Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0D015202.292ON71671634060.0
Suva_9.1082.292ON72271622760.0
YIL091C (UTP25)2.292ON72172622730.0
Skud_9.822.292ON72271822460.0
Kpol_1039.462.292ON70456522420.0
KAFR0J013402.292ON72872522430.0
Smik_9.882.292ON72472522360.0
NDAI0B035302.292ON73972522360.0
TBLA0B059702.292ON71971522280.0
KNAG0A054002.292ON72157122270.0
TDEL0G022202.292ON71070821920.0
SAKL0E07546g2.292ON71871721890.0
NCAS0B062302.292ON72372121780.0
CAGL0D04180g2.292ON70057021120.0
KLTH0G10494g2.292ON74756421080.0
KLLA0E08229g2.292ON70471620980.0
Ecym_33312.292ON70856820910.0
ZYRO0A02002g2.292ON70971120900.0
Kwal_27.115032.292ON72756520920.0
ADL209C2.292ON70456720140.0
Kwal_26.71637.88ON622267790.68
Skud_4.5058.469ON604153771.4
TBLA0C055802.164ON540109752.3
CAGL0J10230g2.223ON543135716.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0D01520
         (716 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...  1316   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   881   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   880   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   869   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   868   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   868   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   865   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   865   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   862   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   862   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   848   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   847   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   843   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   818   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   816   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   812   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   810   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   809   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   810   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   780   0.0  
Kwal_26.7163 s26 (243008..244876) [1869 bp, 622 aa] {ON} YAL016W...    35   0.68 
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...    34   1.4  
TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 5...    33   2.3  
CAGL0J10230g Chr10 complement(1000573..1002204) [1632 bp, 543 aa...    32   6.9  

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score = 1316 bits (3406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 655/716 (91%), Positives = 655/716 (91%)

Query: 1   MSGRGEFKKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGXXXXXXXX 60
           MSGRGEFKKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSG        
Sbjct: 1   MSGRGEFKKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGEEAESESD 60

Query: 61  XXXXXXXVGKKRNQVYGALLTILXXXXXXXXXXXXXXXXXXXDAYNASDDEYNVSDKQEI 120
                  VGKKRNQVYGALLTIL                   DAYNASDDEYNVSDKQEI
Sbjct: 61  DAKDEEDVGKKRNQVYGALLTILKSEHPEKKKQKKKFNQEKEDAYNASDDEYNVSDKQEI 120

Query: 121 ENGLXXXXXXXXXXXXXXXXXXXXXXXXXXXTDLFDIHFNQVPENVVDKISNGFDNKKIK 180
           ENGL                           TDLFDIHFNQVPENVVDKISNGFDNKKIK
Sbjct: 121 ENGLEDQQDDNEDENENDMENMENDDESDDDTDLFDIHFNQVPENVVDKISNGFDNKKIK 180

Query: 181 YVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEITNNLLDGKD 240
           YVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEITNNLLDGKD
Sbjct: 181 YVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEITNNLLDGKD 240

Query: 241 NLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKDNQRLQ 300
           NLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKDNQRLQ
Sbjct: 241 NLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKDNQRLQ 300

Query: 301 ENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFEDSLPP 360
           ENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFEDSLPP
Sbjct: 301 ENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFEDSLPP 360

Query: 361 SSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITENTDKKK 420
           SSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITENTDKKK
Sbjct: 361 SSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITENTDKKK 420

Query: 421 KQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYINDQAR 480
           KQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYINDQAR
Sbjct: 421 KQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYINDQAR 480

Query: 481 LFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRFDL 540
           LFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRFDL
Sbjct: 481 LFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRFDL 540

Query: 541 VGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKTTLLFG 600
           VGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKTTLLFG
Sbjct: 541 VGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKTTLLFG 600

Query: 601 DINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFYNE 660
           DINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFYNE
Sbjct: 601 DINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFYNE 660

Query: 661 VVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEFK 716
           VVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEFK
Sbjct: 661 VVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEFK 716

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/716 (61%), Positives = 541/716 (75%), Gaps = 17/716 (2%)

Query: 8   KKRGRSQLRTIQRSKYAKKRNSGRN-YDTNTKHNDESKPADALVSGXXXXXXXXXXXXXX 66
           +KRGR ++R I+R+   +  +   N  D   + + E+K  DA+                 
Sbjct: 17  RKRGRQEMRKIKRTTARRTEDVDTNEVDHVAEESVETKAEDAISDAGSESDLDIGDEE-- 74

Query: 67  XVGKKRNQVYGALLTILXXXXXXXXXXXXXXXXXXXDAY-----NASDDEYNVSDKQEIE 121
              +K+ +VY ALLTIL                   +A      N + D   V D+ EIE
Sbjct: 75  ---EKQEKVYDALLTILKSEHPEPKRKKTKATGENNEAVDQTGVNENTDSEPVDDQLEIE 131

Query: 122 NGLXXXXXXXXXXXXXXXXXXXXXXXXXXXTDLFDIHFNQVPENVVDKISNGFDNKKIKY 181
           NGL                            D F+ HFNQV E  VD +SN F    IKY
Sbjct: 132 NGLLSDQEDDSDDDGDENEQDEVDSEDEQ--DPFESHFNQVSEKYVDDVSNAFKANNIKY 189

Query: 182 VSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEITNNLLDGK-D 240
             K ++ P  + +  IYSKP+V+ G++  VE P K SS+ SYF+K+RL+I N LLD K D
Sbjct: 190 --KSVKSPLGDDESCIYSKPVVN-GDETPVERPYKSSSIYSYFLKQRLKIQNGLLDKKID 246

Query: 241 NLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKDNQRLQ 300
            LT LQK LVDPMFQY DIL+EY++Y  DE EYR+LYTLH LNH+YKTRD++LK+NQRLQ
Sbjct: 247 PLTSLQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHALNHIYKTRDRILKNNQRLQ 306

Query: 301 ENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFEDSLPP 360
           +N ++E LDQGFTRPKVLIVVPTRD AY+VV+ II+KSG+DQV+KKGKF  QF +DSLPP
Sbjct: 307 DNPDTEHLDQGFTRPKVLIVVPTRDAAYHVVDKIIKKSGIDQVDKKGKFYDQFRDDSLPP 366

Query: 361 SSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITENTDKKK 420
           SSKPKSFQ IF+GNT+DFFV+GLKFTRKA+KLYSNFYQSD+I+CSPLG+ MI ENTDKKK
Sbjct: 367 SSKPKSFQHIFRGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKK 426

Query: 421 KQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYINDQAR 480
           +QDDFLSSIE+ ++DQLHS+EYQNISHI  IF+H+NKIP +QH+ADFSRIRMWYIN+QA+
Sbjct: 427 RQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQAK 486

Query: 481 LFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRFDL 540
           L RQTM+FTKY+SP AN++ING+CRN+AGRW+N   + SE SS+G+LGLKIRQIFQRFD+
Sbjct: 487 LLRQTMVFTKYISPAANSLINGRCRNLAGRWKNHKVIESETSSIGQLGLKIRQIFQRFDI 546

Query: 541 VGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKTTLLFG 600
           +G ++ +EPD+RFKFF SV++ SI+KSTGYEDGIL+YIP+Y+D++R+RNYMKEKTT+LFG
Sbjct: 547 IGNSIIEEPDYRFKFFTSVIIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFG 606

Query: 601 DINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFYNE 660
           DINEYS Q++LN+NRSLFQQGRVKVLLYTERLHHYRRYEIKGVK+VIFY PP NPEFYNE
Sbjct: 607 DINEYSSQKQLNANRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVIFYKPPNNPEFYNE 666

Query: 661 VVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEFK 716
            VR+IGKNAFLGN D+NI+TVR VYSKLD LSLERIVGT+RA VLS A+ EVYEFK
Sbjct: 667 TVRYIGKNAFLGNTDLNISTVRCVYSKLDGLSLERIVGTKRAGVLSHAQKEVYEFK 722

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  880 bits (2273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/726 (61%), Positives = 540/726 (74%), Gaps = 31/726 (4%)

Query: 4   RGEFKKRGRSQLRTIQRSKYAKKRNSGRNYDT------NTKHNDESKPADALVSGXXXXX 57
           RG ++KRGR +LR I+RS     R  G + +T      +  H  +      + SG     
Sbjct: 14  RG-YRKRGRQELRKIKRSS---ARTEGGSTETLEDVAEDIDHRSDEDEVSDVDSGDDFDI 69

