query: 258 KFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLL 293
              +P  P  +   +++I  LL   P +R N+ Q++
Sbjct: 331 DLKFP--PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 116/275 (42%), Gaps = 31/275 (11%)

Query: 28  LTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVS 87
           L  G   +V+  R   E   LY      KR ++  K+   IL  +   +    N+ ++V+
Sbjct: 442 LGQGDVGKVFLVR-EKETNRLYALKVFTKREMIKRKKVQRILTEQ--EILATSNHPFVVT 498

Query: 88  YIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYH 147
              S       +ED   V L MEYC G      +                 ++V+  + +
Sbjct: 499 LYHSF-----QTED--YVYLCMEYCMGGEFFRALQTRKAKSISEDDARFYASEVTAALEY 551

Query: 148 MHQLQPPLLHRDIKIENVLLSGDGNFKLCDFG-------SVSGVLRSPTSSE--EFVYLQ 198
           +H L    ++RD+K EN+LL   G+  L DF        +   V R  T S   +     
Sbjct: 552 LHLLG--FIYRDLKPENILLHKSGHIMLSDFDLSVQANDAAKPVKRVATQSSMVDTKVFS 609

Query: 199 NDILKNT---TAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRA-- 253
                N+   T +Y +PE++    G       D W LGIL+Y++ +  TPF+   +    
Sbjct: 610 EGFRTNSFVGTEEYIAPEVIR---GNGHTAAVDWWTLGILIYEMLFGCTPFKGENTNETF 666

Query: 254 --IMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQR 286
             I++ + T+P + + +   K++IR LLS N  +R
Sbjct: 667 CNILKNEVTFPEHHEISRHCKDLIRKLLSKNESKR 701

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 76/156 (48%), Gaps = 19/156 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            V+ G+ H+H L   ++HRDIK ENV++   G  K+ DFGS + V   P   + FV     
Sbjct: 1157 VASGLQHLHSLG--IVHRDIKDENVIIDSKGYVKIIDFGSAAYVKNGPF--DVFV----- 1207

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEK-SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE++    G P   K  DIWALGILLY + +   PF  +    I+EG  
Sbjct: 1208 ----GTIDYAAPEVL---AGNPYEGKPQDIWALGILLYTIIFKENPF--YNIDEIIEGNV 1258

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEE 295
             +            +I+ +L     +RP+I ++  +
Sbjct: 1259 NFDNEASVNPVCVQLIKKMLIKTVPKRPDINEVFSD 1294

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 94/205 (45%), Gaps = 20/205 (9%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           + +LMEYC+G  L   +                M ++   +  +H+    ++HRDIK  N
Sbjct: 95  LWILMEYCAGGSLRSLL---RPGKIDEKYIGVIMRELLVALKCIHKDN--VIHRDIKAAN 149

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPIN 224
           VL++ +G+ KLCDFG  + V ++    +             T  + +PE++    G   +
Sbjct: 150 VLITNEGSVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYD 198

Query: 225 EKSDIWALGILLYKLCYYTTPF-EEHGSRA---IMEGKFTYPAYPQYTDSLKNIIRVLLS 280
            K DIW+LGI  Y++     P+ +    RA   I++ K        Y+ SLK  I + L 
Sbjct: 199 TKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEGRSYSSSLKEFIALCLD 258

Query: 281 TNPIQRPNICQLLEELFRIQHKSSP 305
            +P +R +   LL   F   H+++P
Sbjct: 259 EDPKERLSADDLLRSKFIKTHRATP 283

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 96/205 (46%), Gaps = 20/205 (9%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           + ++ME+C+G  L   +                M ++   +  +H+    ++HRDIK  N
Sbjct: 95  LWIIMEHCAGGSLRSLL---RPGKIDEKYIGVIMRELLVALKCIHKDN--VIHRDIKAAN 149

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPIN 224
           VL++ +GN KLCDFG  + V ++    +             T  + +PE++   + +  +
Sbjct: 150 VLITNEGNVKLCDFGVAAQVNQTSLRRQTMA---------GTPYWMAPEVIMEGVYY--D 198

Query: 225 EKSDIWALGILLYKLCYYTTPF-EEHGSRA---IMEGKFTYPAYPQYTDSLKNIIRVLLS 280
            K DIW+LGI  Y++     P+ +    RA   I++ K        Y+ SLK  I + L 
Sbjct: 199 TKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLD 258

Query: 281 TNPIQRPNICQLLEELFRIQHKSSP 305
            +P +R +   LL+  F   HK++P
Sbjct: 259 EDPKERLSADDLLKSKFIRAHKATP 283

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 119/278 (42%), Gaps = 32/278 (11%)

Query: 23  IIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNN 82
           +  + L  G ++ VY A   S     Y    C K+ I+  K+ +  +  E D + +L   
Sbjct: 11  VFLDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKK-VKYVTIEKDLLNMLAKG 69

Query: 83  KYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXX-XXXXMTDV 141
            ++   I        + E+ Y VL   EY SG  LL  +                 + D 
Sbjct: 70  GHL--GIVKLFCTFHDIENLYFVL---EYVSGGELLALIQRLGRLTEDLSRHITAQLVDT 124

Query: 142 SQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDI 201
              V +MH     ++HRD+K ENVLLS +G   + DFG+         +  +F   +   
Sbjct: 125 ---VDYMHSKG--VIHRDLKPENVLLSQEGRVVITDFGAACTA-----ADRKFENTKRTA 174

Query: 202 LKNTTAQYRSPE-MVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG--- 257
               TA+Y SPE +++   GF     SDIWALG ++Y+L     PF         E    
Sbjct: 175 SFVGTAEYVSPELLLHSQCGF----SSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVA 230

Query: 258 ---KFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQL 292
              K+ +   PQ      +I++ +L T+P++RP+  QL
Sbjct: 231 LDYKWLFSNSPQVV----SIVQSILVTDPLKRPSAAQL 264

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 122/275 (44%), Gaps = 29/275 (10%)

Query: 27  YLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIV 86
           +L  GGFA+ +  +I  E   ++   T  K  I   K    +L +E+   K +K+   IV
Sbjct: 147 FLGEGGFARCF--QIKDESGKIFAAKTVAKISIKTEKTRRKLL-SEIQIHKSMKHQN-IV 202

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
            ++D         ED   V +L+  C    L++ +                   +   + 
Sbjct: 203 QFVDCF-------EDHINVYILLGMCPNGSLMELLKKRKILTEPEVRFFT--VQICGAIK 253

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           +MH  +  ++HRD+K+ N+    + N K+ DFG ++ VL +    +  V          T
Sbjct: 254 YMHSRR--VIHRDLKLGNIFFDENYNLKIGDFG-LAAVLANDRERKYTVC--------GT 302

Query: 207 AQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKFTYP 262
             Y +PE++ L      + + DIW++G++++ L     PF+      I       ++T+P
Sbjct: 303 PNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSEYTFP 361

Query: 263 AYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
                +   K +I+ +L  +PI RP+I +++E ++
Sbjct: 362 INKSISQEAKTLIQDILINDPIARPSINEIMEYVW 396

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 97/205 (47%), Gaps = 20/205 (9%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           + ++MEYC+G  + + +                +    + ++H +     ++HRDIK  N
Sbjct: 78  IWIIMEYCNGGSVRNLIKIGRFNEIYISVILRELLYALEYIHHDN-----IIHRDIKAAN 132

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPIN 224
           +L++ +G  KLCDFG  + +        EF   +   +   T  + +PE++  +  +  +
Sbjct: 133 ILINQNGGIKLCDFGIAAKL--------EFSKPKRQTMAG-TPYWMAPEVIIESSLY--D 181

Query: 225 EKSDIWALGILLYKLCYYTTPFEEHGSRAIME--GKFTYPAYP--QYTDSLKNIIRVLLS 280
            K+DIW++GI  Y++     P+ E+ +   M+   K   P      Y+ SLK  I + L 
Sbjct: 182 TKADIWSVGITAYEITTGNPPYCEYDATKAMQLITKLKPPRLEGKMYSKSLKEFIALCLD 241

Query: 281 TNPIQRPNICQLLEELFRIQHKSSP 305
            +P +R    +LLE  F  +++ +P
Sbjct: 242 EDPSERLTSTKLLETEFIKEYQETP 266

>KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON}
           Anc_4.384 YHR205W
          Length = 775

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 116/263 (44%), Gaps = 29/263 (11%)

Query: 28  LTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSLNILRAEVDAMKILKNNKYIV 86
           L  G F QVY  R   + K +Y      K+VIV  N+ +  I    + A     +  +IV
Sbjct: 374 LGKGTFGQVYQVR-KKDTKRIYAMKVLSKKVIVKKNEVAHTIGERNILATTAGDSCPFIV 432

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
               S     Q   D Y+V    +Y SG  L  F +               + ++   + 
Sbjct: 433 GLKFS----FQTPADLYLV---TDYMSGGEL--FWHLQKEGRFAEYRAKFYIAELVLALE 483

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           ++H     +++RD+K EN+LL  +GN  LCDFG     L+  T++  F           T
Sbjct: 484 YLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLKDRTNT--FC---------GT 530

Query: 207 AQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTP-FEEHGSRAIMEGKFTYPAYP 265
            +Y +PE++    G+   +  D W+LG+L++++C   +P F E   R   +  F    +P
Sbjct: 531 TEYLAPELLLDETGY--TKMVDFWSLGVLIFEMCCGWSPFFAEDNQRMYQKIAFGKVKFP 588

Query: 266 Q--YTDSLKNIIRVLLSTNPIQR 286
           +   +   ++ ++ LL+ NP  R
Sbjct: 589 RDVLSPEGRSFVKGLLNRNPKHR 611

>SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [1569
           bp, 522 aa] {ON} similar to uniprot|P38147 Saccharomyces
           cerevisiae YBR274W CHK1 checkpoint kinase 1 homolog of
           the S. pombe and mammalian Chk1 checkpoint kinases
           Protein kinase Chk1
          Length = 522

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 126/283 (44%), Gaps = 33/283 (11%)

Query: 21  EVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILK 80
           +V++ + +  G FA V TA ++ +  ++      +K V +P  +   +   +V    I  
Sbjct: 14  DVVLGDTIGQGSFAFVKTATLSLDPSSV----IAIKFVHLPTCKQHGMSENDVSKEVI-- 67

Query: 81  NNKYIVSYIDSHANRLQ----NSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXX 136
               I S    H+N L+    N    Y+  + ME   G  L D                 
Sbjct: 68  ----IHSRCSKHSNILKVIDCNISKDYL-WIAMEMADGGDLFD--KIEPDIGVDAEVAQF 120

Query: 137 XMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVY 196
               + + ++H+H++   + HRDIK EN+LL  +GN KL DFG  S   R   +      
Sbjct: 121 YFQQLLRAIHHLHEV-CGIAHRDIKPENILLDKNGNLKLADFGLASQFRRKDGTKR---- 175

Query: 197 LQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFE-----EHGS 251
           L  D  +  +  Y +PE++  +  +   + +DIW+ GIL++ L    TP+E     ++  
Sbjct: 176 LARD--QRGSPPYMAPEIIYSSEYYA--DTTDIWSCGILVFVLLTGETPWELPSEDDYNF 231

Query: 252 RAIME--GKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQL 292
           R  +E  G  ++  + +   +  N++R +L  NP +R  I QL
Sbjct: 232 REFLEDNGNLSFGPWAKIDFTQLNLLRKILQPNPSKRATILQL 274

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 101/220 (45%), Gaps = 16/220 (7%)

Query: 100 EDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRD 159
           +D   +  L+EY S   LL  +                   +   ++++H +   ++HRD
Sbjct: 329 QDEANLYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRD 384

Query: 160 IKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT-----TAQYRSPEM 214
           IK EN+LL+ D   KL DFG+ + +L     S+       ++L+ +     TA+Y SPE+
Sbjct: 385 IKPENILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPEL 443

