Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D015302.288ON96294448360.0
NDAI0G006702.288ON96890527750.0
Kpol_1039.452.288ON96890127560.0
NCAS0G037802.288ON95790127280.0
TDEL0G021902.288ON93690326610.0
KNAG0H019902.288ON97390726400.0
Suva_14.3242.288ON96890626280.0
KAFR0H033002.288ON96690426270.0
ZYRO0A01936g2.288ON95390025970.0
Skud_14.3062.288ON97090625830.0
Smik_14.3082.288ON96590625780.0
YNL023C (FAP1)2.288ON96590125560.0
TBLA0B059502.288ON99590625460.0
CAGL0M06919g2.288ON95690724730.0
KLTH0G10406g2.288ON96389824320.0
SAKL0E07634g2.288ON97489723560.0
Kwal_27.115182.288ON95390023180.0
KLLA0E08317g2.288ON92190522240.0
Ecym_33272.288ON92688721860.0
ADL213W2.288ON90890521640.0
YJL149W (DAS1)1.198ON663169860.17
NDAI0B045701.357ON46450830.36
Skud_10.661.198ON661169790.94
KLLA0C12925g3.49ON57075753.0
ZYRO0A07260g2.340ON59656743.8
NCAS0C049901.415ON50099719.1
Suva_6.2291.198ON665169719.2
KLLA0E04511g7.221ON302183709.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D01530
         (962 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...  1867   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1073   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...  1066   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...  1055   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...  1029   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...  1021   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1016   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...  1016   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...  1004   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...   999   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...   997   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...   989   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...   985   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...   957   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...   941   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...   912   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...   897   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   861   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   846   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   838   0.0  
YJL149W Chr10 (137379..139370) [1992 bp, 663 aa] {ON}  DAS1Putat...    38   0.17 
NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON} Anc_1...    37   0.36 
Skud_10.66 Chr10 (112547..114532) [1986 bp, 661 aa] {ON} YJL149W...    35   0.94 
KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weak...    33   3.0  
ZYRO0A07260g Chr1 (592998..594788) [1791 bp, 596 aa] {ON} simila...    33   3.8  
NCAS0C04990 Chr3 (1017294..1018796) [1503 bp, 500 aa] {ON} Anc_1...    32   9.1  
Suva_6.229 Chr6 complement(410663..412660) [1998 bp, 665 aa] {ON...    32   9.2  
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    32   9.6  

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score = 1867 bits (4836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 918/944 (97%), Positives = 918/944 (97%)

Query: 1   MSDREITSQIETAAGNTXXXXXXXXXXXXXXXXXXXXXXXXXXGLVYYEQTIRDISKGDR 60
           MSDREITSQIETAAGNT                          GLVYYEQTIRDISKGDR
Sbjct: 1   MSDREITSQIETAAGNTESSSDEESYSKGSNESNFDSSEDEDDGLVYYEQTIRDISKGDR 60

Query: 61  YTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTIDKVWKCPNCSHSSKQIP 120
           YTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTIDKVWKCPNCSHSSKQIP
Sbjct: 61  YTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTIDKVWKCPNCSHSSKQIP 120

Query: 121 LRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHLGPHGECSVITTLKCKC 180
           LRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHLGPHGECSVITTLKCKC
Sbjct: 121 LRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHLGPHGECSVITTLKCKC 180

Query: 181 GRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHSGLCGACPEILSSEQIQ 240
           GRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHSGLCGACPEILSSEQIQ
Sbjct: 181 GRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHSGLCGACPEILSSEQIQ 240

Query: 241 SVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWIGTFACKTRRIVFYACNE 300
           SVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWIGTFACKTRRIVFYACNE
Sbjct: 241 SVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWIGTFACKTRRIVFYACNE 300

Query: 301 HSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKRKKCTDPIPTCENRCGKA 360
           HSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKRKKCTDPIPTCENRCGKA
Sbjct: 301 HSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKRKKCTDPIPTCENRCGKA 360

Query: 361 LKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFEQTPKCTFKCESLMSCRR 420
           LKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFEQTPKCTFKCESLMSCRR
Sbjct: 361 LKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFEQTPKCTFKCESLMSCRR 420

Query: 421 HRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKECNLKLSCGIHDCTRKCHP 480
           HRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKECNLKLSCGIHDCTRKCHP
Sbjct: 421 HRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKECNLKLSCGIHDCTRKCHP 480

Query: 481 GRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKVIERSYPCGHKPPPHQCH 540
           GRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKVIERSYPCGHKPPPHQCH
Sbjct: 481 GRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKVIERSYPCGHKPPPHQCH 540

Query: 541 PSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNKELENCHHKCQYKCHEIGQ 600
           PSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNKELENCHHKCQYKCHEIGQ
Sbjct: 541 PSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNKELENCHHKCQYKCHEIGQ 600

Query: 601 CQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVSCKCGRKQEYRKCYATLDN 660
           CQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVSCKCGRKQEYRKCYATLDN
Sbjct: 601 CQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVSCKCGRKQEYRKCYATLDN 660

Query: 661 SSASIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQDIQSLMEKVSTYEELRLPY 720
           SSASIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQDIQSLMEKVSTYEELRLPY
Sbjct: 661 SSASIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQDIQSLMEKVSTYEELRLPY 720

Query: 721 PQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKPAQRHFVRELSTSFNLYSES 780
           PQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKPAQRHFVRELSTSFNLYSES
Sbjct: 721 PQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKPAQRHFVRELSTSFNLYSES 780

Query: 781 QDPEPKRSVFVKRKVDTRIPNISLEEVLPLWTGFKKLEKERKIQHFESTSQRKYINYEPK 840
           QDPEPKRSVFVKRKVDTRIPNISLEEVLPLWTGFKKLEKERKIQHFESTSQRKYINYEPK
Sbjct: 781 QDPEPKRSVFVKRKVDTRIPNISLEEVLPLWTGFKKLEKERKIQHFESTSQRKYINYEPK 840

Query: 841 EVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLIKNVCYKILPESSDAIIYPEQ 900
           EVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLIKNVCYKILPESSDAIIYPEQ
Sbjct: 841 EVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLIKNVCYKILPESSDAIIYPEQ 900

Query: 901 YNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEGYINQI 944
           YNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEGYINQI
Sbjct: 901 YNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEGYINQI 944

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1073 bits (2775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/905 (55%), Positives = 660/905 (72%), Gaps = 15/905 (1%)

Query: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104
           + YYE+TI++I+KGD Y CMICT+EMDYTC+MYAC+ CYRVFDY+CI+EWA KS  KT+D
Sbjct: 58  MKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKSTEKTVD 117

Query: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164
           ++WKCPNC H +K++P +NR TCWCGKV+NP+ N L+PNSCGQTCN K CVHGC N CHL
Sbjct: 118 RIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCTNICHL 177

Query: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224
           GPH EC+ + ++ C+CG++ KDIFC+Q K    N+ +QC + C LPL+CG+HKCKR CHS
Sbjct: 178 GPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCKRKCHS 237

Query: 225 GLCGACPEILSSEQIQSVESNENRKF--KCYCGENSKNEIMCKKLAI--TGTFSKNSEGD 280
           GLCG CPE L        E NE   +  KCYCG  ++  + CK + I  +  +S ++EG+
Sbjct: 238 GLCGVCPERL--------EVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGN 289

Query: 281 KWIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLA 340
           KWIG FACK  R V Y C++HSFIE C A  ++S +K CPY+PKLL +CPCGKT L++LA
Sbjct: 290 KWIGVFACKEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLA 349

Query: 341 QKRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPC 400
           + R  CTDPIPTCE+ C K LKCGKH CP+ CH G+CMDPC+Q+E   CSC Q+ FLVPC
Sbjct: 350 KPRTLCTDPIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPC 409

Query: 401 NFEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICL 460
            F  +P C  KCESLMSCRRHRC ++CC+G+P A+KRKK L   ++L DE+LVEA HICL
Sbjct: 410 QFTGSPHCNIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICL 469

Query: 461 KECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFEC 520
           KECNL LSCGIH C RKCHPG+CP CL SDSNDLVCPCGKT++EAPVRCG+KLPPCPF+C
Sbjct: 470 KECNLLLSCGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQC 529

Query: 521 IKVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEIC 580
           IKV+   YPCGH P PH CHP  EPCPPCTA V +PCKCGK   V+ +CFQ   SCG+IC
Sbjct: 530 IKVVRNEYPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKIC 589

Query: 581 NKELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTK 640
              L++C HKC  +CH  G CQ  CKQ+C K R NC+H C   CHG++ CPDVPC    K
Sbjct: 590 GLPLKDCPHKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAK 649

Query: 641 VSCKCGRKQEYRKCYATLDNSSA-SIELLPCDEDCEAHARHLQLRDAFGYDSSLDTS-NK 698
           V+C+CGR++ Y  C A  + +SA +  +L CDE+CE   RH QL++AFG    + +S + 
Sbjct: 650 VTCECGRRETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDL 709

Query: 699 NIQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKP 758
             + ++ ++     +EEL+LP+ ++ +S +S+Q +WC QIE+I+ KF+ DK++ +LHFKP
Sbjct: 710 EFERLKDIVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKP 769

Query: 759 MKPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVDTRIPNISLEEVLPLWTGFKKLE 818
           M+P QRHF+ ELS ++NLY ESQDPEPKRSVF+K+   +  P+ SL +VLPL+  FK+LE
Sbjct: 770 MRPPQRHFIHELSKAYNLYCESQDPEPKRSVFIKKNTTSSKPSFSLSKVLPLYQTFKELE 829

Query: 819 KERKIQHFESTSQRKYINYE-PKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKS 877
           KERK+Q FE+ + ++ +N E P+        + NGF IK +SPG T EDL  +FG+ LKS
Sbjct: 830 KERKLQEFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKS 889

Query: 878 TLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNV 937
           TLIKN  Y +L +    +IYPE Y +IT +V +D + LVGHFD + K+  I + + LC +
Sbjct: 890 TLIKNPQYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKI 949

Query: 938 EGYIN 942
           +  ++
Sbjct: 950 DDVLS 954

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score = 1066 bits (2756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/901 (57%), Positives = 658/901 (73%), Gaps = 16/901 (1%)

Query: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104
           L++YE+ I+DI+KGD YTCMICTIE+D T KMYAC  CYRVFDY+CI+EWA KS+ K++D
Sbjct: 66  LMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKSLD 125

Query: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164
           KVWKCPNC+H+S +IPL+NRPTCWCGK +NPDPN   PNSCGQTCN K+C+H C +FCHL
Sbjct: 126 KVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFCHL 185