Query: 58  XXXXXXXXXXVGKKRNQVYGALLTILXXXXXXXXXXXXXXXXXXXDAYNASDDEYN---- 113
                        K+ +VY ALLTIL                         +DE+     
Sbjct: 70  EDEEG--------KKEKVYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEH 121

Query: 114 --VSDKQEIENGLXXXXXXXXXXXXXXXXXXXXXXXXXXXTDLFDIHFNQVPENVVDKIS 171
             V D+ EIENGL                            D F+ HFNQVPE  VDK+S
Sbjct: 122 GPVDDQLEIENGLLGNHEDDNDDDSSGDEKDIDSEDEQ---DPFESHFNQVPEKFVDKLS 178

Query: 172 NGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEI 231
           N F  K +KY S K  L   E   +IY+KP+V  G +  VESP + SS+ SYF+K+RL++
Sbjct: 179 NAFKTKSVKYKSVKGSLSDSES--YIYAKPVVI-GEEALVESPYRSSSIYSYFLKQRLKV 235

Query: 232 TNNLLDGK-DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRD 290
            N LLD K D LT LQK LVDPMFQY DIL+EY++Y  DE EYR+LY LH+LNH+YKTRD
Sbjct: 236 QNGLLDKKTDPLTALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRD 295

Query: 291 KVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFK 350
           ++LK+NQRLQ+N ++E LDQGFTRPKVLIVVPTR+ AY VV+ II KSG+DQV+KKGKF 
Sbjct: 296 RILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFY 355

Query: 351 SQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLH 410
            QF +DSLPP SKPKSFQ IF+GNTNDFFV+GLKFTRKA+KLYSNFYQSD+I+CSPLG+ 
Sbjct: 356 DQFRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQ 415

Query: 411 MITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRI 470
           MI ENTDKKK+QDDFLSSIE+ ++DQLHS+EYQNISHI  IF+HLNKIP +QH+ADFSRI
Sbjct: 416 MILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRI 475

Query: 471 RMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLK 530
           RMWYIN+QA+LFRQTM+FTKY+SP AN++ING+CRN+AGRW+N   + SE SS+G+ GLK
Sbjct: 476 RMWYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLK 535

Query: 531 IRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNY 590
           IRQIFQRFD++G ++ +EPD+RFKFF SV++  I+KSTGYEDGIL+YIP+Y+D++R+RNY
Sbjct: 536 IRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNY 595

Query: 591 MKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYG 650
           MKEKTT+LFGDINEYS QR+LN+NRSLFQQGR+KV+LYTERLHHYRRYEIKGVKSV+FY 
Sbjct: 596 MKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYK 655

Query: 651 PPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAEN 710
           PP NPEFYNEVVRFIGKNAFLGN D+NI+TVR +YSKLD LSLERIVGT+RAAVLS A+ 
Sbjct: 656 PPNNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQK 715

Query: 711 EVYEFK 716
           E+YEFK
Sbjct: 716 EIYEFK 721

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  869 bits (2246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/718 (60%), Positives = 535/718 (74%), Gaps = 21/718 (2%)

Query: 8   KKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGXXXXXXXXXXXXXXX 67
           +KRGR +LR I+RS       SGR  +       +    + +                  
Sbjct: 17  RKRGRQELRKIKRS-------SGRRTEDVDADKIDYVAEEPVGRNDNDAVSDVGSEDDLD 69

Query: 68  VG---KKRNQVYGALLTILXXXXXXXXXXXXXXXXXXXDAYNASDDEYN-----VSDKQE 119
           VG   +K+ +VY ALLTIL                   D    SD   N     V D+ E
Sbjct: 70  VGDEDEKKKKVYDALLTILKSEHPEPKRMKTKAEESS-DRTTQSDGNENAESEPVDDQLE 128

Query: 120 IENGLXXXXXXXXXXXXXXXXXXXXXXXXXXXTDLFDIHFNQVPENVVDKISNGFDNKKI 179
           IENGL                            D F+ HFNQVPE  VD +SN F +K I
Sbjct: 129 IENGLLGDREDESEDDGSEDEKHDDVDSEDEQ-DPFESHFNQVPEKDVDDLSNAFKSKNI 187

Query: 180 KYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEITNNLLDGK 239
           +Y  K ++ P +  + +IY++P+V  G +  VESP K SS+ SYF+K+RL+I N L D K
Sbjct: 188 RY--KSVKAPLNGDESYIYAQPVVV-GEESSVESPYKSSSIYSYFLKQRLKIQNGLQDKK 244

Query: 240 -DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKDNQR 298
            D L  LQ+ LVDPMFQY DIL+EY++Y  DE EYR+LYTLH+LNH+YKTRD++LK+NQR
Sbjct: 245 IDPLNALQRKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRILKNNQR 304

Query: 299 LQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFEDSL 358
           LQ+N ++E LDQGFTRPKVLIVVPTRD AY VV+ II KSG+DQV+KKGKF  QF +DSL
Sbjct: 305 LQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSL 364

Query: 359 PPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITENTDK 418
           PP SKP+SFQ IFKGNTNDFFV+GLKFTRKA+KLYSNFYQSD+I+CSPLG+ MI ENTDK
Sbjct: 365 PPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDK 424

Query: 419 KKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYINDQ 478
           KK+QDDFLSSIEI ++DQLHS+EYQNISHI+ IF+HLNKIP +QH+ADFSRIRMWYIN+Q
Sbjct: 425 KKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQ 484

Query: 479 ARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRF 538
           A+ FRQTM+FTKY+SPT N++ING+CRN+AGRW+N   +  E SS+G+LGLKIRQIFQRF
Sbjct: 485 AKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRF 544

Query: 539 DLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKTTLL 598
           D +G ++ +EPD+RFKFF SV++ SI+KSTGYEDGIL+YIP+Y+D++R+RNYMKEKTT+L
Sbjct: 545 DTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTIL 604

Query: 599 FGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFY 658
           FGDINEYS QR+LN+NRSLFQQGR+KV+LYTERLHHYRRY+IKGVKSVIFY PP NPEFY
Sbjct: 605 FGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFY 664

Query: 659 NEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEFK 716
           +E VRFIGKNAF GN D+NI+TVR +YSKLD +SLERIVGT+RAAVLS A+ EVYEFK
Sbjct: 665 SETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  868 bits (2242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/565 (71%), Positives = 491/565 (86%), Gaps = 3/565 (0%)

Query: 153 DLFDIHFNQVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVE 212
           D F+ HFN V +++VD IS GF +K+IKY S K  L   +K+  I+ KP++       ++
Sbjct: 142 DTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSL--DKKESAIFGKPLLLTQQDETID 199

Query: 213 SPIKKSSLDSYFIKKRLEITNNLLDG-KDNLTKLQKSLVDPMFQYVDILHEYENYGSDEQ 271
           +P+  SS DSYFIK+RL+I N+LLD  K+NLT L+K L+DPMFQY D+L EY NY +DE+
Sbjct: 200 NPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYENDEK 259

Query: 272 EYRELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVV 331
           EYRELY+LH+LNH+YKTRDK+LKDNQRLQEN++ E LDQGFTRPKVLIVVPTRDTAY VV
Sbjct: 260 EYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQVV 319

Query: 332 ETIIRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALK 391
           ETII KSGLDQ++KKGKFK QFF+DSLPP+SKPKSF+ +FKGNTNDFFVLG+KFTRKA+K
Sbjct: 320 ETIIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIK 379

Query: 392 LYSNFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNI 451
           LYSNFYQSD+IICSPLG+ MI ENTDKKK+QDDFLSSIE+ I+DQLHS+EYQNISH+  I
Sbjct: 380 LYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTI 439

Query: 452 FEHLNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRW 511
            EH+NKIP++Q +ADFSRIRMWYINDQA+  RQTM+FT+Y+SPTANA+INGKC N+AGRW
Sbjct: 440 LEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMAGRW 499

Query: 512 RNKIQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYE 571
           +N   ++SE+SS+G+LG+KI+QIFQRFDLVGGT+ DE D+RFK+F SVVM +I+KSTGYE
Sbjct: 500 KNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTGYE 559

Query: 572 DGILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTER 631
           DGILVYIP Y+DYMR+RNYMKEKTT+LF +INEYS Q++L+SNRS+FQQGR KVLLYTER
Sbjct: 560 DGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYTER 619

Query: 632 LHHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSL 691
           LHHYRRYE+KG+KSVIFY PPTNPEFYNEV+RF  KNAFLG  DINI+T+R VYSKLD L
Sbjct: 620 LHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLDGL 679