Query: 215 VNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEG--KFTYPAYPQYTDSLK 272
           +  +     + + DIWA G +L++L     PF+        +   K  Y     +   L+
Sbjct: 444 LTDSY---TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILR 500

Query: 273 NIIRVLLSTNPIQRPNICQLLEELF-RIQHKSSPLPNFYV 311
           ++I+ +L  NP  R  I Q+   LF R +  S+P   +Y+
Sbjct: 501 DLIKKILIKNPNNRLTIHQIKSHLFYRSKDFSNPWNIWYL 540

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 62/276 (22%), Positives = 126/276 (45%), Gaps = 29/276 (10%)

Query: 26  NYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYI 85
           ++L  GGFA+ +  +I  +   ++   T  K + + ++++   L +E+   K +++   I
Sbjct: 83  HFLGEGGFARCF--QIKDDGGKIFAAKTVAK-ISIKSEKTRKKLLSEIQIHKSMRHTN-I 138

Query: 86  VSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGV 145
           V ++D         ED   V +L+E C    L+D +                 T +   V
Sbjct: 139 VQFVDCF-------EDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFT--TQIVGAV 189

Query: 146 YHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT 205
            +MH  +  ++HRD+K+ N+      N K+ DFG ++ VL +    +  V          
Sbjct: 190 KYMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFG-LAAVLANDRERKYTV--------CG 238

Query: 206 TAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKFTY 261
           T  Y +PE++        + + DIW+ G+++Y L     PF+      I E    G F +
Sbjct: 239 TPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDFVF 297

Query: 262 PAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           P     +     +I+ +LS +P++RP++ ++++ ++
Sbjct: 298 PKDKFISPEALVLIKDILSIDPLERPSLDEIIDYVW 333

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 123/286 (43%), Gaps = 49/286 (17%)

Query: 31   GGFAQVYTA-RITSEHKNLYPELTCLKRVIVPNKQSLN--------ILRAEVDAMKILKN 81
            G F  VY    +T+       E+  +K+V VP   S N         LR+EV  +K L +
Sbjct: 1190 GSFGAVYLCLNVTTG------EMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-D 1242

Query: 82   NKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDV 141
            +  IV Y+       +N    Y   L +EY +G  +   +                 T V
Sbjct: 1243 HLNIVQYLG-----FENKNSIYS--LFLEYVAGGSVGSLIRMYGRFDESLIKHLT--TQV 1293

Query: 142  SQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDI 201
             +G+ ++H     +LHRD+K +N+LL  DG  K+ DFG         +   + +Y  +D+
Sbjct: 1294 LRGLAYLHSKG--ILHRDMKADNLLLDQDGICKISDFGI--------SRKSKDIYSNSDM 1343

Query: 202  LKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME--GKF 259
                T  + +PEMV+   G+  + K DIW+LG ++ ++     P+      A M   GK 
Sbjct: 1344 TMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKS 1401

Query: 260  -TYPAYPQYTDSLKNIIRV-------LLSTNPIQRPNICQLLEELF 297
             + P  P+  D+L  I RV           +P +RP   +LL   F
Sbjct: 1402 KSAPPIPE--DTLPLITRVGRSFLDACFEIDPEKRPTATKLLSHQF 1445

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 91/201 (45%), Gaps = 29/201 (14%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V + +EYC G  L D++                   +   V++ H LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LQKQRIPLDETSKLFAQIVGAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLAL--GFP 222
           +LL   G   L DFG          + E     Q + +  TT  Y +PE++      G+ 
Sbjct: 159 ILLDKQGYAMLTDFG---------FTRECATKTQLETICGTTV-YMAPELIKRESYDGY- 207

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEH-----GSRAIMEGKFTYPAYPQYTDS-LKNIIR 276
              K D W+LGI+LY + +   PF+E      G + + E     P    YT+   K++I 
Sbjct: 208 ---KVDTWSLGIILYTMLHGFMPFDEEDPTLTGLKIMNE---MPPIVDAYTNVHAKDLIL 261

Query: 277 VLLSTNPIQRPNICQLLEELF 297
            LL   P +RP++ ++LE  F
Sbjct: 262 KLLRKTPSERPSLNKVLEHPF 282

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 80/158 (50%), Gaps = 23/158 (14%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            +  G+ H+H     ++HRDIK ENV++   G  K+ DFGS + V   P   + FV     
Sbjct: 1240 IVSGIKHLHDQG--IVHRDIKDENVIVDSKGCVKIIDFGSAAYVKSGPF--DVFV----- 1290

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEK-SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE+++   G P   K  DIWA+GILLY + +   PF  +    I+EG+ 
Sbjct: 1291 ----GTIDYAAPEVLS---GEPYEGKPQDIWAIGILLYTIVFKENPF--YNIDEILEGEL 1341

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
             +      ++    +I+ +L  +  +RP    L+EE+F
Sbjct: 1342 KFNNSNDISEDCIELIKKILIRSVPKRP----LIEEIF 1375

>Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W
           (REAL)
          Length = 527

 Score = 70.1 bits (170), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 127/289 (43%), Gaps = 50/289 (17%)

Query: 21  EVIIENYLTSGGFAQVYTARITSEHKNLYPE-LTCLKRVIVPNKQSLNILRAEVDAMKIL 79
           +V++ + +  G FA V  A     H  + P  +  +K V VP  + + +   ++    +L
Sbjct: 14  DVVLGDTVGQGTFACVKNA-----HLQMDPSVILAVKFVHVPTCKKMGLTEKDITKEVVL 68

Query: 80  KNNKYIVSYIDSHANRLQ----NSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXX 135
           +      S    H N L+    N    Y+  ++ME   G  L D +              
Sbjct: 69  Q------SKCSKHPNILRLIDCNVSKDYM-WIIMEMADGGDLFDKIEPDVGVD------- 114

Query: 136 XXMTDVSQ--------GVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRS 187
              +DV+Q         + +MH ++  + HRDIK ENVLL  +GN KL DFG  S   R 
Sbjct: 115 ---SDVAQFYFQQLVSAIDYMH-VKCGVAHRDIKPENVLLDKNGNLKLADFGLASQFKRK 170

Query: 188 PTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFE 247
             +      L+  + +  +  Y +PE++    GF   +++DIW++GILLY L    TP+E
Sbjct: 171 DGT------LRLSMDQRGSPPYMAPEVLYSEAGF-YADRTDIWSIGILLYVLLTGQTPWE 223

Query: 248 ----EHGSRAIM---EGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNI 289
               E          +G   +  + +   +  N++R +L  +P++R  +
Sbjct: 224 LPSLEDEDFVFFIQNDGNLNWGPWSKIEFTHLNLLRKILQPDPVKRATL 272

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 104/226 (46%), Gaps = 31/226 (13%)

Query: 107 LLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVL 166
           +L EY +G  LLD++                   V+  + ++H     ++HRD+KIEN++
Sbjct: 209 MLFEYVAGGQLLDYI--IQHGSLREHHARKFARGVASALQYLHANN--IVHRDLKIENIM 264

Query: 167 LSGDGNFKLCDFGSVSGVLRSPTSSEEFV----YLQNDILKNTTAQYRSPEMVNLALGFP 222
           +S  G  K+ DFG +S V  +      F     +   ++LK     Y  PE+        
Sbjct: 265 ISNSGEIKIIDFG-LSNVYDTRKQLHTFCGSLYFAAPELLK--AHPYTGPEV-------- 313

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKFTYPAYPQYTDSLKNIIRVL 278
                D+W+ G++LY L     PF++  S  + E    GK  YP +   +  + +++  +
Sbjct: 314 -----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKRGKVEYPQH--LSIEVMSLLSKM 366

Query: 279 LSTNPIQRPNICQLLEELFRIQHKSSPLPNFYVQR-AMSSLQMDTT 323
           L  +P +R ++ Q++E  +  +   +P P++   R  ++   +D+T
Sbjct: 367 LVVDPSRRASLKQVVEHPWMTKGYDTPAPSYVPNRIPLTPEMLDST 412

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 122/284 (42%), Gaps = 45/284 (15%)

Query: 31   GGFAQVYTA-RITSEHKNLYPELTCLKRVIVPNKQS--------LNILRAEVDAMKILKN 81
            G F  VY    +T+       E+  +K+V VP   S        L  L++EV  +K L +
Sbjct: 1155 GSFGSVYLGLNVTTG------EMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKDL-D 1207

Query: 82   NKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDV 141
            +  IV Y+       +N   ++V  L +EY +G  +   +                   V
Sbjct: 1208 HVNIVQYLG-----FENK--NHVYSLFLEYVAGGSVGSLIRLFGRFDEDLIRFL--AVQV 1258

Query: 142  SQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDI 201
             +G+ ++H     +LHRD+K +N+LL  DG  K+ DFG         +     +Y  +D+
Sbjct: 1259 LRGLAYLHSKG--ILHRDMKADNLLLDVDGICKISDFGI--------SKKSNNIYSNSDM 1308

Query: 202  LKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIM--EGKF 259
                T  + +PEMV+   G+  + K DIW+LG ++ ++     P+      A M   GKF
Sbjct: 1309 TMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFKIGKF 1366

Query: 260  -TYPAYPQYTDSL-----KNIIRVLLSTNPIQRPNICQLLEELF 297
             + P  P+ T  L     K+ +      +P +RP    LL   F
Sbjct: 1367 KSAPPIPEDTQKLLSAEAKSFLDACFEIDPEKRPTADDLLSHPF 1410

>KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON}
           Anc_4.384 YHR205W
          Length = 792

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 119/264 (45%), Gaps = 31/264 (11%)

Query: 28  LTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSLNILRAEVDAMKILKNNKYIV 86
           L  G F QVY  +   + K +Y      K+VIV  N+ +  I    +  +   K++ ++V
Sbjct: 390 LGKGTFGQVYQVK-KKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVITATKSSHFMV 448

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
               S     Q   D Y   L+ +Y SG  L  F +               + ++   + 
Sbjct: 449 GLKFS----FQTPSDLY---LVTDYMSGGEL--FWHLQKEGRFSEDRAKFYIAELVLALE 499

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           ++H     +++RD+K EN+LL  +GN  LCDFG     L+  T++  F           T
Sbjct: 500 YLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLKDRTNT--FC---------GT 546

Query: 207 AQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKFTYP 262
            +Y +PE++    G+   +  D W+LG+L++++C   +PF    ++ + +    GK  +P
Sbjct: 547 TEYLAPELLLDETGY--TKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFP 604

Query: 263 AYPQYTDSLKNIIRVLLSTNPIQR 286
                 +  ++ ++ LL+ NP  R
Sbjct: 605 RDVLSAEG-RSFVKGLLNRNPKHR 627

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 94/206 (45%), Gaps = 20/206 (9%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           + ++MEYC+G  L   +                M ++   + ++H+    ++HRDIK  N
Sbjct: 109 LWIIMEYCAGGSLRSLL---RPGKIDEKYIGVIMRELLVALKYIHKDN--VIHRDIKAAN 163

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPIN 224
           VL++ +G+ KLCDFG  + + +S    +             T  + +PE++    G   +
Sbjct: 164 VLITNEGSVKLCDFGVAAQLNQSTLRRQTMA---------GTPYWMAPEVI--MEGVYYD 212

Query: 225 EKSDIWALGILLYKLCYYTTPF-EEHGSRA---IMEGKFTYPAYPQYTDSLKNIIRVLLS 280
            K DIW+LGI  Y++     P+ E    RA   I + K        YT  LK  I + L 
Sbjct: 213 TKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLD 272

Query: 281 TNPIQRPNICQLLEELFRIQHKSSPL 306
            +P +R +  +L +  F   HK +P+
Sbjct: 273 EDPKERLSAEELSKTKFIKAHKLTPV 298

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 136/298 (45%), Gaps = 51/298 (17%)