Query: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKS-NKNNVYQCNEVCQLPLACGVHKCKRVCH 223
           GPH +C   TT+ C+CG++ KD+FC+ L    N+N  + C E C + L+CG+HKC RVCH
Sbjct: 186 GPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRVCH 245

Query: 224 SGLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAI--TGTFSKNSEGDK 281
           SG CG CPE+++            +K  CYCG  + ++I C  + I  +G  SK+ EG+ 
Sbjct: 246 SGSCGPCPELIT------------KKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNT 293

Query: 282 WIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQ 341
           WIG F C   R V YAC  HSF E C +  +ISG KICPY+PKLL +CPCGKT+L     
Sbjct: 294 WIGVFKCNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFEN 353

Query: 342 KRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCN 401
           KR+KCTDPI TCENRC K LKCGKH CP+ CHNG CMDPC Q+E+  CSC  K F VPC 
Sbjct: 354 KRQKCTDPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQ 413

Query: 402 FEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLK 461
           F + P+C  KCESLMSCRRHRC ++CC+GKP ADKRKKML ++ +L DESLVEA HICLK
Sbjct: 414 FHEKPRCNMKCESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLK 473

Query: 462 ECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECI 521
           +CNLKLSCGIH+CTRKCH G+CP CL SDS+DLVCPCGKTV+EAPVRCG+KLP C F CI
Sbjct: 474 DCNLKLSCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCI 533

Query: 522 KVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICN 581
           K IE SYPCGHKP  H CHP+  PCPPCT VV +PCKCGK    KA+CFQE  SCG++C 
Sbjct: 534 KYIEGSYPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCE 593

Query: 582 KELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKV 641
           K+L+ CHH CQ KCH  G+CQK C Q+CNK R NC+H C  KCHG S CPD+PC    +V
Sbjct: 594 KKLDGCHHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEV 653

Query: 642 SCKCGRKQEYRKCYATLDNSSASI-ELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNI 700
            C CGR++E   C AT    S  + ++LPCD+ C  + R  +LR+AFG  SS +     +
Sbjct: 654 YCGCGRRKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESEL 713

Query: 701 QDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMK 760
           + ++ ++EKV++YEEL LP+ ++V+S YSKQ  WC+QIE+++ KFV DK K +LHFKPM 
Sbjct: 714 ERLKKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMP 773

Query: 761 PAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVDTRIPNISLEEVLPLWTGFKKLEKE 820
             QR+F+  L  ++ +YSESQD EPKRSV++K+   TRIPNISLEE LPL+  +KK+EKE
Sbjct: 774 APQRNFIHALVEAYEMYSESQDREPKRSVYLKKNKYTRIPNISLEEALPLYQSYKKIEKE 833

Query: 821 RKIQHFESTSQRKYINYEPKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLI 880
           RK+Q FES     Y+NY+P E  +      NGF IK I+ G T +DL+ +FG  LK TLI
Sbjct: 834 RKVQSFESKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLI 893

Query: 881 KNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEGY 940
           K+  Y ILP+   AI+YP+ Y +I+E+V +D+E L GHFD++ KEA++ +S+ +CN+   
Sbjct: 894 KDAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDI 953

Query: 941 I 941
           +
Sbjct: 954 L 954

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score = 1055 bits (2728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/901 (57%), Positives = 665/901 (73%), Gaps = 13/901 (1%)

Query: 44  GLVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTI 103
            + YYE+ I++I+KGD Y CMICT+EMDYTC+MYAC+ CYRVFDYECI+EWA KS  KT+
Sbjct: 49  AMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKTV 108

Query: 104 DKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCH 163
           D++WKCPNC H +K++P +NRPTCWCGKV+NP+PN L+PNSCGQTCN  TCVHGC   CH
Sbjct: 109 DRIWKCPNCYHVNKKVPPKNRPTCWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSKICH 168

Query: 164 LGPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCH 223
           LGPH EC+ I T+KC+CG++ KDI C+Q       + +QC+E C LPLACG+H+C++ CH
Sbjct: 169 LGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKCH 228

Query: 224 SGLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAI--TGTFSKNSEGDK 281
           SGLCG CPEIL++++            +CYCG   ++ I C+ + +  + + S+N +G+K
Sbjct: 229 SGLCGICPEILNTKEYLDAH------IRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEK 282

Query: 282 WIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQ 341
           W+G F C   R V Y C+EHSF+E C A  +I G K CP++PKLL +CPCGKT LK+L +
Sbjct: 283 WVGVFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVE 342

Query: 342 KRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCN 401
            RKKCTDPIPTC++RCGK LKCG+HTCP+ICH G CMDPC+Q++   CSC Q+ FLVPC 
Sbjct: 343 SRKKCTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQ 402

Query: 402 FEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLK 461
           F Q P+CT KCESLMSCRRHRC ++CC G+P A+ RKK L   ++L DESLVE  HICLK
Sbjct: 403 FHQDPQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLK 462

Query: 462 ECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECI 521
           ECNL LSCG H C RKCHPG+CP CL SDSNDLVCPCG+T+IEAPVRCG+KLPPCP+ CI
Sbjct: 463 ECNLMLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCI 522

Query: 522 KVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICN 581
           KV+   YPCGH P PH CHP  EPCPPCTA V +PCKCGK   V+ +CFQ   SCG+IC 
Sbjct: 523 KVVRGEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICG 582

Query: 582 KELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKV 641
             LENC+H CQ +CH +G+CQK+CKQ+C K R NC H C   CHG + CPD+PC+   K+
Sbjct: 583 LPLENCNHTCQKRCHLLGECQKTCKQICKKKRINCEHTCLKPCHGKTDCPDIPCSVSIKI 642

Query: 642 SCKCGRKQEYRKCYATLDNSSASIEL-LPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNI 700
           +C+CGRK+ Y  C AT    SA+ +  + CDE+CE   RH QL++AFG   S  +++  +
Sbjct: 643 TCECGRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEV 702

Query: 701 QDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMK 760
           + ++ L +  +T+EEL+LPY ++ +S Y+KQ KWC QIE+IL K + DKA+ +LHFKPM+
Sbjct: 703 EKLKDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMR 762

Query: 761 PAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNISLEEVLPLWTGFKKLE 818
           P QRHF++E + SFNLY+E+QD EPKRSVFVK++ D  +  P ISL + LPL+  FK+LE
Sbjct: 763 PPQRHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTFKELE 822

Query: 819 KERKIQHFESTSQRKYINYE-PKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKS 877
           KERK++ FE+ +  + IN E P+E  V  +   +GF IKKISPG T EDL  +FG+ L S
Sbjct: 823 KERKLKEFEARTTTRLINVEAPQEDNVYHAK-YSGFLIKKISPGTTVEDLQRIFGQFLTS 881

Query: 878 TLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNV 937
           TLI N  Y I+ +  DA+IYPE Y  ++  V +DLE LVGHFDFI KE  I D + LC+V
Sbjct: 882 TLIVNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDV 941

Query: 938 E 938
           E
Sbjct: 942 E 942

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score = 1029 bits (2661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/903 (53%), Positives = 638/903 (70%), Gaps = 11/903 (1%)

Query: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104
           + YYE+ +++I+ GDRY CMICT+EMDYTCKMYAC+ CYRVFDYECI+EWA KS  KT+D
Sbjct: 38  MAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLD 97

Query: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164
           +VWKCPNC   +K++P +NRPTCWCGK +NPDPN L PNSCGQTC+   C HGC   CHL
Sbjct: 98  RVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHL 157

Query: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224
           GPH +C    T KC+CG++ ++ FC+Q       + +QCNEVC LPLACG+HKC+R+CHS
Sbjct: 158 GPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHS 217

Query: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWIG 284
           G+CG CP +L+++       +   K +CYCG   ++   CK + +    SK+ +GD WIG
Sbjct: 218 GICGPCPAVLNAK-------SNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIG 270

Query: 285 TFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKRK 344
            F C   R + YAC EHSF+E CQ   SISGK  CP++PKLL +CPCG+TSLK LA+ RK
Sbjct: 271 AFGCSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRK 330

Query: 345 KCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFEQ 404
            CT PIP C++ CGK L CG+HTCP+ CH+G CMDPCIQ+E   CSC +  + VPC F++
Sbjct: 331 SCTSPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKE 390

Query: 405 TPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKECN 464
            P+C  KCESLMSCRRHRC ++CC G+P A++R+K  L+  EL DES VE+ HICLK+CN
Sbjct: 391 QPRCDTKCESLMSCRRHRCTERCCCGRPFAERRRKTPLSSRELMDESSVESEHICLKDCN 450

Query: 465 LKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKVI 524
           L LSCG H C RKCHPG+CP CL SDSNDLVCPCGKTV+EAPVRCG++LPPC + CI+VI
Sbjct: 451 LTLSCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVI 510

Query: 525 ERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNKEL 584
           + +Y CGHKP PH CHP  EPCP CTA V +PCKCGK   V+ +CFQ   SCG  C K L
Sbjct: 511 QNAYKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPL 570

Query: 585 ENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVSCK 644
           +NC H CQ  CH  G+CQK CKQ+CN+ R  C+H+C+  CHG+  CPD+PC    K+ C+
Sbjct: 571 DNCPHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCE 630

Query: 645 CGRKQEYRKCYATLDN-SSASIELLPCDEDCEAHARHLQLRDAFGYDSSLDT-SNKNIQD 702
           C  K+ +  C A  +  S A+  +LPCDE+CE H RHLQLR+AFG  +  D  S      
Sbjct: 631 CEVKESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTAS 690

Query: 703 IQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKPA 762
           +++L    +++EEL LP+ +  + T++KQ  WC+QIE++L  F+ ++ K +LHFKPM+PA
Sbjct: 691 LENLAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPA 750

Query: 763 QRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVDTRI--PNISLEEVLPLWTGFKKLEKE 820
           QRHF+ EL+ S+NLY ESQD EPKRSVFVK++ +     P I L++ LP++  FK+ EKE
Sbjct: 751 QRHFIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKE 810

Query: 821 RKIQHFESTSQRKYINYEPKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLI 880
           +K Q FE+ +  +++N+ PKE         N F +K +S G T+EDL  +F   LK TL+
Sbjct: 811 KKAQRFEAQTTTEFVNFIPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLV 870

Query: 881 KNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEGY 940
           KN  +KI   + + +IYPE Y  I+ +V +DLE LVGHFD++ KE+ I D I LC+++  
Sbjct: 871 KNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHIDLK 930

Query: 941 INQ 943
           + Q
Sbjct: 931 VLQ 933

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 1021 bits (2640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/907 (53%), Positives = 639/907 (70%), Gaps = 16/907 (1%)

Query: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104
           L YYE+ +R+I+KGD YTCMICT+EMDYTCKM+AC+ CYRVFDY+C++EWA KS  KT+D
Sbjct: 51  LPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTDKTVD 110