Query: 692 SLERIVGTQRAAVLSRAENEVYEFK 716
           +L+RIVG++RAA+L   +NE Y+FK
Sbjct: 680 ALQRIVGSKRAAILCHGQNESYDFK 704

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/725 (60%), Positives = 536/725 (73%), Gaps = 17/725 (2%)

Query: 3   GRGEFKKRGRSQLRTIQRSKYAKKRNS-----GRNYDTNTKHNDESKPADALVSGXXXXX 57
           G    +KRGR +LR I+R+   K R++     G +   NT   +E +P+ A         
Sbjct: 10  GYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEE-EPSSAANGDDVGDE 68

Query: 58  XXXXXXXXXXVGKKRNQVYGALLTILXXXXXXXXXXXXXXXXXX----XDAYNASDDEYN 113
                       KK  QVYGALLTIL                           +   E  
Sbjct: 69  VGDEASDDEEEMKK--QVYGALLTILKSEHPEPKKQKKEKVNKVLLDNEQQDESDASEEE 126

Query: 114 VSDKQEIENGLXXXXXXXXXXXXXXXXXXXXXXXXXXXTDLFDIHFNQVPENVVDKISNG 173
             + Q+IEN L                            D F+ HFN V E   DK+   
Sbjct: 127 EDETQQIENALMGSHADDASEDDDKEHGDDNEESDEEQ-DPFETHFNSVDEKFTDKLDVS 185

Query: 174 FDNKKIKYVSKKIQLPHHEKDFFIYSKPIV-DDGNKHKVESPIKKSSLDSYFIKKRLEIT 232
           F N  IKY S K  LP  E ++ I+SKP++  D  +  VE  + KSS+ SYF+K+RL++ 
Sbjct: 186 FKNNDIKYKSTK--LPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRLKMQ 243

Query: 233 NNLLDGK-DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDK 291
           NNL+D K D LT LQK LVDPMFQY DIL++Y++YG DE EYR+LY+LH+LNHLYKTRDK
Sbjct: 244 NNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDK 303

Query: 292 VLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKS 351
           +LK+NQRLQ+NN++E LDQGFTRPKVLIVVPTRDTAY V+E II KSG+DQV+KKGKFK 
Sbjct: 304 ILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKD 363

Query: 352 QFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHM 411
           QFFEDSLPPSSKPKSFQ IFKGNTNDFFVLG+KFTRKA+KLYSNFYQSD+IICSPLG+ M
Sbjct: 364 QFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQM 423

Query: 412 ITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIR 471
           I ENTDKKK+QDDFLSSIE+ I+DQLHS+EYQNISH+  I  H+NKIP+EQHDADFSR+R
Sbjct: 424 ILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVR 483

Query: 472 MWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKI 531
           MWYINDQA+LFRQTM+FTKY+SP AN+++NGKC+N +GRW+N   +++  SS+ K+G+KI
Sbjct: 484 MWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKI 543

Query: 532 RQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYM 591
           RQIFQRF+ V G++ DEPD+RFKFF SV + +I+K+TGYEDG L+YIP Y+DY+RVRNY+
Sbjct: 544 RQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYL 603

Query: 592 KEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGP 651
           K+KTT+LFGDINEYSDQ++LNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVK+V+FY P
Sbjct: 604 KDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQP 663

Query: 652 PTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENE 711
           P NPEFY EVVR+IGKNAFLGN D+NI+TVR +YSKLD+LSLE IVG++RA VL  A+NE
Sbjct: 664 PKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNE 723

Query: 712 VYEFK 716
           VYEFK
Sbjct: 724 VYEFK 728

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/725 (60%), Positives = 540/725 (74%), Gaps = 26/725 (3%)

Query: 4   RGEFKKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALV--SGXXXXXXXXX 61
           RG ++KRGR +LR I+RS   + ++   N        +    AD +V  +G         
Sbjct: 14  RG-YRKRGRQELRKIKRSSVRRTKDESVN--------EVDHVADEIVHSTGEDKISDIGS 64

Query: 62  XXXXXXVGK---KRNQVYGALLTILXXXXXXXXXXXXXXXXXXXDAYNASDDE-----YN 113
                 V     K+ +VY ALLTIL                    A   + +E     Y 
Sbjct: 65  EEDNLDVEDEEGKKEKVYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVNVEYE 124

Query: 114 VSDKQ-EIENGLXXXXXXXXXXXXXXXXXXXXXXXXXXXTDLFDIHFNQVPENVVDKISN 172
             D+Q EIENGL                            D F+ HFNQV E  VD +SN
Sbjct: 125 PVDEQLEIENGLLGDREDDNDDDSNENEKDDMDSEDE--QDPFESHFNQVSEKYVDDLSN 182

Query: 173 GFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEIT 232
            F +K IKY S K  L   E   +IY+KP +  G +  VESP + SS+ SYF+K+RL++ 
Sbjct: 183 AFKSKSIKYKSVKASLGDDES--YIYAKPFMV-GEEALVESPYRSSSIYSYFLKQRLKVQ 239

Query: 233 NNLLDGK-DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDK 291
           N LLD K D LT +QK L+DPMFQY DIL+EY++Y  DE EYR+LY LH+LNH+YKTRD+
Sbjct: 240 NGLLDKKIDPLTCMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYALHVLNHIYKTRDR 299

Query: 292 VLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKS 351
           +LK+NQRLQ+N ++E LDQGFTRPKVLIVVPTR+ AY VV+ II KSG+DQV+KKGKF  
Sbjct: 300 ILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYD 359

Query: 352 QFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHM 411
           QF +DSLPP SKPKSFQ IFKGNT+DFFV+GLKFTRKA+KLYSNFYQSD+IICSPLG+ M
Sbjct: 360 QFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQM 419

Query: 412 ITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIR 471
           I ENTDKKK+QDDFLSSIE+ ++DQLHS+EYQNISHI  IF+H+NKIP +QH+ADFSRIR
Sbjct: 420 ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIR 479

Query: 472 MWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKI 531
           MWYIN+QA+LFRQTM+FTKY+SP AN++ING+C N+AGRW+N   + SE SS+G+LGLK+
Sbjct: 480 MWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKV 539

Query: 532 RQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYM 591
           RQIFQRFD++G ++ +EPD+RFKFF SV++ SI+KS GYEDGILVYIP+Y+D++R+RNYM
Sbjct: 540 RQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYM 599

Query: 592 KEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGP 651
           KEKTT+LFGDINEYS+QR+LN+NRSLFQQGR+KV+LYTERLHHYRRYEIKGVKSV+FY P
Sbjct: 600 KEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKP 659

Query: 652 PTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENE 711
           P NPEFYNE VRFIGKNAFLGN D+NI+TVR +YSKLD LSLERIVGT+RAAVLS A+ E
Sbjct: 660 PNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKE 719

Query: 712 VYEFK 716
           VYEFK
Sbjct: 720 VYEFK 724

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/725 (61%), Positives = 537/725 (74%), Gaps = 26/725 (3%)

Query: 8   KKRGRSQLRTIQRSKYAKKRNSGRNYDTN-TKHND-ESKPADALVSGXXXXXXXXXXXXX 65
           +KRGR +LRTI+RS   K R     YD+N T+HND E    +    G             
Sbjct: 25  RKRGRQELRTIRRSAAKKSR-----YDSNVTEHNDTEELLQEESEEGEEDEEDDQSEQEE 79

Query: 66  XXVGKKRNQVYGALLTILXXXXXXXXXXXXXXXXXXXDAY------NASDDEYNVS---- 115
               +++ +VYGALLTIL                   +        N  D E   S    
Sbjct: 80  VDEDERKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRETEDSIIEE 139

Query: 116 -DKQEIENGLXXXXXXXXXXXXXXXXXXXXXXXXXXXTDLFDIHFNQVPENVVDKISNGF 174
            + ++IENGL                            D F+ HFN+  E  VDK+   F
Sbjct: 140 DETEQIENGLLDRDDEQSDDDQLNDSNDVESDDEQ---DPFESHFNKPTEQFVDKLHAAF 196

Query: 175 DNKKIKYVSKKIQLPHHEKDFFIYSKPIV--DDGNKHKVESPIKKSSLDSYFIKKRLEIT 232
           ++++IKY + KI +   +    I SKP +  ++   +++ S     S+ SYFIK+RL+I 
Sbjct: 197 ESREIKYKATKIVI--DDSHSVISSKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQ 254

Query: 233 NNLLDGK-DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDK 291
           NNLL+ K D LT LQK L+DPMFQY DIL+EY++YG DE EYR+LY LH LNH+YKTRD+
Sbjct: 255 NNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDR 314