Query: 16  QVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLK---RVIVP--NKQSLNILR 70
           QV     I+ + L  G F +V      +   N  P+   +K   R  VP  + + + I R
Sbjct: 38  QVTFGPYIVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRRDTVPKNSDKEVKIYR 97

Query: 71  AEVDAMKILKNNKYIVSYIDSHAN--RLQNS-EDSYVVLLLMEYCSGAGLLDFMNXXXXX 127
            E++A+K L           +H N  RL+   ++S  + +++EY SG     ++      
Sbjct: 98  -EINALKHL-----------THPNIVRLEEVLQNSKYIGIVLEYASGGEFYRYIQKKRRL 145

Query: 128 XXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRS 187
                        +  GV++MH     L+HRD+K+EN+LL  + N  + DFG V+     
Sbjct: 146 KEHAACRL--FAQLISGVHYMHSKG--LVHRDLKLENLLLDKNENLLITDFGFVN----- 196

Query: 188 PTSSEEFVYLQNDILKNTTAQ--YRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTP 245
                EF + +N+++K +     Y +PE+V     +    K+DIW+ G+++Y +     P
Sbjct: 197 -----EFNH-KNELMKTSCGSPCYAAPELVVTTKPYEA-RKADIWSCGVIMYAMLAGYLP 249

Query: 246 FEEHGSRAIMEG----------KFTYPAYPQYTDSL-KNIIRVLLSTNPIQRPNICQL 292
           +++       EG            T   +P+Y + + ++++R +L +NP +R N+ Q+
Sbjct: 250 WDDDSENP--EGDDIAKLYHYITKTPLKFPEYINPVPRDLLRRILVSNPKKRLNLRQV 305

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 137/299 (45%), Gaps = 45/299 (15%)

Query: 11  KGTKLQVASHEVIIENYLTSGGFAQVYTARITSE----HKNLYPELTCLKRVIVP--NKQ 64
           K  K QV     I+   L  G F +V      S+     KN+   +  ++R  +P  +++
Sbjct: 54  KEKKRQVTFGPYIVGPTLGEGEFGKVKLGWSNSKPEEGSKNV--AIKLVRRDTIPKHSEK 111

Query: 65  SLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXX 124
            + I R E++A+K L N+  IV   +     LQNS+    + ++++Y SG     ++   
Sbjct: 112 EVKIYR-EINALKHL-NHPNIVRLEEV----LQNSK---YIGIVLQYASGGEFYKYIQKK 162

Query: 125 XXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGV 184
                           +  GVY+MH     L HRD+K+EN+LL    N  + DFG V+  
Sbjct: 163 RRLKEPPACRL--FAQLISGVYYMHHKG--LAHRDLKLENLLLDEHENLMITDFGFVNE- 217

Query: 185 LRSPTSSEEFVYLQNDILKNTTAQ--YRSPEMVNLALGFPINEKSDIWALGILLYKLCYY 242
                      + +ND++K +     Y +PE+V  A  +    K+D+W+ G++LY +   
Sbjct: 218 -----------FHKNDLMKTSCGSPCYAAPELVVTARPYEA-RKADVWSCGVILYAMLAG 265

Query: 243 TTPFE------EHGSRAIMEGKFTYPA--YPQYTDSL-KNIIRVLLSTNPIQRPNICQL 292
             P++      E    A +    T  A  +P+Y   L ++++R +L +NP  R ++ ++
Sbjct: 266 YLPWDDDPENPEGDDIAKLYHYITKSALKFPEYIKPLPRDLLRRILVSNPDTRLSVMEI 324

>CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} similar
           to uniprot|P11792 Saccharomyces cerevisiae YHR205w SCH9
           serine/threonine protein kinase
          Length = 746

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 116/263 (44%), Gaps = 29/263 (11%)

Query: 28  LTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSLNILRAEVDAMKILKNNKYIV 86
           L  G F QVY  +   + K +Y      K+VIV  N+ +  I    +      K + +IV
Sbjct: 346 LGKGTFGQVYQVK-KKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTSSKASPFIV 404

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
               S     Q   D Y+V    +Y SG  L  F +               + ++   + 
Sbjct: 405 GLKFS----FQTPTDLYLV---TDYMSGGEL--FWHLQREGRFTEDRAKFYIAELVLALE 455

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           H+H     +++RD+K EN+LL  +GN  LCDFG     L+  T++  F           T
Sbjct: 456 HLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLKDRTNT--FC---------GT 502

Query: 207 AQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPF-EEHGSRAIMEGKFTYPAYP 265
            +Y +PE++    G+   +  D W+LG+L++++C   +PF  E   +   +  F    +P
Sbjct: 503 TEYLAPELLLDESGY--TKMVDFWSLGVLIFEMCCGWSPFYAEDNQKMYQKIAFGKVKFP 560

Query: 266 Q--YTDSLKNIIRVLLSTNPIQR 286
           +   +   ++ ++ LL+ NP  R
Sbjct: 561 RDILSPEGRSFVKGLLNRNPKHR 583

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 106/241 (43%), Gaps = 45/241 (18%)

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXX 128
           +R E+  +  LK    I  Y  S+    +       + ++MEYC+G  L   +       
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLIDTK-------LWVIMEYCAGGSLRTLLRPGIIEE 111

Query: 129 XXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188
                    M ++   +  +H+    ++HRDIK  N+L++ +G+ KLCDFG  + + +S 
Sbjct: 112 KYIGVI---MREILVALISIHRDN--VIHRDIKAANILIANNGSVKLCDFGVAAQLSQS- 165

Query: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPF-E 247
                   L+   +   T  + +PE++   + +  + K DIW+LGI  Y++     P+  
Sbjct: 166 -------MLKRQTMAG-TPYWMAPEVIMEGVYY--DTKVDIWSLGITAYEIATGNPPYCH 215

Query: 248 EHGSRAI----------MEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
               RA+          +EG+       +Y+  LK  I + L  +P +RP      EELF
Sbjct: 216 MEAIRAMQMITKSKPPRLEGR-------EYSQPLKEFIALCLDEDPKERP----YAEELF 264

Query: 298 R 298
           +
Sbjct: 265 K 265

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 87/203 (42%), Gaps = 33/203 (16%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           V + +EYC G  L D +                   +   VY+ H L    +HRD+K+EN
Sbjct: 107 VWMALEYCPGKELYDHL--LFSKRIPIAECTELFAQIVGAVYYAHSLN--CVHRDLKLEN 162

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLAL--GFP 222
           +LL   G  KL DFG     +   T          + +  TT  Y +PE++      GF 
Sbjct: 163 ILLDKHGRAKLTDFGFTRECMTRSTL---------ETVCGTTV-YMAPELIERKSYDGFK 212

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNI-------- 274
           I    DIWALG++LY + Y   PF+E       E K  +    +  D   NI        
Sbjct: 213 I----DIWALGVILYTMIYGAMPFDEDD-----EVKTKWKIVNEDPDFTNNISSNDVKDL 263

Query: 275 IRVLLSTNPIQRPNICQLLEELF 297
           I+ LL  +P +RP I ++L+  F
Sbjct: 264 IKKLLKKDPTERPTIREILKHDF 286

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 98/215 (45%), Gaps = 30/215 (13%)

Query: 107 LLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVL 166
           +L EY SG  LLD++                   ++  + ++H     ++HRD+KIEN++
Sbjct: 263 MLFEYVSGGQLLDYI--IQHGSLREHHARKFARGIASALEYIHANN--IVHRDLKIENIM 318

Query: 167 LSGDGNFKLCDFGSVSGVLRSPTSSEEFV----YLQNDILKNTTAQYRSPEMVNLALGFP 222
           +S  G  K+ DFG +S V         F     +   ++LK     Y  PE+        
Sbjct: 319 ISTSGEIKIIDFG-LSNVFDRKKQLHTFCGSLYFAAPELLK--AHPYTGPEV-------- 367

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKFTYPAYPQYTDSLKNIIRVL 278
                D+W+ G++LY L     PF++  S      I +GK  YP +   +  + +++  +
Sbjct: 368 -----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPNH--LSIEVISLLSKM 420

Query: 279 LSTNPIQRPNICQLLEELFRIQHKSSPLPNFYVQR 313
           L  +P++R ++ Q++E  +  +    P P++  +R
Sbjct: 421 LVVDPLRRASLKQVVEHPWMTRGYDYPPPSYVPRR 455

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 102/222 (45%), Gaps = 30/222 (13%)

Query: 107 LLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVL 166
           +L EY SG  LLD++                   ++  + ++H     ++HRD+KIEN++
Sbjct: 221 MLFEYVSGGQLLDYI--IQHGSIREHQARKFARGIASALIYLHANN--IVHRDLKIENIM 276

Query: 167 LSGDGNFKLCDFGSVSGVLRSPTSSEEFV----YLQNDILKNTTAQYRSPEMVNLALGFP 222
           +S     K+ DFG +S +  S      F     +   ++LK     Y  PE+        
Sbjct: 277 ISDSSEIKIIDFG-LSNIYDSRKQLHTFCGSLYFAAPELLKANP--YTGPEV-------- 325

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKFTYPAYPQYTDSLKNIIRVL 278
                D+W+ G++L+ L     PF++  S      I +GK  YP +   +  + +++  +
Sbjct: 326 -----DVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKM 378

Query: 279 LSTNPIQRPNICQLLEELFRIQHKSSPLPNFYVQRAMSSLQM 320
           L  +P +R  + Q++E  + ++  + P P++  +R   +++M
Sbjct: 379 LVVDPKRRATLKQVVEHHWMVRGFNGPPPSYLPKRVPLTIEM 420

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 94/211 (44%), Gaps = 34/211 (16%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           + ++MEYC+G  L   +                +      + ++H+    ++HRDIK  N
Sbjct: 97  LWVIMEYCAGGSLRTLLRPGKIDEKYLGVIVRKLL---IALVYIHKDN--VIHRDIKAAN 151

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPIN 224
           VL++ +G+ KLCDFG V+  L +     + +          T  + +PE++   + +  N
Sbjct: 152 VLITNEGHVKLCDFG-VAAQLTAANHKRQTMA--------GTPYWMAPEVIMEGVYY--N 200

Query: 225 EKSDIWALGILLYKLCYYTTPF-EEHGSRAI----------MEGKFTYPAYPQYTDSLKN 273
            K+DIW+LGI  Y++     P+ +    RA+          +EG+        Y+  LK 
Sbjct: 201 TKADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGR-------NYSPLLKE 253

Query: 274 IIRVLLSTNPIQRPNICQLLEELFRIQHKSS 304
            I + L  +P +RP    LL   F   HK S
Sbjct: 254 FIALCLDEDPEERPTAEDLLSSKFVKAHKGS 284

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 97/212 (45%), Gaps = 34/212 (16%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           + ++MEYC+G  L   +                M ++   +  +H+    ++HRDIK  N
Sbjct: 113 LWIIMEYCAGGSLRSLL---RPGKIDEKYIGVIMRELLVALKFIHKDN--IIHRDIKAAN 167

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPIN 224
           VL++ +G  KLCDFG V+  L   T       L+   +   T  + +PE++    G   +
Sbjct: 168 VLITNEGGVKLCDFG-VAAQLNQRT-------LRRQTMAG-TPYWMAPEVI--MEGVYYD 216

Query: 225 EKSDIWALGILLYKLCYYTTPF-EEHGSRAI----------MEGKFTYPAYPQYTDSLKN 273
            K DIW+LGI  Y++     P+ +    RA+          +EG+        YT  +K 
Sbjct: 217 TKVDIWSLGITAYEISTGNPPYCDVEALRAMQLITKSKPPRLEGR-------NYTPLIKE 269

Query: 274 IIRVLLSTNPIQRPNICQLLEELFRIQHKSSP 305
            I + L  +P +R +  +LL+  F   HK++P
Sbjct: 270 FIALCLDEDPNERLSADELLKSKFIKAHKTTP 301

>SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} similar
           to uniprot|Q03306 Saccharomyces cerevisiae YDR466W
          Length = 784