Query: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164
           ++WKCPNC   +K++P +NRPTCWCGKV+NP+PN L PNSCGQTC+ K C+HGC   CHL
Sbjct: 111 RIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSKICHL 170

Query: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224
           GPH EC   T++KC+CG+  K+I C + K     N++QCNE C   L CG+H+C+++CHS
Sbjct: 171 GPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQKICHS 230

Query: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWIG 284
           GLCG+CPE L+      V+  ++    CYCG++++N I CK + +TG  SKN+ GD+WIG
Sbjct: 231 GLCGSCPENLT------VKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIG 284

Query: 285 TFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKRK 344
            +ACK  R V Y+C +HSF E C A  +++G K CP++PK L +C CGKT L+ L + R+
Sbjct: 285 VYACKDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARR 344

Query: 345 KCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFEQ 404
           +C DPIP CE+RC K LKCGKHTCP+ CH+G CMDPCIQ++   C+C +  FLVPC F+ 
Sbjct: 345 RCIDPIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQG 404

Query: 405 TPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKECN 464
            P C  KCESL+SCRRH+C ++CC+G+P A++R+K     +++NDE+L+EA H+CLK CN
Sbjct: 405 APHCQLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACN 464

Query: 465 LKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKVI 524
           L LSCG H C RKCHPG+CP CL SDSNDLVCPCGKT++ APVRCG+KLP C   CIKV+
Sbjct: 465 LTLSCGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVV 524

Query: 525 ERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNKEL 584
           E    CGHKP PH CHP  +PCPPCTA V +PCKCGK+  V+ +CFQ+  SCG+ C K L
Sbjct: 525 EGISECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPL 584

Query: 585 ENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVSCK 644
            NCHH CQ  CH  GQCQ +CKQVCNK   NC H+C+  CHG   CPD+ C  + K+ C 
Sbjct: 585 PNCHHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCP 644

Query: 645 CGRKQEYRKCYATLD-NSSASIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSN----KN 699
           CGRK+    C AT   +SS   E L CDE+CEA+ RH QL++AFG    +   +    K 
Sbjct: 645 CGRKEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKE 704

Query: 700 IQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPM 759
              ++ L  K +T+EEL+ P+ +S ISTY +Q KWC +IE+ L  F+ ++ K++LHFKPM
Sbjct: 705 GTRLEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPM 764

Query: 760 KPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNISLEEVLPLWTGFKKL 817
           KP QR F+REL+ ++NLYSE+QDPEPKRSVFVK+  D  +  P  SL E+ PL+  FK L
Sbjct: 765 KPPQRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLL 824

Query: 818 EKERKIQHFESTSQRKYINYEPKEVI---VKSSNDTNGFFIKKISPGITEEDLSEVFGKA 874
           EKERK+Q F + +    IN +  + +    + S   N F IK IS G T +DL  +FGK 
Sbjct: 825 EKERKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKY 884

Query: 875 LKSTLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIML 934
           ++ TLI+N  Y+ LPE + AI+YPE Y +I+ +   D+E LVGH +FI  +A + DS  L
Sbjct: 885 MEKTLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAEL 944

Query: 935 CNVEGYI 941
           C+    +
Sbjct: 945 CDASSKL 951

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1016 bits (2628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/906 (53%), Positives = 639/906 (70%), Gaps = 15/906 (1%)

Query: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104
           + YYE+ I++I+KGD Y CMICT+EMDYTC+M+AC+ CYRVFDY CI+EWA KS  KT+D
Sbjct: 54  MQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 113

Query: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164
           K+WKCPNC H  K++P RNRPTCWCGKV+NPD N L PNSCGQTCN  TCVHGC   CHL
Sbjct: 114 KIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKICHL 173

Query: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224
           GPH EC+    +KC+CG++ K IFC+Q K   K+  + C E C LPL+CG+HKCK+ CHS
Sbjct: 174 GPHPECTRTVEIKCRCGKHSKSIFCYQSKAMKKH--FDCQEECGLPLSCGIHKCKKKCHS 231

Query: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAI--TGTFSKNSEGDKW 282
           GLCG CPE++ SE             KCYCG +SK+ I C ++    +G  SK+  G++W
Sbjct: 232 GLCGPCPELIMSE------DKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEW 285

Query: 283 IGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQK 342
           IG FACK  R V YAC++HSFIEPC +  +++GKK CP+ P LL +CPCG+T+L++L + 
Sbjct: 286 IGVFACKDIRTVDYACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKP 345

Query: 343 RKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNF 402
           RK CTDPIPTC +RC K LKCGKH+CP+ICH+G+CMDPC+Q +   C+C Q  FLVPC F
Sbjct: 346 RKHCTDPIPTCSSRCSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGF 405

Query: 403 EQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKE 462
           ++ P C  KCESLMSCRRHRC  +CC+G+P A +RKK +   ++L DESLVEA HICLK 
Sbjct: 406 QEKPHCNIKCESLMSCRRHRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKP 465

Query: 463 CNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIK 522
           CNL LSCGIH C RKCHPG+CP CL SDSNDLVCPCGKTVI APVRCG+KLP C + CIK
Sbjct: 466 CNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIK 525

Query: 523 VIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNK 582
           V+     CGHKP PH CHP    CPPCT  V +PCKCGK   V+ VCFQ   SCG  C K
Sbjct: 526 VVRGESECGHKPMPHTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGK 585

Query: 583 ELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVS 642
            L  CHH CQ  CH    CQK CKQ+C + R NC+H C   CHG S CPD+PC  + K++
Sbjct: 586 PLSGCHHTCQKTCHLPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKIT 645

Query: 643 CKCGRKQEYRKCYATLDNSSAS-IELLPCDEDCEAHARHLQLRDAFGY-DSSLDTSNKNI 700
           CKCGR ++   C A  +  S +    L C+E+CEA  R  +LR+AFG  + S +++N  +
Sbjct: 646 CKCGRIEKKVACGAKSNVVSVTEAPQLDCNEECEALKRLKELREAFGISEESNESTNNEL 705

Query: 701 QDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMK 760
             ++ L+   +T+EEL+LP+ ++V+S Y+KQ  WC QIE+I+ K + DK +++LHFKPM+
Sbjct: 706 DTLKKLVSVATTFEELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMR 765

Query: 761 PAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVDTRI--PNISLEEVLPLWTGFKKLE 818
           P QRHF+REL+ ++NLYSESQD EP RSVF+K++ +++   P +SL E  PL+  FK+L+
Sbjct: 766 PPQRHFIRELAKAYNLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQ 825

Query: 819 KERKIQHFESTSQRKYINYEPKEVIVKSS-NDTNGFFIKKISPGITEEDLSEVFGKALKS 877
           KERKIQ F++ +  K IN+E ++   K      NGF ++K+  G   +DL   F   LK 
Sbjct: 826 KERKIQEFQARTTAKLINFEVRDAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKH 885

Query: 878 TLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNV 937
           TL+    Y I+ +   A++YPE Y  ++ +  +D+++LVGHFDF+ KEA + DSI LC++
Sbjct: 886 TLVVKPQYLIIDDGKTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSI 945

Query: 938 EGYINQ 943
           +  + +
Sbjct: 946 DEELGR 951

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/904 (54%), Positives = 633/904 (70%), Gaps = 17/904 (1%)

Query: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104
           ++YYE+ I++I+ GD Y CMICT+EMDYTCKMYAC+ C R+FDY+CI+EWA KS  KT +
Sbjct: 53  MMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKSTEKTKE 112

Query: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164
           ++WKCPNC H +K++P +NR TCWCGKV+NP+ N L+PNSCGQTCN   C+HGC   CHL
Sbjct: 113 RIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCSKICHL 172

Query: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLK-KSNKNNVYQCNEVCQLPLACGVHKCKRVCH 223
           GPH EC    T+KC CG++E+ I C Q K +S + N + C E C LPL+CG+H CK+ CH
Sbjct: 173 GPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTCKKKCH 232

Query: 224 SGLCGACPEILSSEQIQSVESNENR--KFKCYCGENSKNEIMCKKLAITGTFSKNSEGDK 281
           SGLCG+CPE+L        E NE +    KCYCG  +K    CK +    T S+++EG+K
Sbjct: 233 SGLCGSCPELL--------EVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNK 284

Query: 282 WIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQ 341
           W+G F+C   R V Y+C +HSF+E C A  ++SG K CP++P LL +CPCG+T L  L++
Sbjct: 285 WVGVFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSK 344

Query: 342 KRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCN 401
            R KCTDP+PTCE  C K LKCGKH CP+ CHNG CMDPCIQ++   CSC Q  FL PC 
Sbjct: 345 PRLKCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQ 404

Query: 402 FEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLK 461
           FE  P C  KCESLMSCRRHRC ++CC+G+P A+KRKK L    ++NDE+LVEA H+CLK
Sbjct: 405 FEGEPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLK 464

Query: 462 ECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECI 521
           ECNL LSCG H C RKCHPG+CP CL SDSNDLVCPCGKTV+EAPVRCG+KL PC F CI
Sbjct: 465 ECNLMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCI 524

Query: 522 KVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICN 581
           KVI     CGH P PH CHP  +PCPPCTA V +PCKCGK   V+ VCFQ+  SCG+IC 
Sbjct: 525 KVIRNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICG 584

Query: 582 KELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKV 641
             L  CHHKCQ  CH  G+CQ  CKQVC K R NC H+C   CHGS+ C D PC   TK+
Sbjct: 585 LPLLTCHHKCQKVCHPNGECQVKCKQVCRKKRVNCVHECLKSCHGSTECSDSPCPVSTKI 644

Query: 642 SCKCGRKQEYRKCYATLD-NSSASIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNI 700
           SC CGR++ Y  C AT   +S+A I  L C+E+CE   RH +LR+AFG     +  N   
Sbjct: 645 SCPCGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGT 704

Query: 701 QDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMK 760
           + +QS  +  + Y++L+LPY +  +  Y+KQ  WC QIE++L KF+ D ++ +LHFKPM+
Sbjct: 705 ERLQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMR 764

Query: 761 PAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNISLEEVLPLWTGFKKLE 818
           P QR+F+ E++ +FNLY+ESQD EPKRSVF+K+  D  +  P + L +VLP++  FKKLE
Sbjct: 765 PPQRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLE 824

Query: 819 KERKIQHFESTSQRKYINYEPKEVIVKSSN-DTNGFFIKKISPGITEEDLSEVFGKALKS 877
           KERK + FE+ +  + +N    + + +    + NG  IK +S GIT E LSE F K  KS
Sbjct: 825 KERKAKQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKFFKS 884