Query: 292 VLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKS 351
           +LK+NQRLQ+N ++E+LDQGFTRPKVLIVVPTRDTAY V + II+KSGLDQV+KKGKF  
Sbjct: 315 ILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYD 374

Query: 352 QFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHM 411
           QF +DSLPPSSKPKSFQ IFKGNTNDFFVLGLKFTRKA+KLYSNFYQSD+I+CSPLG+ M
Sbjct: 375 QFKDDSLPPSSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQM 434

Query: 412 ITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIR 471
           I ENTDKKK+QDDFLSSIE+ I+DQLHS+EYQN++HI  IF+HLNKIP EQHDADFSRIR
Sbjct: 435 IVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIR 494

Query: 472 MWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKI 531
           MWYINDQA+LFRQTM+FTKYVSP ANA+IN +CRN  GRW+N   +  E SS+GKLGLKI
Sbjct: 495 MWYINDQAKLFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKIVAPEVSSIGKLGLKI 554

Query: 532 RQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYM 591
           +QIFQRFD++GG++ DEPD+RFK F SV++ SI+KST Y+DGIL+YIP+Y+DY+R+RNY+
Sbjct: 555 KQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYL 614

Query: 592 KEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGP 651
           KEKT +LFGDINEYS+QRELNSNRSL QQGRVKVLLYTERLHHYRRYEIKGVKSV+FY P
Sbjct: 615 KEKTRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKP 674

Query: 652 PTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENE 711
           PTNPEFYNEVVRFIGKNAFLGN D+NI+TVR VY KLD LSLERIVGT+RA +L  A+NE
Sbjct: 675 PTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNE 734

Query: 712 VYEFK 716
           VYEFK
Sbjct: 735 VYEFK 739

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/715 (58%), Positives = 539/715 (75%), Gaps = 14/715 (1%)

Query: 7   FKKRGRSQLRTIQRSKYAKKRNSGRNYDTN-TKHNDESKPADALVSGXXXXXXXXXXXXX 65
           + KRGRSQ R+I++S  AK+    +  DT   K   E + +D  VS              
Sbjct: 14  YGKRGRSQKRSIKKSSGAKR---FKTEDTRIVKETIEDESSDEDVSNTSIDKEAEVTEDL 70

Query: 66  XXVGKKRNQVYGALLTILXXXXXXXXXXXXXXXXXXXDAYNASD---DEYNVSDKQEIEN 122
               +K+ QVY AL+TIL                   +     D   DE   +++QEIEN
Sbjct: 71  ----EKKKQVYDALVTILKSEHKEPKMRDNLNETSKEEHLTDEDLDEDEKFETEEQEIEN 126

Query: 123 GLXXXXXXXXXXXXXXXXXXXXXXXXXXXTDLFDIHFNQVPENVVDKISNGFDNKKIKYV 182
            L                           +D FD HFNQ  E   +K ++ F NK+IKY 
Sbjct: 127 NLLSIKDDEEEGENNDDNAGESDDESDNKSDPFDSHFNQPTEQFTNKFADAFKNKQIKYR 186

Query: 183 SKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEITNNLLD-GKDN 241
           S K ++  +E    IYS+P + +  + KV+SP+ KSS+ SY +KKRL+I N+LLD   +N
Sbjct: 187 SIKYKINEYESS--IYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKINNDLLDPAVNN 244

Query: 242 LTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKDNQRLQE 301
           LT +QK LVDPMFQY DIL+EY NYG DE+EYR LY LH+LNH+YKTRD++LK+N ++Q+
Sbjct: 245 LTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNSKVQD 304

Query: 302 NNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFEDSLPPS 361
           N ++EFLDQGFTRPKVLIV PTRD  Y++V  II+KSG+DQ++KK KF+ QF+E+SL P+
Sbjct: 305 NPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEESLLPA 364

Query: 362 SKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITENTDKKKK 421
           SKPKSFQ++FKGN+ND+FVLG+KFTRKA+KLYSNFYQSD+I+CSPLGLHMI ENTDKKK+
Sbjct: 365 SKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTDKKKR 424

Query: 422 QDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYINDQARL 481
           QDDFLSSIE+ I+DQLHSME+QNISH+ +IFEH+NKIP+EQHD DFSRI+MWYINDQA+L
Sbjct: 425 QDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYINDQAKL 484

Query: 482 FRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRFDLV 541
           FRQTMIFTKY+SP+AN  +NGKC+N +GRW+N   +T  ESS+G+LGL+++Q+F RFD++
Sbjct: 485 FRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHRFDII 544

Query: 542 GGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKTTLLFGD 601
           GG++ DEPD+RFK+F SV++ SI KST YEDG+L+YI +Y+DY+RVRNY+KEKTT+LFGD
Sbjct: 545 GGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTILFGD 604

Query: 602 INEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFYNEV 661
           INEYSDQ+++NSNR+LFQQ RVKVLLYTERLHH+RRYEIKGVK+++FY  PTNPEFYNEV
Sbjct: 605 INEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEFYNEV 664

Query: 662 VRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEFK 716
           VR+IGKNAF GN DINI+ VR +YSKLD L+LERI+GT+RAAVL+  +NE YEFK
Sbjct: 665 VRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/571 (70%), Positives = 487/571 (85%), Gaps = 8/571 (1%)

Query: 153 DLFDIHFNQVPENVVDKISNGFDNKKIKYVSKKIQLPHHEK---DFFIYSKPIVDDG--- 206
           D F+ HFNQ PE  ++ +   F +K+++Y S K+Q     K   ++ IYS+P V  G   
Sbjct: 152 DPFESHFNQFPETEINTLDAAFKSKQLQYRSVKLQPAKVTKVKDEYLIYSEPTVPGGKQL 211

Query: 207 NKHKVESPIKKSSLDSYFIKKRLEITNNLLDGK-DNLTKLQKSLVDPMFQYVDILHEYEN 265
           +K  +ES  K  S+ SYF+KKRL+I N+LL+ K DNL  +QK LVDPMFQY DIL+EYEN
Sbjct: 212 SKKLIESNTK-CSIGSYFLKKRLKIQNDLLENKPDNLASIQKELVDPMFQYKDILYEYEN 270

Query: 266 YGSDEQEYRELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRD 325
           YG  E EYR+LY LH LNH+YKTRD++LK+NQRLQEN+++E LDQGFTRPKVLI+ PTRD
Sbjct: 271 YGKSEDEYRQLYALHALNHVYKTRDRILKNNQRLQENSDTECLDQGFTRPKVLIIAPTRD 330

Query: 326 TAYNVVETIIRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKF 385
           TAY++V TII KSG+DQV+K+GKFK QF+EDSLPPSSKPKSFQSIFKGNTNDFFVLG+KF
Sbjct: 331 TAYSIVTTIINKSGIDQVDKRGKFKDQFYEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKF 390

Query: 386 TRKALKLYSNFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNI 445
           TRKA+KLYSNFYQSD+I+CSPLGL MI ENTDKKK+QDDFLSSIEITI+DQLHS+EYQNI
Sbjct: 391 TRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSIEITIIDQLHSIEYQNI 450

Query: 446 SHIMNIFEHLNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCR 505
           SH+  IFEHLN IP EQHDADFSRIRMWYINDQAR FRQTM+FTKY+SPTAN++INGKCR
Sbjct: 451 SHLYTIFEHLNNIPDEQHDADFSRIRMWYINDQARFFRQTMVFTKYISPTANSIINGKCR 510

Query: 506 NIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSIL 565
           N +GRW+N   +++E S +GKL L++RQIFQRF++ GG++ DEPD+RFKFF SV++  IL
Sbjct: 511 NWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFEVTGGSIVDEPDYRFKFFTSVIIPGIL 570

Query: 566 KSTGYEDGILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKV 625
           KSTGYEDGIL+YIP Y+DY+RVRNY+KEKT +LFGDINEYS Q++L +NRSLFQQGR+KV
Sbjct: 571 KSTGYEDGILIYIPEYTDYVRVRNYLKEKTRILFGDINEYSSQKQLTANRSLFQQGRLKV 630

Query: 626 LLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVY 685
           LLYTERLHHYRRYEIKGVKSVIFY PP++PEFY EVVR IG+NAFLGN D+NI+TVR +Y
Sbjct: 631 LLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFYTEVVRNIGRNAFLGNTDLNISTVRCIY 690

Query: 686 SKLDSLSLERIVGTQRAAVLSRAENEVYEFK 716
           SKLD+L+LE +VGTQRA VL   +NE+YEFK
Sbjct: 691 SKLDALALENVVGTQRAGVLCHGQNEIYEFK 721