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 124/286 (43%), Gaps = 29/286 (10%)

Query: 18  ASHEVIIENYLTSGGFAQVYTARITSEHKNLYPE-----LTCLKRVIVPNKQSLNILRAE 72
           + H+ I +  L  G ++ VY A   + + +  P+       C K+ I+  +  +  +  E
Sbjct: 6   SPHDFIFKEQLGHGSYSTVYKALDKARNNSGLPQHFYAIKVCSKKHII-RENKVKYVTIE 64

Query: 73  VDAMKILK--NNKYIVS-YIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXX 129
            + + +L   NN  IV  Y   H     + E+ Y VL   +Y  G  LL  +        
Sbjct: 65  KNTLNLLAQGNNPGIVKLYYTFH-----DQENLYFVL---DYAPGGELLHLLQRYGTFDE 116

Query: 130 XXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPT 189
                   M  +   V ++H     ++HRD+K ENVLLS DG   + DFG+ S V    T
Sbjct: 117 VWSKHF--MCQLVDVVEYIHSKG--VIHRDLKPENVLLSKDGRLMVTDFGAASVVTTDGT 172

Query: 190 SSEEFVYLQNDILKNTTAQYRSPE-MVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248
           SS+  V  +       TA+Y SPE ++N    F     SDIWALG +LY+    + PF  
Sbjct: 173 SSDNSVSERAASFVG-TAEYVSPELLLNNQCFF----SSDIWALGCILYQFMQGSPPFRG 227

Query: 249 HGSRAIMEG--KFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQL 292
                  E      Y        S+ +++R +L  +P +R +I  +
Sbjct: 228 ENELQTFEKIVSLDYHWKLAVNPSVMDLVRHILVIDPHERLSISAI 273

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 77/155 (49%), Gaps = 21/155 (13%)

Query: 141 VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
           +  G+ H+H L   ++HRDIK EN+++  +G  ++ DFGS +     P            
Sbjct: 788 IVAGIKHIHGLG--IIHRDIKTENIIIDSEGCVQVIDFGSAAYATNGPFQ---------- 835

Query: 201 ILKNTTAQYRSPEMVNLALGFPINEK-SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
            + + T  Y SPE++    G P   K  D+WALGILLY + +  TPF  +    I+E + 
Sbjct: 836 -VFHGTIDYASPEVLK---GEPYEGKPQDVWALGILLYIITFKQTPF--NSVAEIIENEL 889

Query: 260 TY-PAYPQ-YTDSLKNIIRVLLSTNPIQRPNICQL 292
              PA+ +  +D  + +I  +L      RP I ++
Sbjct: 890 EIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 137/298 (45%), Gaps = 46/298 (15%)

Query: 23  IIENYLTSGGFAQVYTARITSEHKNL-YPELTCLK---RVIVP--NKQSLNILRAEVDAM 76
           I+ + L  G F +V      + + ++  P+   +K   R  +P  +++ + I R E++A+
Sbjct: 41  IVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKEIKIYR-EINAL 99

Query: 77  KILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXX 136
           K L N+  IV   +     LQNS+  Y+ ++L EY SG     ++               
Sbjct: 100 KHL-NHPNIVRLEEV----LQNSK--YIGIVL-EYASGGEFYKYIQKKRRLKEGPACRL- 150

Query: 137 XMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVY 196
               +  GVY+MH     L+HRD+K+EN+LL  + N  + DFG V+          EF+ 
Sbjct: 151 -FAQLISGVYYMHSKG--LVHRDLKLENLLLDKNENLLITDFGFVN----------EFL- 196

Query: 197 LQNDILKNTTAQ--YRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGS--- 251
            +N+++K +     Y +PE+V  A  +    K+D+W+ G++LY +     P+++      
Sbjct: 197 PENELMKTSCGSPCYAAPELVVTARPYEA-RKADVWSCGVILYAMLAGYLPWDDDPENPD 255

Query: 252 --------RAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQH 301
                   R I      +P Y       ++++R +L  +P +R  I + L+  +   H
Sbjct: 256 GDDIGKLYRYITRTPLKFPDY--IAPVPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 111/251 (44%), Gaps = 58/251 (23%)

Query: 48  LYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLL 107
           +Y E+  LK +  PN     I+R E    ++L+N+KYI                     +
Sbjct: 85  IYREINALKHLTHPN-----IVRLE----EVLQNSKYIG--------------------I 115

Query: 108 LMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLL 167
           ++EY SG     ++                   +  GVY+MH     L+HRD+K+EN+LL
Sbjct: 116 VLEYASGGEFYKYIQKKRRLKEPIACKL--FAQLVSGVYYMHSKG--LVHRDLKLENLLL 171

Query: 168 SGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQ---YRSPEMVNLALGFPIN 224
             + N  + DFG V+             +LQN+ L  T+     Y +PE+V  +  +   
Sbjct: 172 DKNENLIITDFGFVNE------------FLQNNELMKTSCGSPCYAAPELVVTSNPYKA- 218

Query: 225 EKSDIWALGILLYKLCYYTTPFEE--HGSRAIMEGKF-----TYP-AYPQYTDSL-KNII 275
            K+D+W+ GI+L+ +     P+++     R     K      T P  +P Y  ++ ++++
Sbjct: 219 RKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLYNYITTSPLKFPSYISAIPRDLL 278

Query: 276 RVLLSTNPIQR 286
           R +L  NP QR
Sbjct: 279 RKILVANPNQR 289

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 102/222 (45%), Gaps = 30/222 (13%)

Query: 107 LLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVL 166
           +L EY SG  LLD++                   ++  + ++H     ++HRD+KIEN++
Sbjct: 219 MLFEYVSGGQLLDYI--IQHGSIREHQAKKFARGIASALMYLHANN--IVHRDLKIENIM 274

Query: 167 LSGDGNFKLCDFGSVSGVLRSPTSSEEFV----YLQNDILKNTTAQYRSPEMVNLALGFP 222
           +S     K+ DFG +S +  S      F     +   ++LK     Y  PE+        
Sbjct: 275 ISDSSEIKIIDFG-LSNLYDSRKQLYTFCGSLYFAAPELLKANP--YTGPEV-------- 323

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKFTYPAYPQYTDSLKNIIRVL 278
                D+W+ G++L+ L     PF++  S      I +GK  YP +   +  + +++  +
Sbjct: 324 -----DVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKM 376

Query: 279 LSTNPIQRPNICQLLEELFRIQHKSSPLPNFYVQRAMSSLQM 320
           L  +P +R  + Q++E  + ++  S P P++  +R   +++M
Sbjct: 377 LVVDPKRRATLKQVVEHHWMVRGFSGPPPSYLPKRIPLTMEM 418

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 74/147 (50%), Gaps = 7/147 (4%)

Query: 157 HRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVN 216
           H +IK  N+L S DG   + + GS+  +     + +    ++    ++ T  Y  PE++N
Sbjct: 238 HMNIKPSNILFSSDGLPVITELGSLQKLDLKIENVKMLKSIKEWTEEHCTVYYMPPELLN 297

Query: 217 LALGFPINEKSDIWALGILLYKLCYYTTPF--EEHGSR-----AIMEGKFTYPAYPQYTD 269
           L +G  ++   DIW+LG  LY L +  +PF  EE  +       I + ++++P    Y+ 
Sbjct: 298 LKVGTVLDCSVDIWSLGCTLYTLLFGISPFKREEQVNEVPLKYGISKARYSFPEGHVYSK 357

Query: 270 SLKNIIRVLLSTNPIQRPNICQLLEEL 296
            L ++I   L  NP  RP + +LL +L
Sbjct: 358 KLVSVIETCLQVNPTMRPTVNELLGQL 384

>KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]
           {ON} similar to uniprot|P11792 Saccharomyces cerevisiae
           YHR205W SCH9 protein kinase involved in growth control
           may be redundant with cAMP pathway cAMP-dependent
           protein kinase homolog suppressor of cdc25ts
          Length = 755

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 123/283 (43%), Gaps = 31/283 (10%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSLN 67
           +K   K      +  +   L  G F QVY  R   + K +Y      K+VIV  N+ +  
Sbjct: 332 FKSTKKRHYGPQDFEVLRLLGKGTFGQVYQVR-KKDTKRIYAMKVLSKKVIVKKNEIAHT 390

Query: 68  ILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXX 127
           I    +      K+  +IV    S     Q   D Y+V    ++ SG  L  F +     
Sbjct: 391 IGERNILVRTASKSCPFIVGLKFS----FQTPADLYLV---TDFMSGGEL--FWHLQKEG 441

Query: 128 XXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRS 187
                     + ++   + ++H+    +++RD+K EN+LL  +GN  LCDFG     L+ 
Sbjct: 442 RFAEDRAKFYIAELVLALEYLHEND--IVYRDLKPENILLDANGNIALCDFGLSKADLKD 499

Query: 188 PTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFE 247
            T++  F           T +Y +PE++    G+   +  D W+LG+L++++C   +PF 
Sbjct: 500 RTNT--FC---------GTTEYLAPELLLDESGY--TKMVDFWSLGVLIFEMCCGWSPFF 546

Query: 248 EHGSRAIME----GKFTYPAYPQYTDSLKNIIRVLLSTNPIQR 286
              ++ + +    GK  +P     +   ++ ++ LL+ NP  R
Sbjct: 547 AEDNQKMYQKIAFGKVKFPR-DVLSPEGRSFVKGLLNRNPRHR 588

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 98/215 (45%), Gaps = 30/215 (13%)

Query: 107 LLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVL 166
           +L EY SG  LLD++                   ++  + ++H     ++HRD+KIEN++
Sbjct: 179 MLFEYVSGGQLLDYI--IQHGSLREHHARKFTRGIASALQYLHANN--IVHRDLKIENIM 234

Query: 167 LSGDGNFKLCDFGSVSGVLRSPTSSEEFV----YLQNDILKNTTAQYRSPEMVNLALGFP 222
           +S  G  K+ DFG +S +         F     +   ++LK   + Y  PE+        
Sbjct: 235 ISTSGEIKIIDFG-LSNLFDKSKQLHTFCGSLYFAAPELLK--ASPYTGPEV-------- 283

Query: 223 INEKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKFTYPAYPQYTDSLKNIIRVL 278
                D+W+ G++LY L     PF++  S      I +GK  YP +   +  + +++  +
Sbjct: 284 -----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKM 336

Query: 279 LSTNPIQRPNICQLLEELFRIQHKSSPLPNFYVQR 313
           L  +P +R ++ Q++E  + ++    P P++   R
Sbjct: 337 LVVDPHRRASLKQVVEHHWMVRGYDGPPPSYVPNR 371

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 125/300 (41%), Gaps = 48/300 (16%)

Query: 31   GGFAQVYTA-RITSEHKNLYPELTCLKRVIVPN--------KQSLNILRAEVDAMKILKN 81
            G F  VY +  IT+       E+  +K+V VP         K  +  L++EV  +K L +
Sbjct: 1160 GSFGAVYLSLNITTG------EMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-D 1212

Query: 82   NKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDV 141
            +  IV Y+ S            +  L +EY +G  +   +                 T V
Sbjct: 1213 HLNIVQYLGSEIR-------GNIYSLFLEYVAGGSVGSLIRLYGRFDEKLIRHLN--TQV 1263

Query: 142  SQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDI 201
              G+ ++H     +LHRD+K +N+LL  DG  K+ DFG         +   + +Y  +D+
Sbjct: 1264 LSGLKYLHS--KGILHRDMKADNLLLDEDGICKISDFGI--------SKKSKNIYSNSDM 1313

Query: 202  LKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME--GKF 259
                T  + +PEMV+   G+  + K DIW+LG ++ ++     P+      A M   GK 
Sbjct: 1314 TMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKS 1371

Query: 260  -TYPAYPQYTDSL-----KNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPNFYVQR 313
             + P  P  T  L     K+ +      +P +RP    LLE  F    K  P  NF   R
Sbjct: 1372 KSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLEHSF---SKVDPAFNFSRTR 1428

>TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.591
           YDR466W
          Length = 694

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 122/289 (42%), Gaps = 34/289 (11%)

Query: 20  HEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKIL 79
           H+ + +  L  G ++ VY A   +    +Y    C K+ I+  K+ +  +  E + + +L
Sbjct: 10  HDFVFKQELGHGSYSTVYKAVDRTNANRVYAIKVCSKQHIIKEKK-VKYVTIEKNTLNLL 68

Query: 80  KNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMT 139
              ++    +  H     + E+ Y VL   +Y  G  LL  ++                 
Sbjct: 69  TRARH-PGIVKLHYT-FHDEENLYFVL---DYAPGGELLSLLHRMKTFSEMWACHFTCQL 123

Query: 140 DVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQN 199
             S    H   +    +HRD+K EN+LL+ +G   + DFG+ +G   + +    FV    
Sbjct: 124 IDSMQFLHSQGI----IHRDLKPENLLLNNEGRLMITDFGTATG---TDSRGSSFV---- 172

Query: 200 DILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 TA+Y SPE++   L    +  SDIWALG ++Y+    + PF         E   
Sbjct: 173 -----GTAEYVSPELL---LHNQCDVSSDIWALGCMIYQFLQGSPPFRGENELQTFEKTV 224

Query: 260 T--YPA-YPQYTDS-----LKNIIRVLLSTNPIQRPNICQL-LEELFRI 299
           +  YP   PQ T       + ++ R +L  +P  RP + Q+ L + F +
Sbjct: 225 SLDYPWNNPQVTPKGINPVVVDLTRRILVLDPSVRPTLQQIKLHKWFEL 273

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 79/165 (47%), Gaps = 20/165 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            V +G+ ++H     +LHRD+K +N+LL  DG  K+ DFG         +   E +Y  ++
Sbjct: 1247 VLEGLSYLHSQG--ILHRDMKADNLLLDQDGICKISDFGI--------SKKSEDIYSNSE 1296

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTP---FEEHGSRAIMEG 257
            +    T  + +PEMV+   G+  N K DIW+LG ++ ++     P   FE   +   +  
Sbjct: 1297 MTMRGTVFWMAPEMVDTKQGY--NAKVDIWSLGCVVLEMFAGKRPWSNFEVVTAMYKIGQ 1354

Query: 258  KFTYPAYPQYTDSL-----KNIIRVLLSTNPIQRPNICQLLEELF 297
              + P  P+ T  L     KN +      +P +RP   QLLE  F
Sbjct: 1355 SKSAPPIPEDTKDLISPTAKNFLNQCFHIDPKERPTAGQLLEHPF 1399

>Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205W
           (SCH9) - cAMP-dependent protein kinase homolog,
           suppressor of cdc25ts [contig 376] FULL
          Length = 744

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 123/283 (43%), Gaps = 31/283 (10%)

Query: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSLN 67
           +K   K      +  +   L  G F QVY  R   + K +Y      K+VIV  N+ +  
Sbjct: 321 FKATMKQHYGPQDFEVLRLLGKGTFGQVYQVR-KKDTKRIYAMKVLSKKVIVKKNEIAHT 379

Query: 68  ILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXX 127
           I    +      K+  +IV    S     Q   D Y+V    ++ SG  L  F +     
Sbjct: 380 IGERNILVRTASKSCPFIVGLKFS----FQTPADLYLV---TDFMSGGEL--FWHLQKEG 430

Query: 128 XXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRS 187
                     + ++   + ++H+    +++RD+K EN+LL  +GN  LCDFG     L+ 
Sbjct: 431 RFAEDRARFYIAELVLALEYLHEND--IVYRDLKPENILLDANGNIALCDFGLSKADLKD 488

Query: 188 PTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFE 247
            T++  F           T +Y +PE++    G+   +  D W+LG+L++++C   +PF 
Sbjct: 489 RTNT--FC---------GTTEYLAPELLLDESGY--TKMVDFWSLGVLIFEMCCGWSPFF 535

Query: 248 EHGSRAIME----GKFTYPAYPQYTDSLKNIIRVLLSTNPIQR 286
              ++ + +    GK  +P     +   ++ ++ LL+ NP  R
Sbjct: 536 AEDNQKMYQKIAFGKVKFPR-DVLSPEGRSFVKGLLNRNPRHR 577

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 126/280 (45%), Gaps = 37/280 (13%)

Query: 31   GGFAQVYTA-RITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYI 89
            G F  VY +  +T+       E+  +K+V VP   S N   A V  ++ L++   ++  +
Sbjct: 1347 GSFGSVYLSLNVTTG------EMMAVKQVEVPEFGSQN--EAIVSTVEALRSEVTLLKDL 1398

Query: 90   DSHANRLQN---SEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
            D H N +Q     + + +  L +EY +G  +   +                 T +  G+ 
Sbjct: 1399 D-HINIVQYLGFEKKNNIYSLFLEYVAGGSIGSLI--RMYGRFDESLIRHSTTQILAGLS 1455

Query: 147  HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
            ++H     +LHRD+K +N+LL G+G  K+ DFG         +   + +Y  +++    T
Sbjct: 1456 YLHSKG--ILHRDMKADNILLDGEGICKISDFGI--------SRKSKDIYSNSEMTMRGT 1505

Query: 207  AQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIM----EGKFTYP 262
              + +PEMV+   G+  + K DIW+LG ++ ++     P+      A M    + K + P
Sbjct: 1506 VFWMAPEMVDTKQGY--SAKVDIWSLGCIILEMFAGKRPWSNLEVVAAMFKIGQSK-SAP 1562

Query: 263  AYPQYTDSL-----KNIIRVLLSTNPIQRPNICQLLEELF 297
              P+ T  L     ++ +      +P +RP   Q+L+ LF
Sbjct: 1563 PIPEDTLPLISQDGRDFLDDCFKIDPEKRPTAEQMLDHLF 1602

>TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}
           Anc_4.384 YHR205W
          Length = 754

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 121/283 (42%), Gaps = 29/283 (10%)

Query: 8   KYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSL 66
           +Y+   K      +  +   L  G F QVY  +   + K +Y      K+VIV  N+ + 
Sbjct: 332 EYRSTKKRHYGPSDFEVLRLLGKGTFGQVYQVK-KKDTKRIYAMKVLSKKVIVKKNEIAH 390

Query: 67  NILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXX 126
            I    +      K   +IVS   S     Q   D Y+V    +Y SG  L  F +    
Sbjct: 391 TIGERNILVHSASKTCPFIVSLKFS----FQTPTDLYLV---TDYMSGGEL--FWHLQKE 441

Query: 127 XXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLR 186
                      +  +   + ++H     +++RD+K EN+LL  +GN  LCDFG     L+
Sbjct: 442 GRFTEDRAKFYIAQLVLALEYLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLK 499

Query: 187 SPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTP- 245
             T++  F           T +Y +PE++    G+   +  D W+LG+L++++C   +P 
Sbjct: 500 DRTNT--FC---------GTTEYLAPELLLDETGY--TKMVDFWSLGVLIFEMCCGWSPF 546

Query: 246 FEEHGSRAIMEGKFTYPAYPQ--YTDSLKNIIRVLLSTNPIQR 286
           F E   +   +  F    +P+   +   ++ ++ LL+ NP  R
Sbjct: 547 FAEDNQKMYQKIAFGKVKFPRDILSPEGRSFVKGLLNRNPNHR 589

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 80/148 (54%), Gaps = 12/148 (8%)

Query: 155 LLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEM 214
           ++HRDIK EN+LL  D   KL DFG+   +L    +++ F  L+       TA+Y SPE+
Sbjct: 278 IVHRDIKPENILLDKDMKVKLTDFGTAR-ILEKDETTQTFNLLERSKSFVGTAEYVSPEL 336

Query: 215 VNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKFTYPA-YPQYTD 269
           +N      ++ K DIWA G +L+++     PF+        + +M+ ++ + A +P    
Sbjct: 337 LNDNY---VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV-- 391

Query: 270 SLKNIIRVLLSTNPIQRPNICQLLEELF 297
            ++++I+ +L  +P QR +  Q+ +  F
Sbjct: 392 -IRDLIKKILVKSPEQRLDASQIKKHHF 418

>ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YHR205W (SCH9)
          Length = 711

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 117/264 (44%), Gaps = 31/264 (11%)

Query: 28  LTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSLNILRAEVDAMKILKNNKYIV 86
           L  G F QVY  R   + K +Y      K+VIV  N+ +  I    +      K+  +IV
Sbjct: 310 LGKGTFGQVYQVR-KKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKSCPFIV 368

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
               S     Q   D Y   L+ ++ SG  L  F +               + ++   + 
Sbjct: 369 GLKFS----FQTPTDLY---LVTDFLSGGEL--FWHLQKEGRFTEERAKFYIAELVLALE 419

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           ++H     +++RD+K EN+LL  +GN  LCDFG     L+  T++  F           T
Sbjct: 420 YLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLKDRTNT--FC---------GT 466

Query: 207 AQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIME----GKFTYP 262
            +Y +PE++    G+   +  D W+LG+L++++C   +PF    ++ + +    GK  +P
Sbjct: 467 TEYLAPELLLDETGY--TKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFP 524

Query: 263 AYPQYTDSLKNIIRVLLSTNPIQR 286
                +   ++ ++ LL+ NP  R
Sbjct: 525 R-DVLSPEGRSFVKGLLNRNPKHR 547

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/265 (24%), Positives = 119/265 (44%), Gaps = 56/265 (21%)

Query: 48  LYPELTCLKRVIVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLL 107
           +Y E+  LK +  PN     I+R E    ++L+N+KYI                     +
Sbjct: 124 IYREINALKHLTHPN-----IVRLE----EVLQNSKYIG--------------------I 154

Query: 108 LMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLL 167
           ++EY SG     ++                 + +  GVY+MH     L+HRD+K+EN+LL
Sbjct: 155 VLEYASGGEFYKYI--QKKRRLKESVASNLFSQLVSGVYYMHCKG--LVHRDLKLENLLL 210

Query: 168 SGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQ--YRSPEMVNLALGFPINE 225
              GN  + DFG V+          EF     +++K +     Y +PE+V     +    
Sbjct: 211 DKYGNLIITDFGFVN----------EFSKFS-ELMKTSCGSPCYAAPELVISTRPYEA-R 258

Query: 226 KSDIWALGILLYKLCYYTTPFEE-----HGSRAIMEGKF--TYP-AYPQYTDSL-KNIIR 276
           K+DIW+ GI+L+ +     P+++      G+      K+  T P  +P+Y   + ++++R
Sbjct: 259 KADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKLYKYITTTPLKFPEYISPMARDLLR 318

Query: 277 VLLSTNPIQRPNICQLLEELFRIQH 301
            +L   P +R  + Q+L+  + + H
Sbjct: 319 NILIPYPQKRATLKQILKHQWLLPH 343

>KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 793

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 121/290 (41%), Gaps = 51/290 (17%)

Query: 28  LTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP--NKQSLNILRAEVDAMKILKNNKYI 85
           L  GG  +VY  + +S+HK     +  LKRV     ++ S++  + E++ +K L+N + +
Sbjct: 478 LGKGGSGKVYKVK-SSDHK-----VYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRV 531

Query: 86  VSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGV 145
           V  ID H  +        V+ LLME C    L   +                  ++ + V
Sbjct: 532 VKLIDYHMGQ-------GVLFLLME-CGEHDLSQVLTQRSKIPFDTEFVRYHFQEMIKCV 583

Query: 146 YHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNT 205
             +H     ++H D+K  N +    G  K+ DFG  + V     +    +Y  N I    
Sbjct: 584 KVVHDAD--IVHSDLKPANFVFV-KGMLKIIDFGIANAVPDHTVN----IYRDNQI---G 633