Query: 878 TLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNV 937
           TLIKN  Y I+   ++ +IYPE +N IT+ V+ DL++LVGHF+ I KE LI DS+ +CN+
Sbjct: 885 TLIKNPQYLII--ENNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEMCNI 942

Query: 938 EGYI 941
           E  +
Sbjct: 943 ENEL 946

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/900 (53%), Positives = 621/900 (69%), Gaps = 14/900 (1%)

Query: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104
           ++YYE+ +++I++GD Y CMICT+EMDYTCKM+AC  CYRVFDY+CI+EWA KS  +T+D
Sbjct: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115

Query: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164
           K WKCPNC   S ++P ++RPTCWCGKV+NPDPN L PNSCGQTC+   C HGC   CHL
Sbjct: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHL 175

Query: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224
           GPH EC+ I ++KCKCGR+ +D+ C ++  S +N  + C E C L L CGVHKC + CHS
Sbjct: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVG-SGRNQQFTCEESCGLLLPCGVHKCSKKCHS 234

Query: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWIG 284
           GLCG C E L S+       ++    KCYCG +    I C  + +    S + +G+ WIG
Sbjct: 235 GLCGGCNETLHSK------PDKGAVIKCYCGLHESPSIRCGDVRVADRDSVDDQGNGWIG 288

Query: 285 TFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKRK 344
            F CK  R+V YAC +HSF+E C+   S+  +  CP++P +L SCPCG+T L +L Q R 
Sbjct: 289 VFRCKDVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARV 348

Query: 345 KCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFEQ 404
           KCTD IPTCE++CGK L CGKHTCPY CH G CMDPC+Q E TNC C  + FLVPC F +
Sbjct: 349 KCTDHIPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFRE 408

Query: 405 TPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKECN 464
            P+C  KCESLMSCRRHRC +KCC+GKP A++RKK   T  EL DESLVEA H+CLK CN
Sbjct: 409 DPRCNTKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCN 468

Query: 465 LKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKVI 524
           L L+CG H C RKCHPGRCP CL SD NDLVCPCGKTV+EAPVRCG+KLPPCP+ CI V+
Sbjct: 469 LTLTCGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVV 528

Query: 525 ERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNKEL 584
              YPCGH P PH CHP  E CPPCTA V++PCKCGK   V+ +CFQ+  SCG+ICNK L
Sbjct: 529 RDGYPCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPL 588

Query: 585 ENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVSCK 644
            +C H CQ KCH+ G CQ  C+Q+C K R NC+H+C   CHG  PCPD PC     + C 
Sbjct: 589 GSCRHTCQKKCHD-GGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCA 647

Query: 645 CGRKQEYRKCYATLDNSSASIEL-LPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQDI 703
           CGRK+    C       SAS+   L CDE+CE   R  QL+DA G   + D+S   +++ 
Sbjct: 648 CGRKESTEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSS---VENT 704

Query: 704 QSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKPAQ 763
            S     S +EEL LP+ ++V++ YS+Q ++C  IE +L  F+ D+ K++LHFKPMKPAQ
Sbjct: 705 VSNALVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQ 764

Query: 764 RHFVRELSTSFNLYSESQDPEPKRSVFVKRKV--DTRIPNISLEEVLPLWTGFKKLEKER 821
           RHFV EL+ ++ LYSESQDPEPKRSV+VK+++  ++  P+I+L+E LP++  FK+ EKE 
Sbjct: 765 RHFVHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKET 824

Query: 822 KIQHFESTSQRKYINYEPKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLIK 881
           KI+ +E  +    +N+ PK          NGF I+ ++ G   EDL  ++G+ LK TL++
Sbjct: 825 KIRRYEMQNVTNLVNFVPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVR 884

Query: 882 NVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEGYI 941
           N  YK LP+ + A+I+PE Y+ +T +   D+E LVGHFDFI KE  I D + LC V  Y+
Sbjct: 885 NPVYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYL 944

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score =  999 bits (2583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/906 (52%), Positives = 630/906 (69%), Gaps = 15/906 (1%)

Query: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104
           L YYE+ I++I+KGD Y CMICT+EMDYTC+M+AC+ CYRVFDY CI+EWA KS  KT+D
Sbjct: 55  LQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKTVD 114

Query: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164
           K+WKCPNC H  K++P RNRPTCWCG V+NPDPN+L PNSCGQTCN  TCVHGC   CHL
Sbjct: 115 KIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKICHL 174

Query: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224
           GPH EC+ +  +KC CGR+ K IFC+Q K   +   + C E C L L+CGVHKCK+ CHS
Sbjct: 175 GPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRR--FNCQEECGLSLSCGVHKCKKKCHS 232

Query: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCK--KLAITGTFSKNSEGDKW 282
           GLCG+CPE + ++       +  ++ KCYCG + +N I C   +   +G  SK+  G++W
Sbjct: 233 GLCGSCPEFIINDD------SSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEW 286

Query: 283 IGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQK 342
            G FAC   R V YAC++HSFIEPC +  +ISG+K CP+ P LL +CPCG+T+L++L + 
Sbjct: 287 AGVFACADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKP 346

Query: 343 RKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNF 402
           RK C DPIPTC +RC K LKCGKH CP+ CH+G+CMDPC+Q++  NCSC Q  F +PC F
Sbjct: 347 RKHCHDPIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGF 406

Query: 403 EQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKE 462
           +++P+C  KCESLMSCRRHRC  +CC+G+P A +RKK     ++L DESLVEA HICLK 
Sbjct: 407 QESPRCNIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKP 466

Query: 463 CNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIK 522
           CNL LSCG+H C RKCHPG+CP CL SDSNDL+C CGKTV+ APVRCG+KLP C   CIK
Sbjct: 467 CNLTLSCGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIK 526

Query: 523 VIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNK 582
           V+     CGHKP PH CHPS   CPPCT  V +PC+CGK   V+ VCFQ   SCG  C  
Sbjct: 527 VVRGESWCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGI 586

Query: 583 ELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVS 642
            L  C+H CQ  CH +G+CQK CKQ+C + R +C H C   CHG + CPD+PC  + K++
Sbjct: 587 PLSGCYHTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKIT 646

Query: 643 CKCGRKQEYRKCYATLDNSSA-SIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQ 701
           C+CGR ++   C A  D  S  +  +L C+E+CE   R  +LR+AFG     +   +N  
Sbjct: 647 CECGRIKKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNEL 706

Query: 702 D-IQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMK 760
           D +  L+    T+EEL+LP+ ++ +S YSKQ +WC QIE IL K +  + +++LHFKPM+
Sbjct: 707 DALSELVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMR 766

Query: 761 PAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNISLEEVLPLWTGFKKLE 818
           P QRHF+ E++ ++NLY+ESQD EP RSVF+K++ +  ++ P +SL E  PL+  FK+ +
Sbjct: 767 PPQRHFIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQ 826

Query: 819 KERKIQHFESTSQRKYINYEPKEVIVK-SSNDTNGFFIKKISPGITEEDLSEVFGKALKS 877
           KERK+Q F++ +  K IN+E ++   K  +   NGF ++ +  G T EDL   F   LK 
Sbjct: 827 KERKLQEFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKH 886

Query: 878 TLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNV 937
           TL+ N  Y IL +S  A+IYPE Y + + +  +D+E+LVGHFDF+ KEA + DSI LC+V
Sbjct: 887 TLVANPQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSV 946

Query: 938 EGYINQ 943
           +  I +
Sbjct: 947 DEEIGK 952

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/906 (52%), Positives = 630/906 (69%), Gaps = 15/906 (1%)

Query: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104
           + YYE++I++ISKGD Y CMICT+EMDYTC+M+AC+ CYRVFDY CI+EWA KS  KT+D
Sbjct: 50  MQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKTVD 109

Query: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164
           ++WKCPNC H  K++P  NRPTCWCGKV+NPDPN L PNSCGQTC+   C+HGC   CHL
Sbjct: 110 RIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPICIHGCSKTCHL 169

Query: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224
           GPH EC+ +  + C CG++ + IFC+Q K   KN  ++C E C LPL+C VH CKR CH+
Sbjct: 170 GPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKN--FKCQEECGLPLSCSVHNCKRKCHT 227

Query: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCK--KLAITGTFSKNSEGDKW 282
           GLCG CPE+++S+       +   + KCYCG +S+  I C   +   +G  SK+  G++W
Sbjct: 228 GLCGPCPELITSKD------STEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEW 281

Query: 283 IGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQK 342
           IG FAC   R V ++C +HSFIEPC +  S++G+K+CP+ P LL +CPCG+T+L +L + 
Sbjct: 282 IGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKP 341

Query: 343 RKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNF 402
           RK C DPIPTC +RC K LKCGKH+CP+ICH+ +CMDPC+Q++   C+C Q  F VPC F
Sbjct: 342 RKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGF 401

Query: 403 EQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKE 462
           +  P+C  KCESLMSCRRHRC  +CC+G+P A KR+K     ++L DESLVEA HICLK 
Sbjct: 402 QGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKP 461

Query: 463 CNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIK 522
           CNL LSCGIH C RKCHPG+CP CL SDSNDL+CPCGKTV+ APVRCG++LP C   CIK
Sbjct: 462 CNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIK 521

Query: 523 VIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNK 582
           V+     CGHKP PH CHP   PCPPCT  V +PCKCGK   V+ VCFQ+  SCG  C  
Sbjct: 522 VVRGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGL 581

Query: 583 ELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVS 642
            L  C H CQ  CH  G CQK CKQ+C  +R +C H C   CHG + CPD+PC  + K++
Sbjct: 582 LLHFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKIT 641

Query: 643 CKCGRKQEYRKCYATLDNSSAS-IELLPCDEDCEAHARHLQLRDAFGY-DSSLDTSNKNI 700
           CKCGR ++   C A      A+   +L CDE+CEA  R  +LR+AFG  + S + ++  +
Sbjct: 642 CKCGRNEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNEL 701

Query: 701 QDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMK 760
             ++ L+   +T+EEL LP+ ++ +S YSKQ +WCSQIE IL K + DK +++LHFKPM+
Sbjct: 702 DALKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMR 761

Query: 761 PAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNISLEEVLPLWTGFKKLE 818
           P QRHF+REL+ ++ LYSESQD EP RSVF+K++ +  +  P +SL E LPL+  FK+L+
Sbjct: 762 PPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQ 821

Query: 819 KERKIQHFESTSQRKYINYEPKEVIVK-SSNDTNGFFIKKISPGITEEDLSEVFGKALKS 877
           KERK+Q F+S +  K IN+E ++   K      NGF ++ +  G T EDL   F   LK 
Sbjct: 822 KERKVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKH 881