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/708 (59%), Positives = 525/708 (74%), Gaps = 15/708 (2%)

Query: 9   KRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGXXXXXXXXXXXXXXXV 68
           KRGR +LR+I+R +    RN         +H +ES   +                     
Sbjct: 18  KRGRKELRSIRRPQ----RNKAHE---EPEHLNESSEGEVKNHHNGMQHNEEIANVEEDE 70

Query: 69  GKKRNQVYGALLTILXXXXXXXXXXXXXXXXXXXDAYNASDDEYNVSDKQEIENGLXXXX 128
             KR +VYGALLTIL                   +   +  +E    + +++E+ L    
Sbjct: 71  ENKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKEDSESDVEEDERDEVEQLEDNLARVD 130

Query: 129 XXXXXXXXXXXXXXXXXXXXXXXTDLFDIHFNQVPENVVDKISNGFDNKKIKYVSKKIQL 188
                                   D FD HFNQVPENVVDK+   F  +++KY S K+  
Sbjct: 131 ENPSEDDLSEDADEESDDEQ----DTFDSHFNQVPENVVDKLDAAFKERQLKYKSAKV-- 184

Query: 189 PHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEITNNLLDGKDNLTKLQKS 248
           P  E +  +YSKP++ +    K+E P +  SL SY  K+RL+I N+L    +NLT  Q++
Sbjct: 185 PIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDL--EHENLTSTQRT 242

Query: 249 LVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKDNQRLQENNESEFL 308
           LVDPM QY D+L+EY +Y  DE EYR+LY LH+LNH+YKTRDK+LK+NQR+ +N ++++L
Sbjct: 243 LVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNPDADYL 302

Query: 309 DQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQ 368
           DQGFTRPKVLIVVPTRDTAY V+E II KSG+DQ++KKGKF+ QFFE+SLPPSSKPKSFQ
Sbjct: 303 DQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLPPSSKPKSFQ 362

Query: 369 SIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITENTDKKKKQDDFLSS 428
            +FKGNTNDFFVLG+KFTRKA+KLYSNFYQSD+IICSPLG+ +I ENTDKKK+QDDFLSS
Sbjct: 363 HVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSS 422

Query: 429 IEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYINDQARLFRQTMIF 488
           IEI+I DQLHS+EYQN+SH+M IF+HLN IP+EQHD DF R+R+WYIN+QA+LFRQTMIF
Sbjct: 423 IEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIF 482

Query: 489 TKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADE 548
           TKYVSPTANA+IN KC+N+ GRW+N   +   +SS+GKLGLK+RQIFQR DL   ++ +E
Sbjct: 483 TKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEE 542

Query: 549 PDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQ 608
            DFRFKFF SV++ SI+KSTGYEDGILVYIP+Y+D++RVRNYMKEKTT++FGDINEYS+Q
Sbjct: 543 SDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQ 602

Query: 609 RELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKN 668
           ++LNSNR+LFQQGR KVLLYTERLHH+RRYEIKGVKSV+FY PPTNPEFY+EVVRFI K+
Sbjct: 603 KQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKS 662

Query: 669 AFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEFK 716
           A LG  D+NI+TVR +YSKLD +SLERIVGT+RAA+L+  +NEVYEFK
Sbjct: 663 AALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/717 (59%), Positives = 531/717 (74%), Gaps = 17/717 (2%)

Query: 3   GRGEFKKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGXXXXXXXXXX 62
           G  + KK GR +LRTI R   A  R++  + D      D S   + L             
Sbjct: 16  GYKKAKKTGRKELRTITR---ANARHANESKDDFENEPDMSSEEEELADNKPRSDEEEEE 72

Query: 63  XXXXXVGKKRNQVYGALLTILXXXXXXXXXXXXXXXXXXXDA-YNASDDEYNVSDKQE-I 120
                   K+ +VY ALLT+L                           + Y+  D++E I
Sbjct: 73  DIET----KKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDEDEEEAI 128

Query: 121 ENGLXXXXXXXXXXXXXXXXXXXXXXXXXXXTDLFDIHFNQVPENVVDKISNGFDNKKIK 180
           EN L                            D F++HFN V E    K+++ F +KKI+
Sbjct: 129 ENALVETNDDEDDVGSDINGDEDDEDK----ADSFELHFNNVSELQATKLASAFRDKKIR 184

Query: 181 YVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEITNNLLDGK- 239
           Y  K +++P +E +FFIYS+P V+  +   V +P  K SL SYFIK++L+I NNLLD K 
Sbjct: 185 Y--KSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNLLDDKK 242

Query: 240 DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKDNQRL 299
           + L  LQK+LVDPMFQY D+L+EY +Y   E+EYR+LY LH+LNH+YKTRD++L+++Q+L
Sbjct: 243 EALAPLQKNLVDPMFQYQDLLYEYRSY-EQEEEYRDLYALHVLNHVYKTRDRILRNSQKL 301

Query: 300 QENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFEDSLP 359
           Q+N++ E LDQGFTRPKVLIVVPTRD AY +V  II KSGLDQV+K+GKF+ QFF+ SLP
Sbjct: 302 QDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLP 361

Query: 360 PSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITENTDKK 419
           PSSKPKSF+ IFKGNTNDFFVLG KFTRK LKLYSNFYQSDVI CSPLG+ +I ENTDKK
Sbjct: 362 PSSKPKSFKHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKK 421

Query: 420 KKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYINDQA 479
           K+QDDFLSSIE+ ++DQLHS+EYQN+SHI  IF+H+NKIP++QHDADFSRIRMWYIN+QA
Sbjct: 422 KRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQA 481

Query: 480 RLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRFD 539
            LFRQTM+FTKY SP AN++INGKCRN AGRW+N   +  E+SS+ +LGLK+RQIFQRFD
Sbjct: 482 TLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFD 541

Query: 540 LVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKTTLLF 599
           LVGG+  DEPD+RFKFF SV++ SI+KSTGYEDGIL+YIP+Y+DY+RVRN+++EKTTLLF
Sbjct: 542 LVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLF 601

Query: 600 GDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFYN 659
           GDINEYS+Q++L SNR+LFQQG+VKVLLYTERLHH+RRYEIKGVKSVIFY PPTNPEFY 
Sbjct: 602 GDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYR 661

Query: 660 EVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEFK 716
           EVVR+IGK+AFLG+ D+NI+TVR VY KLD LSLER+VGT+RAAVL+  +NE+YEFK
Sbjct: 662 EVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/721 (58%), Positives = 527/721 (73%), Gaps = 24/721 (3%)

Query: 8   KKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGXXXXXXXXXXXXXXX 67
           KKRGR +LRTI+RS  AK  +S   ++++   ++E +                       
Sbjct: 15  KKRGRQELRTIRRSAGAKV-SSQEVFNSSIVDDEEQE---------LNESNESEQEEDID 64

Query: 68  VGKKRNQVYGALLTILXXXXXXXXXXXXXXXXXXXDAYN-----ASDD--EYNVSDKQEI 120
             +K+N+VYGALLTIL                      +     ASDD  +  + + Q+I
Sbjct: 65  EEEKKNKVYGALLTILKSEHPELKKKKKKRVDDSKSGEDKGSELASDDGKDDEIDEAQQI 124

Query: 121 ENGLXXXXXXXXXXXXXXXXXXXXXXX--XXXXTDLFDIHFNQVPENVVDKISNGFDNKK 178
           E+GL                              D F+ HFNQV E   D ++  F+   
Sbjct: 125 EDGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGS 184

Query: 179 IKYVSKKIQLPHHEKDFFIYSKPIV--DDGNKHKVESPIKKSSLDSYFIKKRLEITNNLL 236
           +KY S K  +  ++    I S P +   +  + + +S  K SS+ SYF+K+RL + N++L
Sbjct: 185 VKYKSTKSVIGDNKT--VISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDML 242

Query: 237 DGK-DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKD 295
           D K D L  LQK LVDPMFQY DIL EY +Y  DE EYR+LY LH LNH+YKTRD++LKD
Sbjct: 243 DSKKDPLGPLQKELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHALNHVYKTRDRILKD 302

Query: 296 NQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFE 355
           N RLQ+N+++E+ DQGFTRPKVLIVVPTRDTAY V+  II KSGLDQV+KKGKF  QF +
Sbjct: 303 NGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHD 362

Query: 356 DSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITEN 415
           ++LPPSSKPKSFQ IFKGNTNDFFVLG+KFTRKA+KLYSNFYQSD+I+CSPLG+ MI EN
Sbjct: 363 ETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVEN 422