Query: 206 TAQYRSPEMVNLALGFPINEK----------SDIWALGILLYKLCYYTTPFEEHGSR--- 252
           T  Y +PE + +A+ F  N+           SD+W+ G +LY++ Y   P+         
Sbjct: 634 TPNYMAPETL-VAMNFTRNDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRL 692

Query: 253 -AIMEGKFTYPAYPQYTDSLKNI--------IRVLLSTNPIQRPNICQLL 293
            AIM      P YP+  DS   +        IR  L  NPI R  I QLL
Sbjct: 693 YAIMNPDVKIP-YPE-KDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLL 740

>KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {ON}
           similar to uniprot|P11792 Saccharomyces cerevisiae
           YHR205W SCH9 protein kinase involved in growth control
           may be redundant with cAMP pathway cAMP-dependent
           protein kinase homolog suppressor of cdc25ts
          Length = 734

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 122/284 (42%), Gaps = 31/284 (10%)

Query: 8   KYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSL 66
           +Y    K Q    +  +   L  G F QVY  R   +   +Y      K+VIV  N+ + 
Sbjct: 311 EYTSTKKRQYGPQDFEVLRLLGKGTFGQVYQVR-KKDTMRIYAMKVLSKKVIVKKNEIAH 369

Query: 67  NILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXX 126
            I    +      K++ +IV    S     Q   D Y+V    ++ SG  L  F +    
Sbjct: 370 TIGERNILVRTASKSSPFIVGLKFS----FQTPTDLYLV---TDFMSGGEL--FWHLQKE 420

Query: 127 XXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLR 186
                      + ++   + ++H     +++RD+K EN+LL  +GN  LCDFG     L+
Sbjct: 421 GRFTEDRAKFYIAELVLALEYLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLK 478

Query: 187 SPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPF 246
             T++  F           T +Y +PE++    G+   +  D W+LG+L++++C   +PF
Sbjct: 479 DRTNT--FC---------GTTEYLAPELLMDETGY--TKMVDFWSLGVLIFEMCCGWSPF 525

Query: 247 ----EEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQR 286
                +   + I  GK  +P     +   ++ ++ LL+ NP  R
Sbjct: 526 FASDNQKMYQKIAFGKVKFPR-DVLSPEGRSFVKGLLNRNPKHR 568

>CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209c IPL1
           ser/thr protein kinase
          Length = 358

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 111/267 (41%), Gaps = 41/267 (15%)

Query: 28  LTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNK----QSLNILRAEVDAMKILKNNK 83
           L  G F +VY  R    HK       C  + I  N+      L  L+ EVD    + +  
Sbjct: 106 LGKGKFGKVYCVR----HKK--SGFICALKAIEKNEILQFNLLKQLKREVDIQLGMDHPN 159

Query: 84  YIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQ 143
            I  Y   H        D   V LLME+     L  + +               +  ++ 
Sbjct: 160 IIKLYAHFH--------DEKRVYLLMEHSINGEL--YKSLKNNGPFNDVLASHYIYQIAD 209

Query: 144 GVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILK 203
            +++MH+ +  ++HRD+K ENVL+  D   KL DFG     + +P  S+           
Sbjct: 210 ALHYMHKKR--IIHRDVKPENVLIGFDNVVKLADFG---WSILNPEGSKRKTLC------ 258

Query: 204 NTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKF 259
             T  Y SPEM+        +E+ D+WALG+L Y+L     PFEE+      + I++   
Sbjct: 259 -GTIDYLSPEMITPR---EYDEQVDVWALGVLAYELVVGVPPFEENSKELTYKRILKCDL 314

Query: 260 TYPAYPQYTDSLKNIIRVLLSTNPIQR 286
            +P     +   K++I  LL T+  QR
Sbjct: 315 NFPE--SISKDAKDLISKLLVTDTTQR 339

>Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii ADL389W
          Length = 739

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 120/284 (42%), Gaps = 31/284 (10%)

Query: 8   KYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSL 66
           +Y    K      +  +   L  G F QVY  R   + K +Y      K+VI+  N+ + 
Sbjct: 317 EYSHTKKRHCGPQDFEVLRLLGKGTFGQVYQVR-KKDTKRIYAMKVLSKKVIIKKNEIAH 375

Query: 67  NILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXX 126
            I    +      K+  +IV    S     Q   D Y+V   M    G G L F +    
Sbjct: 376 TIGERNILVRTASKSCPFIVGLKFS----FQTPADLYLVTDFM----GGGEL-FWHLQKE 426

Query: 127 XXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLR 186
                      + ++   + ++H     +++RD+K EN+LL  +GN  LCDFG     L+
Sbjct: 427 GRFTEDRAKFYIAELVLALEYLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLK 484

Query: 187 SPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPF 246
             T++  F           T +Y +PE++    G+   +  D W+LG+L++++C   +PF
Sbjct: 485 DRTNT--FC---------GTTEYLAPELLLDETGY--TKMVDFWSLGVLIFEMCCGWSPF 531

Query: 247 ----EEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQR 286
                +   + I  GK  +P     +   ++ ++ LL+ NP  R
Sbjct: 532 FADDNQKMYQKIAFGKVKFPR-DVLSPEGRSFVKGLLNRNPKHR 574

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 96/213 (45%), Gaps = 34/213 (15%)

Query: 105 VLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIEN 164
           + ++MEYC+G  L   +                  ++   + ++H+    ++HRDIK  N
Sbjct: 114 LWIIMEYCAGGSLRTLLRPGKIDEKYIGVITR---EILIALKYIHKDN--IIHRDIKAAN 168

Query: 165 VLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPIN 224
           VL++ +G+ KLCDFG V+  L   T   + +          T  + +PE++    G   +
Sbjct: 169 VLITNEGSIKLCDFG-VAAQLNQSTKRRQTMA--------GTPYWMAPEVI--MEGVYYD 217

Query: 225 EKSDIWALGILLYKLCYYTTPF-EEHGSRAI----------MEGKFTYPAYPQYTDSLKN 273
            K DIW+LGI  Y++     P+ E    RA+          +EG+        Y+  LK 
Sbjct: 218 TKVDIWSLGITTYEIATGNPPYCEIEALRAMQLITKSKPPRLEGR-------NYSPLLKE 270

Query: 274 IIRVLLSTNPIQRPNICQLLEELFRIQHKSSPL 306
            + + L  +P +R +   LL+  F   HK +P+
Sbjct: 271 FVALCLDEDPKERMSAEDLLKTKFIKAHKLTPV 303

>Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)
           [2274 nt, 758 aa]
          Length = 757

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 117/263 (44%), Gaps = 29/263 (11%)

Query: 28  LTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSLNILRAEVDAMKILKNNKYIV 86
           L  G F QVY  R   + K +Y      K+VIV  N+ +  I   ++      K+  +IV
Sbjct: 354 LGKGTFGQVYQVR-KKDTKRIYAMKVLSKKVIVKKNEIAHTIGERDILVRTASKSCPFIV 412

Query: 87  SYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVY 146
               S     Q   D Y+V    ++ SG  L  F +               + ++   + 
Sbjct: 413 GLKFS----FQTPADLYLV---TDFMSGGEL--FWHLQKEGRFTEDRAKFYIAELVLALE 463

Query: 147 HMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT 206
           ++H     +++RD+K EN+LL  +GN  LCDFG     L+  T++  F           T
Sbjct: 464 YLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLKDRTNT--FC---------GT 510

Query: 207 AQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTP-FEEHGSRAIMEGKFTYPAYP 265
            +Y +PE++    G+   +  D W+LG+L++++C   +P F E   +   +  F    +P
Sbjct: 511 TEYLAPELLLDESGY--TKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFP 568

Query: 266 Q--YTDSLKNIIRVLLSTNPIQR 286
           +   +   ++ ++ LL+ NP  R
Sbjct: 569 RDILSPEGRSFVKGLLNRNPNHR 591

>KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.140
           YGL179C
          Length = 909

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 116/267 (43%), Gaps = 53/267 (19%)

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGL------LDFMN 122
           +R E++ +K    +  I+   +     + +   S  + L++EYC G  +      +  ++
Sbjct: 144 IRKEINILKKCNKHPNIIKLFE-----VLDDFKSRKIYLILEYCPGGEIRWCAENVHELS 198

Query: 123 XXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS-- 180
                          + DV  G+ ++H LQ  ++HRDIK  N+LLS +G  K+ DFG   
Sbjct: 199 AKGPPLISFQRSREMLRDVISGLEYLH-LQG-IIHRDIKPANLLLSQEGTVKISDFGVSF 256

Query: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEM------------------VNLALGFP 222
           ++    + T  E+F+ L   I    T  + +PE+                  +N    + 
Sbjct: 257 MNADKANNTKKEDFLAL---IKTEGTPAFFAPEICLGDEIWDKFHINKSIPGLNANDEYY 313

Query: 223 INEKSDIWALGI----LLYKLCYYTTPFEEHGSRAIMEGKFTYP-------------AYP 265
           I EK D+WALG+     L+ +  +++ FE      I+     +P               P
Sbjct: 314 ITEKIDVWALGVTAFCFLFGMLPFSSNFELKLFDKIVNRSLKFPNCAKLSRCPASKLTSP 373

Query: 266 QYTDSLKNIIRVLLSTNPIQRPNICQL 292
              +S KN I +LL+ NP++RP++ ++
Sbjct: 374 HELESAKNFIELLLTKNPMERPSVSEI 400

>Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (REAL)
          Length = 1360

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 74/150 (49%), Gaps = 19/150 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            V  G+ H+H     ++HRDIK ENV++   G  K+ DFGS + V   P   + FV     
Sbjct: 1218 VVAGIKHLHDQG--IVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPF--DVFV----- 1268

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEK-SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE++    G P   K  DIWA+GILLY + +   PF  +    I+EG  
Sbjct: 1269 ----GTIDYAAPEVLG---GNPYEGKPQDIWAIGILLYTVVFKENPF--YNIDEILEGDL 1319

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNI 289
             +    + ++    +I+ +L+    +RP I
Sbjct: 1320 KFNNAEEVSEDCIELIKSILNRCVPKRPTI 1349

>Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100W
           (REAL)
          Length = 1080

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 96/205 (46%), Gaps = 17/205 (8%)

Query: 100 EDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRD 159
           +D   +  L+EY      L  M                 + +   + H+H     ++HRD
Sbjct: 252 QDESSLYFLLEYAPNGDFLSLMKKYGSLDENCACYYG--SQIIDAIDHLHV--SGIIHRD 307

Query: 160 IKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKN--TTAQYRSPEMVNL 217
           IK EN+LL G+   KL DFG+   +  +  SS +  Y  +   K+   TA+Y SPE++N 
Sbjct: 308 IKPENILLDGEMRIKLTDFGTAKLLEPTNNSSSKSKYDLSTRSKSFVGTAEYVSPELLND 367

Query: 218 ALGFPINEKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKFTY-PAYPQYTDSLK 272
           +     + + DIWA G +L+++     PF+        + +M+ ++ + P +P     ++
Sbjct: 368 SF---TDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTPGFPLI---IR 421

Query: 273 NIIRVLLSTNPIQRPNICQLLEELF 297
           ++++ +L  N  QR  I Q+ E  F
Sbjct: 422 DLVKKILIKNLDQRLTINQIKEHPF 446

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 82/153 (53%), Gaps = 17/153 (11%)

Query: 155 LLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEF-----VYLQNDILKNTTAQY 209
           ++HRDIK EN+LL  D   KL DFG+   +   P+++ +      +Y ++      TA+Y
Sbjct: 245 IIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSKSFVG-TAEY 303

Query: 210 RSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKFTYPA-Y 264
            SPE++N +     + + DIWA G +LY++     PF+        + +M+ ++ + A +
Sbjct: 304 VSPELLNDSY---TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGF 360

Query: 265 PQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
           PQ    +K++++ LL  +P  R  I Q+   +F
Sbjct: 361 PQI---VKDLVKKLLVRDPNDRLAIEQIKAHVF 390

>ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON}
           similar to uniprot|P11792 Saccharomyces cerevisiae
           YHR205W SCH9 protein kinase involved in growth control
           may be redundant with cAMP pathway cAMP-dependent
           protein kinase homolog suppressor of cdc25ts
          Length = 788

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 63/283 (22%), Positives = 121/283 (42%), Gaps = 29/283 (10%)

Query: 8   KYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLN 67
           +Y    K Q    +  +   L  G F QVY  +   + + +Y      K+VI+   +   
Sbjct: 360 QYTSTKKRQYGPSDFEVLRLLGKGTFGQVYQVK-KKDSQRIYAMKVLSKKVIIKKNE--- 415

Query: 68  ILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXX 127
           I     +   +++    +  +I       Q   D Y+V    +Y SG  L  F +     
Sbjct: 416 IAHTIGERNILVRTASQLCPFIVGLKFSFQTPADLYLV---TDYMSGGEL--FWHLQKEG 470

Query: 128 XXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRS 187
                     + ++   + ++H     +++RD+K EN+LL  +GN  LCDFG     L+ 
Sbjct: 471 RFSEDRAKFYIAELVMALEYLHDND--IVYRDLKPENILLDANGNIALCDFGLSKAELKD 528

Query: 188 PTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFE 247
            T++  F           T +Y +PE++    G+   +  D W+LG+L++++C   +PF 
Sbjct: 529 RTNT--FC---------GTTEYLAPELLLDETGY--TKMVDFWSLGVLIFEMCCGWSPFF 575

Query: 248 EHGSRAIME----GKFTYPAYPQYTDSLKNIIRVLLSTNPIQR 286
              ++ + +    GK  +P     +   ++ ++ LL+ NP  R
Sbjct: 576 AEDNQKMYQKIAFGKVKFPR-DVLSPEGRSFVKGLLNRNPKHR 617

>NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON}
           Anc_4.384
          Length = 749

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 123/284 (43%), Gaps = 31/284 (10%)

Query: 8   KYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVP-NKQSL 66
           +Y    K     ++  +   L  G F QVY  +   + K +Y      K+VIV  N+ + 
Sbjct: 330 EYSSTKKRHYGPNDFEVLRLLGKGTFGQVYQVK-KKDTKRIYAMKVLSKKVIVKKNEVAH 388

Query: 67  NILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXX 126
            I    +      K + +IV    S     Q   D Y   L+ ++ SG  L  F +    
Sbjct: 389 TIGERNILVTTATKASPFIVGLKFS----FQTPTDLY---LVTDFMSGGEL--FWHLQKE 439

Query: 127 XXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLR 186
                      + ++   + ++H     +++RD+K EN+LL  +GN  LCDFG     L+
Sbjct: 440 GRFTEERAKFYIAELVLALEYLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLK 497

Query: 187 SPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPF 246
             T++  F           T +Y +PE++    G+   +  D W+LG+L++++C   +PF
Sbjct: 498 DRTNT--FC---------GTTEYLAPELLLDEAGY--TKMVDFWSLGVLIFEMCCGWSPF 544

Query: 247 EEHGSRAIME----GKFTYPAYPQYTDSLKNIIRVLLSTNPIQR 286
               ++ + +    GK  +P     +   ++ ++ LL+ NP  R
Sbjct: 545 FAEDNQKMYQKIAFGKVKFPR-DVLSPEGRSFVKGLLNRNPKHR 587

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 109/241 (45%), Gaps = 35/241 (14%)

Query: 75  AMKILKNNKYI-----VSYIDSHANRLQNSEDSYVVL-------------LLMEYCSGAG 116
           A+K+L N +Y+     V Y++   N LQ   D   ++              L+EY     
Sbjct: 190 AVKVL-NKEYLIRQKKVKYVNIEKNTLQRLNDGRGIIKLYFTFQDEASLYFLLEYAPNGD 248

Query: 117 LLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLC 176
            L  +                   +   + ++HQ    ++HRDIK EN+LL  D   KL 
Sbjct: 249 FLSVIKKYGSLNQDCSVYYS--AQILDAIDYLHQKG--VIHRDIKPENILLDKDMKVKLT 304

Query: 177 DFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILL 236
           DFG+   V +  T ++ +  L+       TA+Y SPE++N      ++ K DIWA G +L
Sbjct: 305 DFGTAKLVEKDET-TQTYNLLERSKSFVGTAEYVSPELLNDNY---VDYKCDIWAFGCIL 360

Query: 237 YKLCYYTTPFEEHGS----RAIMEGKFTYPA-YPQYTDSLKNIIRVLLSTNPIQRPNICQ 291
           +++     PF+        + +M+ ++ + A +P     ++++I+ +L  NP QR +  Q
Sbjct: 361 FQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLI---IRDLIKQILVKNPEQRLDTLQ 417

Query: 292 L 292
           +
Sbjct: 418 V 418

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 76/143 (53%), Gaps = 11/143 (7%)

Query: 155 LLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEM 214
           ++HRDIK EN+LL  D   KL DFG+   +   P +++ +  L        TA+Y SPE+
Sbjct: 287 IVHRDIKPENILLDKDFKVKLTDFGTAKILEPKPNTTDSYDLLSRSKSFVGTAEYVSPEL 346

Query: 215 VNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKFTYPA-YPQYTD 269
           +N      ++ + DIWA G +L+++     PF+        + +M+ ++ + A +P    
Sbjct: 347 LNDNY---VDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV-- 401

Query: 270 SLKNIIRVLLSTNPIQRPNICQL 292
            ++++++ +L   P QR  I Q+
Sbjct: 402 -VRDLVKGILIKQPAQRLTIPQI 423

>Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 78/157 (49%), Gaps = 21/157 (13%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            V   + H+H     ++HRDIK ENV++   G  KL DFGS + V   P   + FV     
Sbjct: 959  VVASIKHLHN--QGIVHRDIKDENVIVDSHGFVKLIDFGSAAYVKSGPF--DVFV----- 1009

Query: 201  ILKNTTAQYRSPEMVNLA--LGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGK 258
                 T  Y +PE++  +   G P     DIWALG+LLY + Y   P+  +    I+EG+
Sbjct: 1010 ----GTMDYAAPEVLGGSSYKGKP----QDIWALGVLLYTIIYKENPY--YNIDEILEGE 1059

Query: 259  FTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEE 295
              +    + ++    +I+ +L+    +RP I ++ E+
Sbjct: 1060 LRFDKAEKVSEGCIGLIKRILTREVDKRPTIDEIYED 1096

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 107/256 (41%), Gaps = 53/256 (20%)

Query: 75  AMKILKNNKYI-----VSYIDSHANRLQNSEDSYV---------------VLLLMEYCSG 114
           A KIL N +Y+     V Y++   N LQ    S V               +  L+EY   
Sbjct: 227 AAKIL-NKEYLIKQKKVKYVNIEKNTLQRLNSSRVPGVIKLYFTFQDEANLYFLLEYAPN 285

Query: 115 AGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFK 174
              L  M                   +   ++H+H+    ++HRD+K EN+LL      K
Sbjct: 286 GDFLSVMKRFGTLSEECTKYYG--AQILDAIHHLHKQG--IIHRDVKPENILLDKTMKIK 341

Query: 175 LCDFGSVSGVLRSP--------TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEK 226
           L DFG+   + R          T S+ FV          TA+Y SPE++N      ++ +
Sbjct: 342 LTDFGTAKLIGREDENKPYDLNTRSKSFV---------GTAEYVSPELLNDNY---VDSR 389

Query: 227 SDIWALGILLYKLCYYTTPFEEHGS----RAIMEGKFTYPA-YPQYTDSLKNIIRVLLST 281
            DIWA G +L+++     PF+        + +M  ++ + A +P     L+++I+ LL  
Sbjct: 390 CDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMI---LRDLIKQLLVK 446

Query: 282 NPIQRPNICQLLEELF 297
            P QR  I Q+ +  F
Sbjct: 447 KPEQRLTILQIEKHHF 462

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 80/159 (50%), Gaps = 26/159 (16%)

Query: 144 GVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILK 203
           G+ + H L   ++HRD+K EN+LL    N K+ DFG  +            +  ++ +L+
Sbjct: 155 GMSYCHAL--GIVHRDLKPENILLDHKSNIKIADFGMAA------------LETEDKLLE 200

Query: 204 NT--TAQYRSPEMVNLALGFPINE-KSDIWALGILLYKLCYYTTPFEEHGSR------AI 254
            +  +  Y +PE+V+   G P N  ++DIW+ G++L+ L     PF+E           +
Sbjct: 201 TSCGSPHYAAPEIVS---GLPYNGLETDIWSCGVILFALLTGRLPFDEEDGNIRNLLLKV 257

Query: 255 MEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLL 293
            +G+F  P   + +   +++I  +L+ NP QR    ++L
Sbjct: 258 QKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREIL 296

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 121/284 (42%), Gaps = 45/284 (15%)

Query: 31   GGFAQVYTA-RITSEHKNLYPELTCLKRVIVPNKQS--------LNILRAEVDAMKILKN 81
            G F  VY    +T+       E+  +K+V VP   S        +  LR+EV  +K L +
Sbjct: 1223 GSFGAVYLCLNVTTG------EMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDL-D 1275

Query: 82   NKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDV 141
            +  IV Y+       +N ++ Y   L +EY +G  +   +                 T V
Sbjct: 1276 HLNIVQYLG-----FENKDNIYS--LFLEYVAGGSVGSLIRMYGRFDEPLIRHLN--TQV 1326

Query: 142  SQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDI 201
             +G+ ++H     +LHRD+K +N+LL  DG  K+ DFG         +   + +Y  +D+
Sbjct: 1327 LRGLAYLHSRG--ILHRDMKADNLLLDQDGVCKISDFGI--------SRKSKDIYSNSDM 1376

Query: 202  LKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIM----EG 257
                T  + +PEMV+   G+  + K DIW+LG ++ ++     P+  +   A M    + 
Sbjct: 1377 TMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKS 1434

Query: 258  KFTYP----AYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
            K   P      P  + + ++ +      +P  RP    LL   F
Sbjct: 1435 KSAPPIPPDTLPLISQNGRDFLDACFEIDPDNRPTADNLLSHPF 1478

>YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}
           TPK2cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk3p; localizes to P-bodies during stationary
           phase
          Length = 380

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 64/268 (23%), Positives = 113/268 (42%), Gaps = 37/268 (13%)

Query: 20  HEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKIL 79
           H+  I   L +G F +V+  R  S H   Y  +  LK+  V   + +     E   +K++
Sbjct: 68  HDFQIMRTLGTGSFGRVHLVR--SVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLV 125

Query: 80  KNNKYIVSYIDSHANRLQNS-EDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXM 138
           ++   I         R+  + +D+  + ++M+Y  G  L   +                 
Sbjct: 126 EHPFLI---------RMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAE 176

Query: 139 TDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQ 198
             ++    H H +    ++RD+K EN+LL  +G+ K+ DFG    V ++ T +       
Sbjct: 177 VILALEYLHAHNI----IYRDLKPENILLDRNGHIKITDFGFAKEV-QTVTWT------- 224

Query: 199 NDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE----HGSRAI 254
                  T  Y +PE++      P N+  D W+LG+L+Y++    TPF +         I
Sbjct: 225 ----LCGTPDYIAPEVITTK---PYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKI 277

Query: 255 MEGKFTYPAY--PQYTDSLKNIIRVLLS 280
           ++GK  YP Y  P   D L  +I   L+
Sbjct: 278 LQGKVVYPPYFHPDVVDLLSKLITADLT 305

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 130/293 (44%), Gaps = 42/293 (14%)

Query: 13  TKLQVASHEVI---IENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNIL 69
           T +Q AS + +   ++  +  G +  VY A   ++H +   ++  +K ++  N + LN +
Sbjct: 13  TPIQRASEKSVQYHLKQVIGRGSYGVVYKA--INKHTD---QVVAIKEIVYENDEELNDI 67