Query: 878 TLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNV 937
           TL+ N  Y IL +   A++YPE Y + + +  +D+E+LVGHFDF+ KEA + DSI+LC+ 
Sbjct: 882 TLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCST 941

Query: 938 EGYINQ 943
           +  + +
Sbjct: 942 DEEVGK 947

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/901 (52%), Positives = 623/901 (69%), Gaps = 15/901 (1%)

Query: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104
           + YYE+ I++IS GD Y CMICT+EMDYTC+M+AC+ CYRVFDY CI+EWA KS  KT+D
Sbjct: 50  MQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKTVD 109

Query: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164
           ++WKCPNC + SK++P++NRPTCWCGKV+NPDPN L PNSCGQTCN  TC+HGC   CHL
Sbjct: 110 RIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKICHL 169

Query: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224
           GPH EC+ +  + C CG++ K IFC+Q K   KN  + C EVC LPL+C +H CK+ CH 
Sbjct: 170 GPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKN--FNCQEVCGLPLSCSIHTCKKKCHP 227

Query: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCK--KLAITGTFSKNSEGDKW 282
           GLCG CPE++ S+       +  ++ KCYCG +++  I C   K   +G  SK+  G++W
Sbjct: 228 GLCGPCPEMIISKD------SPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRW 281

Query: 283 IGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQK 342
           IG FAC   R+V Y+C +HSFIE C +  +I+G+K CP+ P  L +CPCG+T+L++L + 
Sbjct: 282 IGVFACADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKP 341

Query: 343 RKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNF 402
           RK C DPIPTC++RCGK LKCGKH+CP+ CH+ +CM+PC+Q++   C+C Q  F VPC F
Sbjct: 342 RKHCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGF 401

Query: 403 EQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKE 462
           +  P+C  KCESLMSCRRHRC  +CC+G+P A +RKK L   ++L DESLVEA HICLK 
Sbjct: 402 QGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKP 461

Query: 463 CNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIK 522
           CNL LSCGIH C RKCHPG+CP CL SDSNDLVCPCG TV+ APVRCG+KLP C   CIK
Sbjct: 462 CNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIK 521

Query: 523 VIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNK 582
           V+     CGHKP PH CH     CPPCT  V +PCKCGK   V+ VCFQ   SCG  C  
Sbjct: 522 VVRGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGI 581

Query: 583 ELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVS 642
            L  C+H CQ  CH  G CQK CKQ C + R NCNH+C   CHG + CPD+PC  + K+ 
Sbjct: 582 PLSYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIY 641

Query: 643 CKCGRKQEYRKCYATLDNSSAS-IELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQ 701
           CKCGR ++   C A  D  S +   +L C+E+CEA  R  +L++AFG     +    N  
Sbjct: 642 CKCGRIKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNEL 701

Query: 702 D-IQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMK 760
           D ++ L+   +T+EEL+LP+ ++ +S YSKQ +WCSQIE IL K + DK +++LHFKPM+
Sbjct: 702 DALKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMR 761

Query: 761 PAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNISLEEVLPLWTGFKKLE 818
           P QRHF+REL+ ++ LYSESQD EP RSVF+K++ +  +  P +SL E  PL+  FK+L+
Sbjct: 762 PPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQ 821

Query: 819 KERKIQHFESTSQRKYINYEPKEVIVK-SSNDTNGFFIKKISPGITEEDLSEVFGKALKS 877
           KERK Q F++ +  K IN+E ++   K      NGF ++ +  G T EDL   F   LK 
Sbjct: 822 KERKAQEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKH 881

Query: 878 TLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNV 937
           TL+ N  Y IL +   A++YPE Y + + +  +D+E+LVGHFDF+ KEA + DSI LC+ 
Sbjct: 882 TLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCST 941

Query: 938 E 938
           E
Sbjct: 942 E 942

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/906 (52%), Positives = 636/906 (70%), Gaps = 16/906 (1%)

Query: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104
           L+YYE+ +R+I+KGD Y CMICT+EMD+TCKMYAC+ CYRVFDY+CI+EWA KS  KT+D
Sbjct: 69  LMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKTVD 128

Query: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164
           K WKCPNC HSSK++PL++RPTCWCGKV+NPDPN L PNSCGQTCN   C H C   CHL
Sbjct: 129 KTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANICPHKCLKQCHL 188

Query: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224
           G H EC+ +  + C+CGR  KDI+CH+ ++  + +++ C++ C L L CG+HKC+R CHS
Sbjct: 189 GSHPECTQLLKITCRCGRETKDIYCHESRR--QKSIFHCDQECGLTLPCGIHKCRRKCHS 246

Query: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAI--TGTFSKNSEGDKW 282
           GLCG+CPE+L       ++ N + K KCYCG +S  E+ CK +A   +G  S+N E  +W
Sbjct: 247 GLCGSCPELL-------IDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEW 299

Query: 283 IGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQK 342
           +G F CK  R V Y CNEH F+E C A  ++    +CP++P LL +CPCGKT+L+ +  +
Sbjct: 300 VGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCE 359

Query: 343 RKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNF 402
           R KCTDPIPTC+N C K LKCGKH CP+ CH G CMDPCIQ++  +C+C ++ FLVPC F
Sbjct: 360 RTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQF 419

Query: 403 EQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKE 462
           +  P C FKCESLMSCRRHRC + CC+G+P A++RKK +L   + NDE+LVEA H+CLK+
Sbjct: 420 KGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKD 479

Query: 463 CNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIK 522
           CNLKLSCGIH C RKCHPG CP CL SDSNDLVCPCGKTVI APVRCG+ LPPC + CIK
Sbjct: 480 CNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIK 539

Query: 523 VIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNK 582
           VI     CGHKP PH CH   +PCP CTA V +PCKCGK   V+ +CFQE  SCG  C  
Sbjct: 540 VIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGL 599

Query: 583 ELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVS 642
            L++C+HKCQ +CH  G+CQ +C Q+CN  R+NC+H C  +CH ++PCPD+PC     V 
Sbjct: 600 PLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTVPVTVV 659

Query: 643 CKCGRKQEYRKCYATLDNSSASI-ELLPCDEDCEAHARHLQLRDAFGYDSSL--DTSNKN 699
           C CGR++  + C +T    S +I   L CDE+C    R ++L+ AFG  + L  D ++  
Sbjct: 660 CDCGRRKLVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGLGDDKTSVA 719

Query: 700 IQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPM 759
           I+ IQ+ +     YEEL LP+ ++V++ Y+KQ KWCSQIE IL KF+ +K K++LHFK M
Sbjct: 720 IERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHM 779

Query: 760 KPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNISLEEVLPLWTGFKKL 817
           K  QR FV  L+ ++ +YSESQDPEP RSVFVK+  +  +  P ++LEE LPL+  FK++
Sbjct: 780 KAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYESFKEV 839

Query: 818 EKERKIQHFESTSQRKYINYEPKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKS 877
           +KE+K Q +E+ + +  IN E +    +S+   NGF IK +  G TEEDL  +FG++LK 
Sbjct: 840 QKEKKKQEYEARTHKTLINVEAETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKP 899

Query: 878 TLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNV 937
           TL+K+  Y ++ ES    I P  Y  I+ +V +D+E L+G FD + KE  I D + LCN+
Sbjct: 900 TLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNI 959

Query: 938 EGYINQ 943
           +  + Q
Sbjct: 960 DEALLQ 965

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/907 (50%), Positives = 616/907 (67%), Gaps = 17/907 (1%)

Query: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104
           + YYE+ +++I KGD Y+C+ICT+E+DYTCK+YAC+ CYRV+DYECI+EWAEKS SK  D
Sbjct: 59  MAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTD 118

Query: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164
           K+W CPNC ++ K IP +NRPTCWCG+ +NP+PN L+PNSCGQTCN K C HGC   CHL
Sbjct: 119 KLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHL 178

Query: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224
           GPH EC+ + ++KC CG+  KDI C Q +  +K   + C  VC   L CG+HKC R CH+
Sbjct: 179 GPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKG--FNCETVCDKLLPCGIHKCNRKCHT 236

Query: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCK--KLAITGTFSKNSEGDKW 282
           GLCG+CPE +       +  N N K +CYCG+ SK++I CK  +      +SK+ +G +W
Sbjct: 237 GLCGSCPETI-------ISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRW 289

Query: 283 IGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQK 342
           IG F C   R V Y C EHSF E C+A  SISG+ IC ++PK L +CPCGK  L  L++ 
Sbjct: 290 IGVFMCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKP 349

Query: 343 RKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNF 402
           R KCTD IPTC   CGK LKCGKH CP+ CH G CMDPC Q+E   C+C QK F +PC F
Sbjct: 350 RSKCTDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGF 409

Query: 403 EQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKK-MLLTREELNDESLVEAVHICLK 461
               +C  KCESLMSCRRHRC ++CC G+P A++R+K M +   +L DES +E +HICLK
Sbjct: 410 NDHARCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLK 469

Query: 462 ECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECI 521
           +CNL LSCGIH C RKCH G+CP CL SDSNDLVCPCGKT++EAPVRCG+KLP CP+ CI
Sbjct: 470 DCNLTLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCI 529

Query: 522 KVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICN 581
           +V+     CGH P PH+CHP   PCP CTA V +PCKCGK   V+ VCF +  SCG++C 
Sbjct: 530 RVVRGETDCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCG 589

Query: 582 KELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKV 641
           + L+ C+HKCQ KCHE G CQ  CKQ CN  R  CNH+C   CH    CPD+PC  + K+
Sbjct: 590 ERLQTCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKI 649

Query: 642 SCKCGRKQEYRKCYATLDNSSASIEL-LPCDEDCEAHARHLQLRDAFG-YDSSLDTSNKN 699
           +C CGR ++   C     N  A     + CDE+C    RH+QL++AFG  D   +T N+ 
Sbjct: 650 TCPCGRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEE 709

Query: 700 IQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPM 759
           +  ++ ++   ST+ +L LP+ + VI+TY +   WC+ IE+ L K + D  + +LHFKPM
Sbjct: 710 MARLEQVISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPM 769

Query: 760 KPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNISLEEVLPLWTGFKKL 817
           +P QR+F+REL+ ++NLYSESQDPEP RSVFVK+ +D  +  P +S+ E  PL+  +KKL
Sbjct: 770 RPPQRYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKL 829

Query: 818 EKERKIQHFESTSQRKYINYEPK-EVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALK 876
           EKE+K  +FES +  + IN+ P+    ++S+   NGF +  +    + +DL  +F   LK
Sbjct: 830 EKEKKQANFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLK 889

Query: 877 STLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCN 936
           STL+    ++ILPE   A+IYP +Y  I+ +V +D+E LV HFDF+ KE+L+   + LCN
Sbjct: 890 STLVVEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCN 949