Query: 416 TDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYI 475
           TDKK +QDDFLSSIE+ I+DQLHS+EYQN++H+  IF+HLNKIP +QH+ADFSRIRMWYI
Sbjct: 423 TDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYI 482

Query: 476 NDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIF 535
           NDQARLFRQTMIFTKYV+P ANA+IN +CRN AGRW+N   +  E S++ +LGLK++Q F
Sbjct: 483 NDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTF 542

Query: 536 QRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKT 595
           QRFD++GG++ DEPD+RFK F SV++ SI+KST Y DGIL+YIP+Y+DY+R+RNY+KEKT
Sbjct: 543 QRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKT 602

Query: 596 TLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNP 655
           TLLFGDINEYS+QRELNSNRSLFQQGRVKVLLYTERLHHYRRYE+KGVKSV+FY PPTNP
Sbjct: 603 TLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNP 662

Query: 656 EFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEF 715
           EFYNEVVR+IGK+AFLGN D+NI+TVR +Y KLD LSLERIVG++RA +L  A+NEVYEF
Sbjct: 663 EFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEF 722

Query: 716 K 716
           +
Sbjct: 723 Q 723

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/570 (66%), Positives = 476/570 (83%), Gaps = 7/570 (1%)

Query: 153 DLFDIHFN-QVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFF----IYSKPIVDDGN 207
           D FD HFN +      + + N   + K++Y S K+++   ++D      I+S P ++ G 
Sbjct: 132 DPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYIE-GE 190

Query: 208 KHKVESPIKKSSLDSYFIKKRLEITNNLLDGKDN-LTKLQKSLVDPMFQYVDILHEYENY 266
             K+E P  K SL SYF+KKRL I NNLLD + N LT LQ+ +VDPM QY DIL+EY+ Y
Sbjct: 191 TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTY 250

Query: 267 GSDEQEYRELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDT 326
           G DE EYR+LYTLH+LNH+YKTRDK++K+NQ+LQ+N +SEFLDQGFTRPKVLI+ PTRD+
Sbjct: 251 GKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDS 310

Query: 327 AYNVVETIIRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFT 386
           AY +V  +I KSGLDQV+KKGKF+ QF++ S PPSSKPKSFQ IFKGNTND+FVLG+KFT
Sbjct: 311 AYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQHIFKGNTNDYFVLGVKFT 370

Query: 387 RKALKLYSNFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNIS 446
           RKA+KLYSNFYQSD+I+CSPLGL MI ENTDKKK+QDDFLSS+E+TI+DQ HS+EYQN +
Sbjct: 371 RKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYT 430

Query: 447 HIMNIFEHLNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRN 506
           H+  IF+HLNKIP+EQHDADFSRIRMWYINDQA+ FRQTMIFTKY+SP AN+++N KCRN
Sbjct: 431 HLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRN 490

Query: 507 IAGRWRNKIQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILK 566
           + GRW+N   ++SE+SS+G +GLK+RQIFQRF+++G ++ADEPD+RFKFF SVV+++I K
Sbjct: 491 LEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITK 550

Query: 567 STGYEDGILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVL 626
           STGY+DG L+YIP YSDY+RVRNYMKEKT++LFGDINEYS+QR L SNR+LF QGR+KVL
Sbjct: 551 STGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVL 610

Query: 627 LYTERLHHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYS 686
           LYTERLHH+RRYE+KGVK+V+FY PP++PEFY EVVR+IGK  FLG+ D+NI+TVR  YS
Sbjct: 611 LYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYS 670

Query: 687 KLDSLSLERIVGTQRAAVLSRAENEVYEFK 716
           KLD L+LE+IVGT+R  VL+  +NE YEFK
Sbjct: 671 KLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/564 (66%), Positives = 474/564 (84%), Gaps = 3/564 (0%)

Query: 153 DLFDIHFNQVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVE 212
           D  +IHFN V E   + +   F  K+++Y S K+ +  +++  FIYS+P + +     V 
Sbjct: 187 DTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQE--FIYSRPTLVNEPASAVS 244

Query: 213 SPIKKSSLDSYFIKKRLEITNNLLDGKDNLTKLQKSLVDPMFQYVDILHEYENYGSDEQE 272
           +P    SL+SYFIK+RL+I N+LLD +D LT LQK +VDPMFQY D+L+EYE+Y   E E
Sbjct: 245 APDGSQSLNSYFIKQRLKIQNDLLDSQDKLTPLQKQIVDPMFQYQDLLYEYEDYDK-ETE 303

Query: 273 YRELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVE 332
           YR+LY LH+LNH+YKTRD++LK+NQRLQEN + E LDQGFTRPKVLIV PTRD AY+++ 
Sbjct: 304 YRDLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDILS 363

Query: 333 TIIRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKL 392
            II+KSGLDQV+KK KFK QFF+++LPPS KPKSFQ +FKGNTNDFFVLG KFTRK +KL
Sbjct: 364 KIIQKSGLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTIKL 423

Query: 393 YSNFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIF 452
           YSNFYQSD+IICSPLG+ +I ENTDKKK+QDDFLSSIE+ ++DQLHS+E+QN+ H+ +IF
Sbjct: 424 YSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTSIF 483

Query: 453 EHLNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWR 512
           EH+NKIP++QHDADFSRI+MWYINDQA+LFRQT+IFTK+ SP AN++INGKCRN AGRW+
Sbjct: 484 EHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRWK 543

Query: 513 NKIQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYED 572
           N   +  E SSLG+LG++ R IFQRFDLVG ++++EPD RFK F SV++ +I+KSTGYED
Sbjct: 544 NHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYED 603

Query: 573 GILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERL 632
           GIL+YIP+Y+D++RVRNY++EKTT+LFGDINEYS+QR+L SNR++FQQGRVKVLLYTERL
Sbjct: 604 GILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTERL 663

Query: 633 HHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLS 692
           HH+RRYEIKGVK+VIFY PPTNPEF+ EV R++GK+AFLG  D+NI+ VR ++SKLD LS
Sbjct: 664 HHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGLS 723

Query: 693 LERIVGTQRAAVLSRAENEVYEFK 716
           LERIVGT+RAAVL+   NE YEFK
Sbjct: 724 LERIVGTERAAVLTHGPNETYEFK 747

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/716 (56%), Positives = 519/716 (72%), Gaps = 28/716 (3%)

Query: 9   KRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGXXXX--XXXXXXXXXX 66
           K GR QLR I R+   +KR          +++DE+  AD                     
Sbjct: 9   KSGRKQLREITRA--GQKR---------VRYDDEATVADLTPDNESDSDNAEPSVAAERE 57

Query: 67  XVGKKRNQVYGALLTILXXXXXXXXXXXXXXXXXXXDAYNASDDE-----YNVSDKQE-I 120
            V + R Q Y ALLT+L                   D+  A +D       N  D+Q+ I
Sbjct: 58  DVEQHRGQAYNALLTLLKSEHPERKHKSNKKIKK--DSQRAEEDSPENDGINSEDEQQNI 115

Query: 121 ENGLXXXXXXXXXXXXXXXXXXXXXXXXXXXTDLFDIHFNQVPENVVDKISNGFDNKKIK 180
           EN L                           +D F+ HF++  E+ +     GF +K +K
Sbjct: 116 ENALDDVSGGVVDEEDMEDSLSDVDESEDE-SDPFESHFSKYSESRLYAFDKGFKDKTVK 174

Query: 181 YVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEITNNLLDGKD 240
           Y S K  +   E    IYSKP +DD     V+    K +L SYFIK++L++ N+  +   
Sbjct: 175 YKSSKTDVSEEES--LIYSKPCLDDEEVLPVKG---KQTLSSYFIKQKLKLANDFQNNGL 229

Query: 241 NLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKDNQRLQ 300
            LT++QK LVDPMFQY D+L+EY++Y +DE +YR+LY+LH LNH+YKTRD++LK+NQ+LQ
Sbjct: 230 PLTEIQKELVDPMFQYKDMLYEYDDY-ADEDQYRDLYSLHALNHVYKTRDRILKNNQKLQ 288

Query: 301 ENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFEDSLPP 360
           ENN+ E LDQGFTRPKVLIVVPTRD A+ +V  I+ KSGLDQ +KK KF+ QFFEDSLPP
Sbjct: 289 ENNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPP 348

Query: 361 SSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITENTDKKK 420
           +SKPKSFQ IF+GNTNDFFVLGLKFTRK+LK+YSNFYQSD+IICSPLG+ +I ENTDKKK
Sbjct: 349 TSKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKK 408