Query: 70  RAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXX 129
            AE+  +K L N+  IV Y   H         SY + +L+EYC+   L   ++       
Sbjct: 68  MAEISLLKNL-NHHNIVKY---HGFI----RKSYELYILLEYCANGSLRRLISRSSTGLS 119

Query: 130 XXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP- 188
                   +T    G+ ++H     ++HRDIK  N+LLS D   KL DFG VS ++ S  
Sbjct: 120 ENESKTY-VTQTLLGLKYLHG--EGVIHRDIKAANILLSADNTVKLADFG-VSTIVNSSA 175

Query: 189 -TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFE 247
            T +    ++  +IL N  A                +  SDIW+LG  + ++     P+ 
Sbjct: 176 LTLAGTLNWMAPEILGNRGA----------------STLSDIWSLGATVVEMLTKNPPYH 219

Query: 248 EHGSRAI---MEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297
                 I   +E    YP    +++SLK+ +      N  +RP   QLL+ ++
Sbjct: 220 NLTDANIYYAVENDTYYPP-SSFSESLKDFLSKCFVKNMYKRPTADQLLKHVW 271

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 77/153 (50%), Gaps = 19/153 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            V+ G+ H+H     ++HRDIK EN+++   G  KL DFGS + V   P   + FV     
Sbjct: 1132 VASGIKHLHD--NGIVHRDIKDENIIVDNKGFVKLIDFGSAAYVKSGPF--DVFV----- 1182

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEK-SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE++    G P   K  DIWA+G+LLY + +   PF  +    I++G  
Sbjct: 1183 ----GTIDYAAPEVLG---GDPYEGKPQDIWAIGVLLYTIIFKENPF--YNIDEILDGDL 1233

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQL 292
               +    ++    +IR +L+ +  +RP I ++
Sbjct: 1234 RISSSVTVSEECIALIRRILNRSVPKRPTIEEI 1266

>SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weakly
           similar to uniprot|P47116 Saccharomyces cerevisiae
           YJR059W PTK2 Putative serine/threonine protein kinase
           involved in regulation of ion transport across plasma
           membrane enhances spermine uptake
          Length = 818

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 65/146 (44%), Gaps = 10/146 (6%)

Query: 107 LLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVL 166
            +MEYC G  L   +                   V+QG+  MH     ++HRDIK ENVL
Sbjct: 371 FVMEYCPGGDLHSLITRTGWKRSPLKERFCLFKQVTQGLRFMHNQG--VVHRDIKPENVL 428

Query: 167 LSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNL--ALGFPIN 224
           +S DG  KL DFG        P      + + +  +   +  +  PE++ L  A G  + 
Sbjct: 429 ISKDGIAKLTDFGISDWAHEDPDDLNSPMRVFDCYVG--SPPFSPPEVMALKNAKGDAVK 486

Query: 225 E----KSDIWALGILLYKLCYYTTPF 246
                K D WALG++L+ L Y  TPF
Sbjct: 487 PYDPFKMDCWALGMILFALVYQATPF 512

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 121/284 (42%), Gaps = 45/284 (15%)

Query: 31   GGFAQVYTA-RITSEHKNLYPELTCLKRVIVPNKQS--------LNILRAEVDAMKILKN 81
            G F  VY A  +T+       E+  +K+V VP   S        +  L++EV  +K L N
Sbjct: 1047 GSFGAVYLALNVTTG------EMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-N 1099

Query: 82   NKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXMTDV 141
            +  IV Y       L   E + +  L +EY +G  +   +                   V
Sbjct: 1100 HVNIVQY-------LGFEEKNGIYSLFLEYVAGGSVGSLIRMYGRFDDQLIRHLTKQ--V 1150

Query: 142  SQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQNDI 201
             +G+ ++H     +LHRD+K +N+LL  DG  K+ DF    G+ R   +    +Y  +D+
Sbjct: 1151 LEGLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDF----GISRKSNN----IYSNSDM 1200

Query: 202  LKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIM--EGKF 259
                T  + +PEMV+ A G+  + K DIW+LG ++ ++     P+      A M   GK 
Sbjct: 1201 TMRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKS 1258

Query: 260  -TYPAYPQYTDSL-----KNIIRVLLSTNPIQRPNICQLLEELF 297
             T P  P  T  L     ++ +      +P  RP    L+   F
Sbjct: 1259 KTAPPIPDDTKDLVSPAGQSFLDQCFEIDPEMRPTADSLVGHPF 1302

>Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W
           (REAL)
          Length = 382

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/268 (23%), Positives = 113/268 (42%), Gaps = 37/268 (13%)

Query: 20  HEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKIL 79
           H+  I   L +G F +V+  R  S H   Y  +  LK+  V   + +     E   +K++
Sbjct: 70  HDFQIMRTLGTGSFGRVHLVR--SVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLV 127

Query: 80  KNNKYIVSYIDSHANRLQNS-EDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXM 138
           ++   I         R+  + +D+  + ++M+Y  G  L   +                 
Sbjct: 128 EHPFLI---------RMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAE 178

Query: 139 TDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQ 198
             ++    H H +    ++RD+K EN+LL  +G+ K+ DFG    V ++ T +       
Sbjct: 179 VILALEYLHAHNI----IYRDLKPENILLDRNGHIKITDFGFAKEV-QTVTWT------- 226

Query: 199 NDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE----HGSRAI 254
                  T  Y +PE++      P N+  D W+LG+L+Y++    TPF +         I
Sbjct: 227 ----LCGTPDYIAPEVITTK---PYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKI 279

Query: 255 MEGKFTYPAY--PQYTDSLKNIIRVLLS 280
           ++GK  YP Y  P   D L  +I   L+
Sbjct: 280 LQGKVIYPPYFHPDVVDLLSKLITADLT 307

>Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 80/162 (49%), Gaps = 22/162 (13%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            V   + H+H     ++HRDIK ENV++   G  KL DFGS + +   P   + FV     
Sbjct: 959  VVASIKHLHGQG--IVHRDIKDENVIVDSHGFVKLIDFGSAAYIKSGPF--DVFV----- 1009

Query: 201  ILKNTTAQYRSPEMVNLA--LGFPINEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGK 258
                 T  Y +PE++  +   G P     DIWALG+LLY + Y   P+  +    I+EG+
Sbjct: 1010 ----GTMDYAAPEVLGGSSYKGKP----QDIWALGVLLYTIIYKENPY--YNIDEILEGE 1059

Query: 259  FTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLE-ELFRI 299
              +    + ++    +I+ +L+    +RP I ++ E E  RI
Sbjct: 1060 LRFDKSEKVSEECIGLIKRILTREVDKRPTIDEIYEDEWLRI 1101

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 74/150 (49%), Gaps = 19/150 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            ++ GV H+H     ++HRDIK ENV++   G  KL DFGS + V R P   + FV     
Sbjct: 1183 ITSGVKHLHD--NGIVHRDIKDENVIVDNKGCVKLIDFGSAAYVKRGPF--DVFV----- 1233

Query: 201  ILKNTTAQYRSPEMVNLALGFPINEK-SDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE++    G P   K  DIWA+G+LLY + Y   PF  +    I++G  
Sbjct: 1234 ----GTIDYAAPEVLE---GDPYEGKPQDIWAIGVLLYTIIYKENPF--YNVDEILDGDL 1284

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNI 289
                    ++    +I ++L  +  +RP +
Sbjct: 1285 RINPSVIVSEECVALITMVLDRSLSKRPTV 1314

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 73/150 (48%), Gaps = 19/150 (12%)

Query: 141  VSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQND 200
            V  G+ H+H     ++HRDIK ENV++   G  K+ DFGS + V   P   + FV     
Sbjct: 1214 VVAGIKHLHDQG--IVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPF--DVFV----- 1264

Query: 201  ILKNTTAQYRSPEMVNLALGFPI-NEKSDIWALGILLYKLCYYTTPFEEHGSRAIMEGKF 259
                 T  Y +PE++    G P   +  DIWA+GILLY + +   PF  +    I+EG  
Sbjct: 1265 ----GTIDYAAPEVLG---GNPYEGQPQDIWAIGILLYTVVFKENPF--YNIDEILEGDL 1315

Query: 260  TYPAYPQYTDSLKNIIRVLLSTNPIQRPNI 289
             +    + ++    +I+ +L+     RP I
Sbjct: 1316 KFNNAEEVSEDCIELIKSILNRRVPNRPTI 1345

>Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON}
           YPL203W (REAL)
          Length = 381

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 64/268 (23%), Positives = 113/268 (42%), Gaps = 37/268 (13%)

Query: 20  HEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNILRAEVDAMKIL 79
           H+  I   L +G F +V+  R  S H   Y  +  LK+  V   + +     E   +K++
Sbjct: 69  HDFQIMRTLGTGSFGRVHLVR--SVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLV 126

Query: 80  KNNKYIVSYIDSHANRLQNS-EDSYVVLLLMEYCSGAGLLDFMNXXXXXXXXXXXXXXXM 138
           ++   I         R+  + +D+  + ++M+Y  G  L   +                 
Sbjct: 127 EHPFLI---------RMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAE 177

Query: 139 TDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSPTSSEEFVYLQ 198
             ++    H H +    ++RD+K EN+LL  +G+ K+ DFG    V ++ T +       
Sbjct: 178 VILALEYLHAHNI----IYRDLKPENILLDRNGHIKITDFGFAKEV-QTVTWT------- 225

Query: 199 NDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE----HGSRAI 254
                  T  Y +PE++      P N+  D W+LG+L+Y++    TPF +         I
Sbjct: 226 ----LCGTPDYIAPEVITTK---PYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKI 278

Query: 255 MEGKFTYPAY--PQYTDSLKNIIRVLLS 280
           ++GK  YP Y  P   D L  +I   L+
Sbjct: 279 LQGKVIYPPYFHPDVVDLLSKLITADLT 306

>Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}
           YGL179C (REAL)
          Length = 569

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 108/255 (42%), Gaps = 60/255 (23%)

Query: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCS--------------- 113
           +R E++ MK   +   +  Y       + N  +S  V L++EYCS               
Sbjct: 101 IREEIEIMKRCHHENVVKLY------DILNDPESTKVYLVLEYCSRGPVKWCPENQLEIK 154

Query: 114 --GAGLLDFMNXXXXXXXXXXXXXXXMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDG 171
             G  +L F                 ++DV  G+ ++H     + HRDIK  N+L+S +G
Sbjct: 155 AVGPSILTF-----------EQARKIVSDVVSGLEYLHSQG--ITHRDIKPSNLLISSNG 201

Query: 172 NFKLCDFGSVSGVLRSPTSSEEFVYLQNDILKNTT---AQYRSPEMVNLALGFPINEKSD 228
             K+ DFG VS  + + T S      Q  I K+ T     + +PE+      +  +   D
Sbjct: 202 AVKISDFG-VS--ILTTTGSTNIQSSQEQISKSKTLGTPAFFAPELCTADGDYRCSSAID 258

Query: 229 IWALGILLYKLCYYTTPFEEHGSRA----IMEGKFTYPAYPQ-------------YTDSL 271
           IW+LG+ LY + + T PF  + +      I+    ++P+Y Q             Y D+ 
Sbjct: 259 IWSLGVTLYCMLFGTLPFNANSALELFDNIISKPLSFPSYEQVSKRGHPNLAREEYNDA- 317

Query: 272 KNIIRVLLSTNPIQR 286
           K+I+  LL  NP +R
Sbjct: 318 KDILNRLLKKNPSER 332

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,407,647
Number of extensions: 2833549
Number of successful extensions: 13112
Number of sequences better than 10.0: 1786
Number of HSP's gapped: 12019
Number of HSP's successfully gapped: 1834
Length of query: 707
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 590
Effective length of database: 40,065,477
Effective search space: 23638631430
Effective search space used: 23638631430
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)