Query: 937 VEGYINQ 943
           +E  + +
Sbjct: 950 IENVLAE 956

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score =  941 bits (2432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/898 (50%), Positives = 597/898 (66%), Gaps = 18/898 (2%)

Query: 47  YYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTIDKV 106
           YYE+TI++I+KGDRY CMICT+EMD+TC MYAC  CYRVFDYECI+EWA KS  K++ K 
Sbjct: 63  YYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQKSVTKT 122

Query: 107 WKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHLGP 166
           WKCPNC    K +PL+NRPTCWCGK I+P+PN L+PNSCGQTC+   CVHGC + CHLGP
Sbjct: 123 WKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSSTCHLGP 182

Query: 167 HGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHSGL 226
           H  C  +   KC+CG+  KD+FC + +K  +  +++C   C L L CGVHKC+R CH+G+
Sbjct: 183 HPTCMRMVQTKCRCGKKSKDVFCSEARKHQE--LFRCGNPCGLTLPCGVHKCQRECHNGV 240

Query: 227 CGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWIGTF 286
           CG CPE ++ E              CYCG  S   I C+ + I    S++  G KWIG F
Sbjct: 241 CGECPETIAKE------------INCYCGLESLPSIKCQDVKIQSK-SQDGSGKKWIGAF 287

Query: 287 ACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKRKKC 346
           AC   R V Y+C EHSF EPC+A  SI+G+  CPY+PK L +CPCG+T L+ +   R KC
Sbjct: 288 ACSRIRTVEYSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKC 347

Query: 347 TDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFEQTP 406
           TDPIPTC+  CGK L CG+H CP+ CH G+CM+ C   +   CSC  + F+VPC F+  P
Sbjct: 348 TDPIPTCDATCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPP 407

Query: 407 KCTFKCESLMSCRRHRCPKKCCTGKPEADKR-KKMLLTREELNDESLVEAVHICLKECNL 465
           +C  KCESLMSCRRHRC ++CC G+  A  R KK+ LTR++L DESLVEA HICLK+CNL
Sbjct: 408 RCNTKCESLMSCRRHRCAERCCDGRSLAQVREKKVFLTRDKL-DESLVEAQHICLKKCNL 466

Query: 466 KLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKVIE 525
           KLSCG H C RKCHPG CP CL SDSNDLVCPCGKTV  APVRCG+ LPPC   CIK ++
Sbjct: 467 KLSCGRHFCQRKCHPGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQ 526

Query: 526 RSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNKELE 585
               CGH P PH CH   EPCP CTA V + CKCGK+  V+ +CFQ   SCG +C K+L 
Sbjct: 527 GPLDCGHPPMPHACHSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLV 586

Query: 586 NCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVSCKC 645
           +CHH C   CH  G+CQ  CKQVC   R+NC+H C+ KCH  SPCPDVPCN   +V C C
Sbjct: 587 SCHHSCTKTCHREGECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGC 646

Query: 646 GRKQEYRKCYATLDNSSASIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQDIQS 705
           G +  +  C A      A    L C EDC A  R L+L +AFG ++      + I D+ +
Sbjct: 647 GHRSSFATCAAHEGQDPADQRPLECTEDCAAARRRLELMEAFGMNTETVQPTEGIVDLAA 706

Query: 706 LMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKPAQRH 765
           L EKV+T++EL LP+ ++ +S ++KQ  WCSQIE+ L + + D +K +LHFKPMKP QRH
Sbjct: 707 LAEKVTTFQELMLPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRH 766

Query: 766 FVRELSTSFNLYSESQDPEPKRSVFVKRKVDTRIPNISLEEVLPLWTGFKKLEKERKIQH 825
           F+ EL+ ++ LY ESQD EPKRSV+VK+ VD+R P++SL+E LPL+  FK  +KERK++ 
Sbjct: 767 FIHELAQAYKLYCESQDKEPKRSVYVKKTVDSRKPSLSLKEALPLYQSFKNAQKERKLKE 826

Query: 826 FESTSQRKYINYEPKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLIKNVCY 885
            E ++  + +NY             NG  I+K+  G  E+ +   F   LK TLIK+  Y
Sbjct: 827 LERSTTTRILNYTSTGESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPNY 886

Query: 886 KILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEGYINQ 943
             L +S D +++ E Y + + +V +D+  +VGH D I K++ + + + +C VE  + +
Sbjct: 887 LKL-DSGDVMVFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVMAE 943

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/897 (50%), Positives = 596/897 (66%), Gaps = 22/897 (2%)

Query: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104
           L YYE+TI +I KGD Y CMICT+EMDYTC MYAC  CYRV+D+ECI+EWA KS+ K++D
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164
           K WKCPNC + + +IP++NR TCWCGKV++P+ N + PNSCGQTCN   C HGC   CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224
           GPH EC   T +KC CG++ KD+FC+Q ++   +  YQC E C L L CGVHKC+R CHS
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKAS--YQCGEPCNLLLPCGVHKCQRKCHS 225

Query: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWIG 284
           G CG C E +S             K  CYCG  ++ +I+CK +      SKN  G+ WIG
Sbjct: 226 GPCGNCEETISG------------KIMCYCGMETREQIICKDVKSVAK-SKNKSGEIWIG 272

Query: 285 TFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKRK 344
            F+C   R V Y+C  HSF E C A  + SG+  CP++P+LL +CPCG T LK L   RK
Sbjct: 273 VFSCAHLRSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRK 332

Query: 345 KCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFEQ 404
           KCTDPIPTCENRC K LKCGKH+CP++CH+G CMDPC+ ++  +CSC  K FLVPC F  
Sbjct: 333 KCTDPIPTCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHD 392

Query: 405 TPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKECN 464
              C  KCESLMSCRRHRC ++CC+G+  A KR+K +    +  DESLVEA HICLK CN
Sbjct: 393 EAHCNTKCESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCN 452

Query: 465 LKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKVI 524
           LKLSCGIH C RKCHPG+C  CL SDSNDL CPCGKTV+ APVRCG+KLPPC   CIK +
Sbjct: 453 LKLSCGIHYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTL 512

Query: 525 ERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNKEL 584
           +    CGH P PH+CH   +PCP CTA + + CKC K   V+ +CFQ   SCG+IC   L
Sbjct: 513 QADTVCGHPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPL 572

Query: 585 ENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVSCK 644
           +NC H C+  CHE GQCQ  CKQ+C   R  C H+C ++CH    CPD  C    KV+C 
Sbjct: 573 KNCSHTCKRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCS 632

Query: 645 CGRKQEYRKCYATLDNSSASIEL-LPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQDI 703
           CGRK+    C A  D  S+ + + LPCD+ CE   RH  L +AFG    L      ++++
Sbjct: 633 CGRKESILPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAP---VEEL 689

Query: 704 QSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKPAQ 763
           + L+E   +++EL LP+ +S +S YSKQ  WC+QIE  L K + D  + +LHFKPMK  Q
Sbjct: 690 RDLVESAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQ 749

Query: 764 RHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD-TRIPNISLEEVLPLWTGFKKLEKERK 822
           R F+ EL+ ++ LYSESQD EPKRSVFVK+  + + IP + L E LPL+  FK+L+KERK
Sbjct: 750 RRFIHELANAYALYSESQDREPKRSVFVKKVENKSHIPLLCLGEALPLYHSFKQLQKERK 809

Query: 823 IQHFESTSQRKYINYEPKEV-IVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLIK 881
           ++  E ++ R+  NY   +   V  + + N F +K ++PG+T+++LS+   + L+ TLI+
Sbjct: 810 VKELEKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQ 869

Query: 882 NVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVE 938
           N  Y+ L E+ D +IYPE + SI+E+V  D++ L  +   I KE  I + + L  ++
Sbjct: 870 NPSYQTL-ENGDFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKID 925

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/900 (48%), Positives = 605/900 (67%), Gaps = 19/900 (2%)

Query: 47  YYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTIDKV 106
           YYE+T+++I KGDRY CMICT+EMD+TC MYAC  CYRVFD+ECI+EWA KS  K++ K 
Sbjct: 45  YYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSKT 104

Query: 107 WKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHLGP 166
           WKCPNC    K++P++NRPTCWCGK + P+PN L+PNSCGQTC+ + C HGC + CHLGP
Sbjct: 105 WKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLGP 164

Query: 167 HGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHSGL 226
           H  C  +  +KC CG+  K +FCH+  K    + + C+  C L L CG+HKC+R CHSG+
Sbjct: 165 HPTCMRMVQVKCNCGKKNKSVFCHEAGKFV--DSFICDSPCGLTLPCGIHKCQRKCHSGI 222

Query: 227 CGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWIGTF 286
           CG CPE +                 CYC   SK  + C ++ I G  S++S G+KW+G F
Sbjct: 223 CGECPESIYG------------TINCYCKLESKPSLKCTEVRIEGR-SRDSSGNKWVGAF 269

Query: 287 ACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKRKKC 346
           +C+  R V ++C +HSF EPC+A  SISG+  CP++P+ L +CPCG++ L+++   R +C
Sbjct: 270 SCENIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQC 329

Query: 347 TDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFEQTP 406
           TDPIPTC++ CGK L+CGKH CP+ CH GSCM+ C+  +   CSC  + F+VPC F++  
Sbjct: 330 TDPIPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKA 389

Query: 407 KCTFKCESLMSCRRHRCPKKCCTGKPEADKR-KKMLLTREELNDESLVEAVHICLKECNL 465
           +C  KCE+LMSCRRHRC ++CC G+  A  R KK+ LTR++L DESLVEA HICLK+CNL
Sbjct: 390 RCNTKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKL-DESLVEAQHICLKQCNL 448

Query: 466 KLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKVIE 525
           KLSCG H C RKCHPG C  CL SDSNDLVCPCGKTV+ APVRCG+ LP C   CIK ++
Sbjct: 449 KLSCGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQ 508

Query: 526 RSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNKELE 585
              PCGH P PH CHP  EPCP CTA V + CKC K+  V+ +CFQ   SCG +C K+L 
Sbjct: 509 GPAPCGHPPMPHPCHPLEEPCPSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLA 568

Query: 586 NCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVSCKC 645
            C H CQ  CH+ G+CQ SCKQ C K R NC H+C++ CH  +PCPD PC  +  + C C
Sbjct: 569 GCQHICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNC 628

Query: 646 GRKQEYRKCYATLDNSSASIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQDIQS 705
           G +     C A  + + A    L C+ DC+   RH +L +AFG  +  +  +K+++D+++
Sbjct: 629 GHRSTTVTCGANENRAPAEETALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEA 688

Query: 706 LMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKPAQRH 765
           L EKVST++EL LP+ ++ +S +SKQ  WC+QIE+ L + + DK K +LHFKPM+P QRH
Sbjct: 689 LAEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRH 748