Query: 421 KQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYINDQAR 480
           +QDDFLSSIE+ I+DQLHS+EYQN  H+  IF+H+NKIP +Q +ADFSRIRMWYIN+QA+
Sbjct: 409 RQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAK 468

Query: 481 LFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRFDL 540
            FRQT++FTKY+SP AN+++NGKCRN+AGRW+N  ++  E+SS+G+LGLK+RQIFQRFDL
Sbjct: 469 FFRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDL 528

Query: 541 VGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKTTLLFG 600
            GGT  DEPD+RFKFF SV++ SI+KSTGYEDGIL+YIP+Y+D++RVRNY+KEKTT++FG
Sbjct: 529 AGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFG 588

Query: 601 DINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFYNE 660
           +INEYS+Q++L SNR+ FQ G+VKVLLYTERLHH+RRYEIK VKSVIFY PP NPEFY+E
Sbjct: 589 EINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSE 648

Query: 661 VVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEFK 716
           VVR IGKN FLGN DINI+TVR +YSK+D LSLER+VG++RAAVL+  +NEVYEFK
Sbjct: 649 VVRNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/568 (66%), Positives = 484/568 (85%), Gaps = 7/568 (1%)

Query: 153 DLFDIHFNQVPENVVDKISNGFDNKKIKYVSKKIQLPH-HEKDFFIYSKPIVDD--GNKH 209
           D F+ HFNQ+ E   +K+   F  K ++Y S K  LP+ H+ + FI+SKP+++   G+  
Sbjct: 144 DPFEYHFNQISEMDTNKLDAAFKEKTVQYESTK--LPYMHDNEGFIFSKPVIEGLKGSDA 201

Query: 210 KVESPIKKSSLDSYFIKKRLEITNNLLDGKDN-LTKLQKSLVDPMFQYVDILHEYENYGS 268
             ++P+ K ++ SYF+KK+L++ N LLD K   LT L K+LVDP+FQY D+L EYE++ S
Sbjct: 202 VNDTPVCKGNIHSYFMKKKLKVHNGLLDDKKKPLTPLSKTLVDPIFQYRDLLFEYEDF-S 260

Query: 269 DEQEYRELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAY 328
            E EYR+LYTLHILNH+YKTRD++LK+N +LQEN++ E LDQGFTRPKVL+V PTR+TAY
Sbjct: 261 QETEYRDLYTLHILNHIYKTRDRILKNNHKLQENDDQELLDQGFTRPKVLVVAPTRNTAY 320

Query: 329 NVVETIIRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRK 388
           +++E II KSGLDQV+KK KFK QF+EDSLPP+SKPKSFQ +FKGNTNDFFVLG+KFTRK
Sbjct: 321 DIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKSFQHVFKGNTNDFFVLGMKFTRK 380

Query: 389 ALKLYSNFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHI 448
            LKLYSNFYQSDVI+CSPLG+ +I ENTDKKK+QDDFLSSIE+ ++DQLHS+E+QN +H+
Sbjct: 381 TLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFLSSIEMLVVDQLHSLEFQNPAHV 440

Query: 449 MNIFEHLNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIA 508
           ++IF+H+NKIP++QHD+DFSRIRMWYINDQARLFRQT+IFTKYVSP AN++INGKC N +
Sbjct: 441 LSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTLIFTKYVSPFANSLINGKCCNWS 500

Query: 509 GRWRNKIQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKST 568
           GR++N+  ++ E+S++ +LGLK+RQ+F RFDL  G+  DEPD+RFKFF SV +  I KST
Sbjct: 501 GRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSVDEPDYRFKFFTSVTVPIIQKST 560

Query: 569 GYEDGILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLY 628
           GYEDGIL+YIP+Y+D++RVRNY K++T +LFG+I EYSDQR++ SNR+LFQQG+VKVLLY
Sbjct: 561 GYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYSDQRQVTSNRALFQQGKVKVLLY 620

Query: 629 TERLHHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKL 688
           TERLHH+RRY+IKGVKSVIFY PP+NPEFY E++R IGKNAFLGN D+NI+TVR  Y KL
Sbjct: 621 TERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIGKNAFLGNADLNISTVRCTYCKL 680

Query: 689 DSLSLERIVGTQRAAVLSRAENEVYEFK 716
           DSLSLERIVG++RAAVL+R++NE+YEFK
Sbjct: 681 DSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/711 (56%), Positives = 515/711 (72%), Gaps = 19/711 (2%)

Query: 8   KKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDE-SKPADALVSGXXXXXXXXXXXXXX 66
           +KRGR  LR+I+R++  K+          ++ + E S+ ++   +               
Sbjct: 16  RKRGRKDLRSIRRARNDKEPVEEPEIPVASEEDGELSEDSEEDATNEVQEQE-------- 67

Query: 67  XVGKKRNQVYGALLTILXXXXXXXXXXXXXXXXXXXDAYNASDDEYNVSDKQEIENGLXX 126
                + + YGALLTIL                      ++SDDE +  +K E+E  L  
Sbjct: 68  ---DSKEKAYGALLTILKSEHPEDRQRERRKKKQDLQDPSSSDDELSEDEKGEVEANLVD 124

Query: 127 XXXXXXXXXXXXXXXXXXXXXXXXXTDLFDIHFNQVPENVVDKISNGFDNKKIKYVSKKI 186
                                       F+ HFN   E++ D +   +  KKI   S KI
Sbjct: 125 TPGEEEPQSEEELSEGDEDESEDERDP-FESHFNMQSESI-DSLDEAWKQKKIVNKSGKI 182

Query: 187 QLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYFIKKRLEITNNLLDGKDN-LTKL 245
           ++   E    IY+K +   G   + E P  K  L SY +K++L+I NNLL+ +D+ LT L
Sbjct: 183 RVDDDES--LIYTKTLA--GKGQEFELPSHKGHLSSYPLKRKLKIQNNLLESQDDVLTPL 238

Query: 246 QKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKDNQRLQENNES 305
           Q+ +VDP+FQY D+L+EYE+Y  DE EYR+LY LH+LNH+YKTRD++LKDNQRL  N + 
Sbjct: 239 QRKIVDPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYKTRDRILKDNQRLATNPDG 298

Query: 306 EFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFEDSLPPSSKPK 365
           EFLDQGFTRPKVLIV PTRDTAY +V  +I KSGLDQV+KK K + QFFED LPPSSKPK
Sbjct: 299 EFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPK 358

Query: 366 SFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITENTDKKKKQDDF 425
           SF+  FKGNTNDFFVLG+KFTRKA++LYSNFYQSD+I+CSPLGL +I ENTD+KK+QDDF
Sbjct: 359 SFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDF 418

Query: 426 LSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYINDQARLFRQT 485
           LSSIE+ I+DQL+S+E+QN+SH+  IF H+NKIP+EQHD DF R+RMWYIN+QA+L RQT
Sbjct: 419 LSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQT 478

Query: 486 MIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRFDLVGGTL 545
           +IFT+YV+PTAN ++NGKCRNI GRW+N  Q+T E+SS+ KLG ++RQIFQR DL G ++
Sbjct: 479 LIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASV 538

Query: 546 ADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKTTLLFGDINEY 605
            DEPD+RF+FF SV++ SI KSTGYEDGIL+YIP+Y+D++RVRNY+K+KTT+LFGDINEY
Sbjct: 539 VDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEY 598

Query: 606 SDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFI 665
           SD R+L S RSLFQQGR+KVLLYTERLHH+RRYEIKGVKSVIFY PP+NPEFYNEVVR+I
Sbjct: 599 SDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYI 658

Query: 666 GKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEFK 716
           GK+AFLG+ D+NI+TVR VYSKLD L+LERIV ++RAAVL+  +NE+YEFK
Sbjct: 659 GKSAFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/565 (65%), Positives = 473/565 (83%), Gaps = 3/565 (0%)

Query: 152 TDLFDIHFNQVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKV 211
           +D  + HFN VPE   D +   F  K+++Y S KI++  +E+  FIYS+P ++  ++  +
Sbjct: 166 SDPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEE--FIYSRPDLNLESRTPI 223

Query: 212 ESPIKKSSLDSYFIKKRLEITNNLLDGKDNLTKLQKSLVDPMFQYVDILHEYENYGSDEQ 271
           + P    SL  YFIK+RL+I N+LLD K+NLT LQK +VDP+FQY D+L+EYENY   E 
Sbjct: 224 QVPQGTQSLSPYFIKQRLKIQNDLLDSKNNLTPLQKKIVDPIFQYQDLLYEYENY-DQET 282