Query: 766 FVRELSTSFNLYSESQDPEPKRSVFVKRKVDTRIPNISLEEVLPLWTGFKKLEKERKIQH 825
           F+ EL  +++LY ESQD EPKRSVFVK+  D++ P+ISL+  LPL+  FK  ++E+K++ 
Sbjct: 749 FIHELGQAYHLYCESQDQEPKRSVFVKKTADSQRPSISLKVALPLYYSFKSAQREKKLKE 808

Query: 826 FESTSQRKYINYE-PKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLIKNVC 884
            E  +  + INY    +     +   NG  ++ +  GI E+ + E F + LK TL+K+  
Sbjct: 809 TERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPH 868

Query: 885 YKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEGYINQI 944
           Y +L  S D ++Y + Y++ + +V  D+E +VGH D I KE L+ + +    V+ +++ +
Sbjct: 869 YLLL-ASGDVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFLDDL 927

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/905 (46%), Positives = 583/905 (64%), Gaps = 23/905 (2%)

Query: 45  LVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTID 104
           + YYEQT+++I  GD+Y CMICT+E+D TC+MYAC SCYRVFDYEC++EWA KS +KT+D
Sbjct: 32  IPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTLD 91

Query: 105 KVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCHL 164
           K WKCPNC   + +IP + R TCWCGKV+NPD NEL PNSCGQTCN  +CVHGC   CHL
Sbjct: 92  KSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCHL 151

Query: 165 GPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCHS 224
           GPH EC +   +KCKCG++ K I C + K     N Y C +VC L L CG H C++ CH+
Sbjct: 152 GPHPECLIPVQIKCKCGKHCKQIPCSRSKVLG--NSYNCGDVCGLLLPCGKHTCQKTCHT 209

Query: 225 GLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWIG 284
           G CG C  I+ +E              CYCG + K+ I C  L +   +SK+  G KWIG
Sbjct: 210 GFCGPCESIIKTE------------LPCYCGSDVKSGIQCSDLRVLD-YSKDVSGKKWIG 256

Query: 285 TFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKRK 344
            ++C   R + Y+C+ H+++E C A   I   + CP++PK L +CPCGKT LK+L + R+
Sbjct: 257 VYSCGEVRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRR 316

Query: 345 KCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFEQ 404
           KCTD IPTC N CGK L CGKHTCP+ CH G CMDPC+ +  T C+C  K FL PC    
Sbjct: 317 KCTDTIPTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHD 376

Query: 405 TPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKECN 464
           TP+C  KCES MSCRRH+C + CC+GKP A KR+K L  + +LN+E+LVE  H+CLK+CN
Sbjct: 377 TPRCNIKCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCN 436

Query: 465 LKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKVI 524
           LKLSCGIHDCT KCHPG+CP CL SD NDLVCPCGKTV+ APVRCG+KLPPCP  CIK+ 
Sbjct: 437 LKLSCGIHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKIS 496

Query: 525 ERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCF--QEFGSCGEICNK 582
           E   PCGH+  PH+CHP+   CPPCTA V + C+C K H ++ +C       +CG  C  
Sbjct: 497 EGPAPCGHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGL 556

Query: 583 ELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVS 642
            L  CHHKCQ KCH  G+C+  C + C   R+ C H CK KCHG+SPCP+  C+E   ++
Sbjct: 557 PLATCHHKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVIT 616

Query: 643 CKCGRKQEYRKCYATLDNSSAS-IELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQ 701
           C C R+ +  +C AT D  S S  E LPCDE+C    RH++L +AFG +     + + ++
Sbjct: 617 CDCNRRTKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQLE 676

Query: 702 DIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKP 761
            I  + +K   +++L +PY + V++ Y KQ+ WC QI  +  KF+ D  K +LH KPM+ 
Sbjct: 677 SIVLVAKK---FDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRV 733

Query: 762 AQRHFVRELSTSFNLYSESQDPEPKRSVFVKR-KVDTRIPNISLEEVLPLWTGFKKLEKE 820
            QR F++EL++++ LYSESQD EP RSV++K+ +  ++ P ++L++   L+  FK LEKE
Sbjct: 734 PQRQFIKELASAYALYSESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKE 793

Query: 821 RKIQHFESTSQRKYINYEPKEVIVKSSNDT-NGFFIKKISPGITEEDLSEVFGKALKSTL 879
           R  +H+ +   +  IN    E  + +  +  N   I  +      +++  +    LK TL
Sbjct: 794 RMQEHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTL 853

Query: 880 IKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEG 939
           +K   Y+ L + +  +I+PE Y+ IT++   D+E ++       ++ ++   + +C V+ 
Sbjct: 854 VKTPQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDE 913

Query: 940 YINQI 944
            ++ +
Sbjct: 914 NLSLV 918

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  846 bits (2186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/887 (48%), Positives = 558/887 (62%), Gaps = 33/887 (3%)

Query: 44  GLVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTI 103
           GL YYE+ I+DI  G  Y C+ICT+E+D TC+MYAC +CYRV+DYECI EWA+KS+ ++ 
Sbjct: 27  GLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKRSA 86

Query: 104 DKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCH 163
           D  WKCPNC HS  ++  + R TCWCGK INP+ N   PNSCGQTC    C HGC + CH
Sbjct: 87  DSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCASTCH 146

Query: 164 LGPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCH 223
           LGPH +C V   LKCKCG+  + I C+Q K         C   C LPL CGVH C+++CH
Sbjct: 147 LGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPK--LSCKLPCGLPLPCGVHTCQKICH 204

Query: 224 SGLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWI 283
           SG CG C  ++S             KFKCYCG N  + I+CK +A+T   S++ +  KWI
Sbjct: 205 SGPCGRCNTVMSG------------KFKCYCGSNHLDSIICKDVAVT-KMSRSGKHKKWI 251

Query: 284 GTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKR 343
           G F+CK  R V Y C EHSF E C+   S   +  CPY+P +  +C CG T+L  + QKR
Sbjct: 252 GVFSCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKR 311

Query: 344 KKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFE 403
           +KCTDPIPTC+ RCGK L CGKHTCP  CH G CMDPC+Q+E   CSC ++ FL PC F+
Sbjct: 312 EKCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFD 371

Query: 404 QTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKEC 463
             P C  KCE+LMSCRRHRC K+CC+GKP A  R   +    + NDESL+EA HIC K C
Sbjct: 372 GKPSCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNC 431

Query: 464 NLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKV 523
           N KLSCG+H CT KCHPG+CP CL SDSNDLVCPCGK+VI APVRCG+  P C + CI  
Sbjct: 432 NRKLSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINT 491

Query: 524 IERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNKE 583
           +  S PCGH+ P H+CHPSTE CPPCTA V +PCKCGK  A + +CFQ   SCG  C  +
Sbjct: 492 LRGSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAK 551

Query: 584 LENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVSC 643
           L NCHH CQ +CH  G+C  +C +VC   R+ C H C + CHG   CPDVPC E   VSC
Sbjct: 552 LTNCHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSC 611

Query: 644 KCGRKQEYRKCYATLDNSSA-SIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQD 702
            CGR+     C A  D  SA + + L CD+DC    +H  L        S +++NK    
Sbjct: 612 GCGRRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTL---RSSESTNKAEHG 668

Query: 703 IQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKPA 762
             S++ K ++YE+L LPY + ++  +SKQ  WC  I+D L + + DK++ +LHFKPMK  
Sbjct: 669 SSSVINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAP 728

Query: 763 QRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVDTRIPNISLEEVLPLWTGFKKLEKERK 822
           QR FV ELS +F LYSESQD EPKRSVFVK    ++IP I L E L L+   K  +KER+
Sbjct: 729 QRQFVHELSKAFGLYSESQDREPKRSVFVKILKTSKIPAIGLSEALLLYQRMKTFQKERR 788

Query: 823 IQHFESTSQRKYINYEPKEVIVKSSNDT-------NGFFIKKISPGITEEDLSEVFGKAL 875
               +  + +  I+     + +   +D+       N   I  +   +T E++   F + L
Sbjct: 789 DLELQHNTTKILIS-----IPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECL 843

Query: 876 KSTLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFI 922
           K TL+K+  ++++  +S+A IYP  +  I+ +V  D++ LV +F  +
Sbjct: 844 KQTLLKDPQFRLI--NSNAYIYPSNFLEISANVETDIQRLVPYFSHV 888

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/905 (45%), Positives = 571/905 (63%), Gaps = 28/905 (3%)

Query: 44  GLVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKTI 103
           G+ YYEQT+ ++  G+ Y C+ICT+EMD +C MYAC  CYRV+DYECI+ WA K+ S T+
Sbjct: 15  GIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTTV 74

Query: 104 DKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFCH 163
           D+ WKCPNC H ++++P +NR TCWCGK +N DPN ++PNSCGQTC    C HGC   CH
Sbjct: 75  DRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLCH 134

Query: 164 LGPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVCH 223
           LGPH EC V    KC+CG+  ++I C++ K + +N  + C++ C LP+ CG+HKC+RVCH
Sbjct: 135 LGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRN--FSCDQPCGLPMPCGIHKCERVCH 192

Query: 224 SGLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKWI 283
           +G CG C E ++ +             KCYCG  ++N+++C ++++    SK S+   WI
Sbjct: 193 NGPCGPCKEEIAGD------------IKCYCGLTTRNKMVCSEVSVVAR-SKVSKYKSWI 239

Query: 284 GTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQKR 343
           G FAC   R V Y+C +HSF E C A  S+  +  CPY+P+   +CPCGKT L +L   R
Sbjct: 240 GAFACDRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTR 299

Query: 344 KKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNFE 403
             CTD I +C   CGK L CG HTCP  CH+G+CMDPC+ +    C+C Q+ FLVPC F 
Sbjct: 300 TACTDHISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFP 359

Query: 404 QTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKEC 463
            +P CT KCESLMSCRRHRC ++CC+G+P + KR      RE  +DES VEA H+CLK+C
Sbjct: 360 HSPSCTAKCESLMSCRRHRCAERCCSGRPHSVKRNSR-RRRESPDDESEVEAQHVCLKDC 418

Query: 464 NLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIKV 523
           N  L CGIH C  KCH G+CP CL SDSNDL+CPCGKT++ APVRCG+KLP C   C   
Sbjct: 419 NRVLLCGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNS 478

Query: 524 IERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNKE 583
           +  ++PCGH PP H CHP  EPCPPCT  V++ C+CGK+  ++  C+ +  SC   C K 
Sbjct: 479 LLDTWPCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGKNE-IRTFCYNDDVSCSRPCKKP 537

Query: 584 LENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVSC 643
           L  C+H CQ  CH  GQCQ++CKQ C   R  C H CK+KCHG + CP+ PC E   ++C
Sbjct: 538 LSYCNHFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITC 597

Query: 644 KCGRKQEYRKC--YATLDNSSASIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNIQ 701
            CG K   + C  YA  D+   + + L CDEDC    RH QL  AFG    ++ +     
Sbjct: 598 SCGHKSSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGV---VEKATSEED 654

Query: 702 DIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMKP 761
           +   L ++  ++++L LP+ + V+S ++KQ +WC+QIE  L K + D +   LHFKPM+ 
Sbjct: 655 EALLLAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRA 714

Query: 762 AQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVDTRIPNISLEEVLPLWTGFKKLEKER 821
           AQR FV ELS+SF LYSESQDPEPKRSV+VK+   +R+P I L +  PL+T FKKLE+E 
Sbjct: 715 AQRRFVHELSSSFGLYSESQDPEPKRSVYVKKTGISRVPAIGLSKAAPLYTSFKKLEREF 774

Query: 822 KIQHFESTSQRKYINYEPKEVIVKSSNDT--NGFFIKKISPGITEEDLSEVFGKALKSTL 879
           K    ES   +K ++    +   +S +D   N   +  ++   +E  L + F      TL
Sbjct: 775 KANS-ESAVTKKLVSVHIDDS-PESQHDAAINAILLSGLTSFASESALRDCFADYFSQTL 832

Query: 880 IKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVEG 939
           +   C + +   ++  I+P  Y S++ +  +DL  L G+F  + +E  ++  I  C ++ 
Sbjct: 833 LN--CPQYVVRGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDS 890

Query: 940 YINQI 944
            +N+I
Sbjct: 891 NLNRI 895

>YJL149W Chr10 (137379..139370) [1992 bp, 663 aa] {ON}  DAS1Putative
           SCF ubiquitin ligase F-box protein; interacts physically
           with both Cdc53p and Skp1 and genetically with CDC34;
           similar to putative F-box protein YDR131C
          Length = 663

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 79/169 (46%), Gaps = 28/169 (16%)

Query: 765 HFVRELSTSFNLYSESQDPE--------PKRSVFVKRKVDTRIPNISLE-EVLPLWTGFK 815
           HF R   +SF++   +  PE        P  + ++ +++ +R+ +++L  + L L+    
Sbjct: 196 HFSRSNVSSFDMAPPNSLPEMVVPENYIPNLTKYLSQRISSRLSHMTLFIDPLKLFNYLY 255

Query: 816 KLEKERKIQHFESTSQRKYINYEPKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGK-A 874
            L+ + +I   +   +R++ N              N +F+KKI PG     LSEVF K  
Sbjct: 256 PLDIKLQIIDLKLHWRREFYN--------------NDYFVKKIRPGNPLTKLSEVFDKRT 301

Query: 875 LKSTLIKNVCYKILPESSDAIIYPEQYNSITE----SVHQDLEVLVGHF 919
           LK   I +    +L   ++ +   +++ ++ +    S+ QD+ +LV  F
Sbjct: 302 LKILTIISWNDTLLKRETEMLKDFKEFENLEDLSLISIKQDVHILVDLF 350

>NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON}
           Anc_1.357
          Length = 464

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 836 NYEPKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKSTLIKNVCY 885
           NYE K++ +  S +T   FI  + P +T+E L  +FGK   S L   VCY
Sbjct: 36  NYEGKKIKILESGETFSLFIGDLHPKVTQEILENIFGK-YPSFLSAKVCY 84

>Skud_10.66 Chr10 (112547..114532) [1986 bp, 661 aa] {ON} YJL149W
           (REAL)
          Length = 661

 Score = 35.0 bits (79), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 79/169 (46%), Gaps = 28/169 (16%)

Query: 765 HFVRELSTSFNLYSESQDPE--------PKRSVFVKRKVDTRIPNISLE-EVLPLWTGFK 815
           HF +   +SF++   +  PE        P  + ++ +++ +R+ +++L  + L L+    
Sbjct: 197 HFSKFNVSSFDMAPPNSLPEMVVPENYIPNLTRYLSQRISSRLSHMTLFIDPLKLFNYLY 256

Query: 816 KLEKERKIQHFESTSQRKYINYEPKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGK-A 874
            L+ + +I   +   +R++ N              NG+F+ K+ PG     LSEVF K +
Sbjct: 257 PLDIKLQIIDLKLHWRREFYN--------------NGYFVNKVRPGNPLAKLSEVFDKRS 302

Query: 875 LKSTLIKNVCYKILPESSDAIIYPEQYNSITE----SVHQDLEVLVGHF 919
           LK   I +    +L   ++ +   +++  + +    S+ QD+ +LV  F
Sbjct: 303 LKILTIISWNDTLLKRETEMLKDFKEFEHLEDLSLISIKQDVHILVDLF 351

>KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weakly
           similar to uniprot|Q99383 Saccharomyces cerevisiae
           YOL123W HRP1 Subunit of cleavage factor I a five-subunit
           complex required for the cleavage and polyadenylation of
           pre-mRNA 3' ends RRM-containing heteronuclear RNA
           binding protein and hnRNPA/B family member that binds to
           poly (A) signal sequences
          Length = 570

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 34/75 (45%)

Query: 799 IPNISLEEVLPLWTGFKKLEKERKIQHFESTSQRKYINYEPKEVIVKSSNDTNGFFIKKI 858
           +P +     +P   G   + + +++Q   S  Q+    +EPK +    S D N  FI  +
Sbjct: 134 VPEMLQMPQMPQMPGMPDMSQLQQLQQTMSQLQQTASQHEPKAIKADLSRDINKMFIGGL 193

Query: 859 SPGITEEDLSEVFGK 873
           +   TEE L + F K
Sbjct: 194 NWETTEEGLRDYFSK 208

>ZYRO0A07260g Chr1 (592998..594788) [1791 bp, 596 aa] {ON} similar
           to uniprot|P40969 Saccharomyces cerevisiae YMR168C CEP3
           Essential kinetochore protein component of the CBF3
           complex that binds the CDEIII region of the centromere
           contains an N-terminal Zn2Cys6 type zinc finger domain a
           C-terminal acidic domain and a putative coiled coil
           dimerization domain
          Length = 596

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 854 FIKKISPGITEEDLSEVFGKALKSTLIKNVCYKILPESSDAIIYPEQYNSITESVH 909
           F  KIS  + EE  S  F K L   L+++VC+K+        I+ +  +S+T S+H
Sbjct: 372 FQTKISNMVEEESFSSAFEKFLAIFLLRSVCWKL---HKMYFIFYDTSDSLTASIH 424

>NCAS0C04990 Chr3 (1017294..1018796) [1503 bp, 500 aa] {ON}
           Anc_1.415 YCL004W
          Length = 500

 Score = 32.0 bits (71), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 12/99 (12%)

Query: 681 LQLRDAFGYDSSLDTSNKNI--------QDIQSLMEKVSTYEELRLPYPQSVISTYSKQI 732
           LQ    +G+D  +  S  N+        QD   L +K   +        Q +IS+ S Q+
Sbjct: 162 LQHMKIYGFDDDVLMSGANLSNDYFTNRQDRYYLFKKAPFFANYYFKLHQ-LISSISYQV 220

Query: 733 KWCSQIEDILRKFVLDKAKNNLHFKPMKPAQRHFVRELS 771
           K+ SQ      KF L   K+NL  KP    +R F+++ S
Sbjct: 221 KYSSQDSS---KFNLLWPKSNLTIKPTLLTKRRFLQDTS 256

>Suva_6.229 Chr6 complement(410663..412660) [1998 bp, 665 aa] {ON}
           YJL149W (REAL)
          Length = 665

 Score = 32.0 bits (71), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 77/169 (45%), Gaps = 28/169 (16%)

Query: 765 HFVRELSTSFNLYSESQDPE--------PKRSVFVKRKVDTRIPNISLE-EVLPLWTGFK 815
           HF +   +SF++   +  PE        P  + ++ +++ +R+ +++L  + L L+    
Sbjct: 197 HFSKFNVSSFDMAPPNSLPEMSVPDHYIPNLTKYLSQRISSRLSHMTLFIDPLKLFNYLY 256

Query: 816 KLEKERKIQHFESTSQRKYINYEPKEVIVKSSNDTNGFFIKKISPGITEEDLSEVFGK-A 874
            L+ + +I   +   +R++ N              N +F+ K+ PG     LSEVF K  
Sbjct: 257 PLDIKLQIVDLKLHWRREFYN--------------NDYFVSKVRPGNPLTKLSEVFDKRT 302

Query: 875 LKSTLIKNVCYKILPESSDAIIYPEQYNSITE----SVHQDLEVLVGHF 919
           LK   I +    +L   ++ +   +++  + +    S+ QD+ +LV  F
Sbjct: 303 LKILTIISWNDTLLKRETEMLKDFKEFEQLEDLSLISIKQDVHILVDLF 351

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 31.6 bits (70), Expect = 9.6,   Method: Composition-based stats.
 Identities = 42/183 (22%), Positives = 76/183 (41%), Gaps = 8/183 (4%)

Query: 704 QSLMEKVSTYEELRLPYPQSV---ISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMK 760
           ++ ++    YE     YP +V   +  +SK +    ++ D+ +    ++A+N L   P  
Sbjct: 82  ENFLKVTKIYENESYDYPSNVKESVDEFSKLVG--GKLHDLSKVTNREQAQNVLLSSPQM 139

Query: 761 PAQRHFVRELSTSFNLYSESQDPEPKRSVFVK-RKVDTRIPNISLEEVLPLWTGFKKLEK 819
              +     LS      SE  + E   +   K     T+I  + L++   + T F K  K
Sbjct: 140 KEPKTLNYALSKVALTSSEHVEDESLANFLAKYSDSQTKIAQLRLQQDTMIQTKFNKAIK 199

Query: 820 ERKIQHFE-STSQRKYINYEPKEV-IVKSSNDTNGFFIKKISPGITEEDLSEVFGKALKS 877
           E+  Q  E ST  RK +  +  +  +V+S+   N    K+ +  + E    E F KA   
Sbjct: 200 EKLEQDIETSTKARKLVEQKRLQYDVVRSNRLKNTKPEKQAALQVEESTHEEEFAKATDD 259

Query: 878 TLI 880
            +I
Sbjct: 260 AII 262

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 101,656,718
Number of extensions: 4475712
Number of successful extensions: 12811
Number of sequences better than 10.0: 91
Number of HSP's gapped: 12108
Number of HSP's successfully gapped: 104
Length of query: 962
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 843
Effective length of database: 39,836,145
Effective search space: 33581870235
Effective search space used: 33581870235
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)