Query: 272 EYRELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVV 331
           EYR+LY LH L+H+YKTRD++LK+NQRLQ+N + E LDQGFTRPKVLIVVPTRD AY+V+
Sbjct: 283 EYRDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVL 342

Query: 332 ETIIRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALK 391
             II KSGLDQV+KK KF+ QF++DSLPP  KPKSFQ +FKGNTNDFFVLG KFTRK +K
Sbjct: 343 SKIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIK 402

Query: 392 LYSNFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNI 451
           LYSNFYQSD+I+CSPLG+ +I ENTDKKK+QDDFLSSIE+ ++DQLHS+E+QN+ H+ +I
Sbjct: 403 LYSNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSI 462

Query: 452 FEHLNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRW 511
           FEH+NKIP++QHDADFSRI+MWYINDQA+LFRQT+IFT++ +P AN++INGKCRN AGRW
Sbjct: 463 FEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRW 522

Query: 512 RNKIQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYE 571
           +N   + +E+SSL +LG++ R +FQRFD+ GG   DEPDFRFK F SV++ +I++STGYE
Sbjct: 523 KNHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYE 582

Query: 572 DGILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTER 631
           DGIL+YIP+Y+D++RVRNY++EKTT+LFGDI+EYS+QR+L +NR+LFQQGRVKVLLYTER
Sbjct: 583 DGILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTER 642

Query: 632 LHHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSL 691
           LHH+RRYEIKGVK+VIFY PPTNPEF+ E VR++ K+AFLG  D+NI+ VR +YSKLD L
Sbjct: 643 LHHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGL 702

Query: 692 SLERIVGTQRAAVLSRAENEVYEFK 716
           +LERIVGT+RAA+L+   NE YEFK
Sbjct: 703 ALERIVGTERAAILTHGPNETYEFK 727

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/567 (64%), Positives = 469/567 (82%), Gaps = 9/567 (1%)

Query: 153 DLFDIHFNQVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVD-DGNKHKV 211
           D FD+HFN+V    V ++   F N + +Y   ++Q     ++  +YSKP+   +G +  V
Sbjct: 144 DHFDVHFNRVSAADVAQLDAAFKNGRAQY---RVQKEARGEEEILYSKPVASSEGTEGPV 200

Query: 212 ESPIKKSSLDSYFIKKRLEITNNLL--DGKDNLTKLQKSLVDPMFQYVDILHEYENYGSD 269
             P +  SL  Y IK+RL + N L   D +  LT  QK L+DPMFQY DIL+EYE Y   
Sbjct: 201 RVPAR--SLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQDILYEYEGYDR- 257

Query: 270 EQEYRELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYN 329
           E+EYRELYTLHILNH+YKTRD++LK+NQ+LQ+N + E LDQGFTRPK L+VVPTR TAY+
Sbjct: 258 EREYRELYTLHILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAYD 317

Query: 330 VVETIIRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKA 389
           VV+ ++++SG++QV+KK KFK QF++ SLPP+SKPKSFQ +FKGNTNDFFVLG+KFTRKA
Sbjct: 318 VVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKA 377

Query: 390 LKLYSNFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIM 449
           ++LYSNFYQSDVI+CSPLGL +I ENTDKKK+QDDFLSSIE+ +LDQLHS+E+QNI+H+ 
Sbjct: 378 IRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVS 437

Query: 450 NIFEHLNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAG 509
           NIF H+NKIP++Q DADFSRIRMWYI DQA+LFRQTM+FT+Y+SP ANA++N KC N AG
Sbjct: 438 NIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWAG 497

Query: 510 RWRNKIQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTG 569
           R ++   +++E+S +G+LGLK+RQIFQRF+++GG+  DEPDFRFKFF SVV+  I K+TG
Sbjct: 498 RVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTG 557

Query: 570 YEDGILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYT 629
           Y+ GIL+YIP Y+D++RVRNY+K+KT +LFGDINEYSDQR+L SNR+LFQ GR+KVLLYT
Sbjct: 558 YDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYT 617

Query: 630 ERLHHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLD 689
           ERLHH+RR+E+KGVKSVI Y PP+NPEFY E++R+IGK+AFLG  D+NIATVR +YSK+D
Sbjct: 618 ERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKMD 677

Query: 690 SLSLERIVGTQRAAVLSRAENEVYEFK 716
           SL+LERIVGT+RAAVL+  +NEVYEFK
Sbjct: 678 SLALERIVGTKRAAVLTHGQNEVYEFK 704

>Kwal_26.7163 s26 (243008..244876) [1869 bp, 622 aa] {ON} YAL016W
           (TPD3) - protein phosphatase 2A regulatory subunit A
           [contig 47] FULL
          Length = 622

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 54/267 (20%), Positives = 115/267 (43%), Gaps = 42/267 (15%)

Query: 252 PMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKDNQRLQENNESEFL--- 308
           P+   +D L ++++ G+  +  ++L T+ +     +TRD+++     + +++E E     
Sbjct: 26  PLALLMDEL-KHDDIGNRVEAMKKLDTIALALGPQRTRDELIPFLTEVAQDDEDEVFAIL 84

Query: 309 --DQGFTRPKV------LIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKS--QFFEDSL 358
               G   P +       +++P+ +   +  ET++R   ++ +    +  S  Q F D +
Sbjct: 85  AEQLGKFVPFIGGAKFATLLLPSLEILASTEETLVRDKAVESLNNVAQELSEDQLFHDFI 144

Query: 359 PP----------SSKPKS---FQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICS 405
           P           SSK  +   F+S+     +D      KF ++ L LY    Q D  +  
Sbjct: 145 PLIEHLATAEWFSSKVSACGLFRSVLARVKDD------KFRKELLALYLQLVQDDTPMVR 198

Query: 406 -------PLGLHMITENTDKKKKQD-DFLSSI-EITILDQLHSMEYQNISHIMNIFEHLN 456
                  P+ + ++T+N D     D D++S + +  + D   S+++  +  +++I +  N
Sbjct: 199 RAAGKNLPVLIDLLTQNPDLSTSDDWDYISGMFQKIVSDTQDSVKFLAVDVLVSILKFFN 258

Query: 457 KIPREQHDADFSRIRMWYINDQARLFR 483
           K     H  D  R  +  I D+A   R
Sbjct: 259 KKNDTTHSKDLLRSAIQLITDEAWRVR 285

>Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON}
           YDR243C (REAL)
          Length = 604

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 72/153 (47%), Gaps = 36/153 (23%)

Query: 483 RQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRFDLVG 542
           RQT++FT  ++P    +  G  R         I + +    L      I+QI +      
Sbjct: 388 RQTLMFTATMTPVIEKIAAGYMRKPV---YATIGVDTGSEPL------IQQIVE------ 432

Query: 543 GTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNY---SDYMRVRNYMKE---KTT 596
              AD  + +FK   S+V       T YE  I+++I NY   +D++  R + KE   + T
Sbjct: 433 --YADNEEQKFKKLKSIV-------TKYEPPIIIFI-NYKQTADWLAER-FQKETNMRVT 481

Query: 597 LLFGDINEYSDQRELNSNRSLFQQGRVKVLLYT 629
           +L G  ++  +QRE   +  LF+ GRV+V++ T
Sbjct: 482 ILHG--SKSQEQRE--HSLQLFRSGRVQVMIAT 510

>TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 540
           aa] {ON} Anc_2.164 YNL112W
          Length = 540

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 6/109 (5%)

Query: 571 EDGILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTE 630
           E  ILV+         +  Y++E        I+   DQRE +   + F++GR  +++ T+
Sbjct: 360 ESKILVFASTKRTCDEITKYLREDGWPALA-IHGDKDQRERDWVLAEFREGRSPIMVATD 418

Query: 631 RLHHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIA 679
                R  ++KG+  VI Y  P N E Y   V  IG+    G     I+
Sbjct: 419 VAA--RGIDVKGINYVINYDMPGNIEDY---VHRIGRTGRAGATGTAIS 462

>CAGL0J10230g Chr10 complement(1000573..1002204) [1632 bp, 543 aa]
           {ON} similar to uniprot|P32048 Saccharomyces cerevisiae
           YNL073w MSK1
          Length = 543

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 56/135 (41%), Gaps = 12/135 (8%)

Query: 166 VVDKISNGFDNKKIKY-VSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSLDSYF 224
           VVD   NGF N +I+  + K I+    E+DF     PI+   +   V  P   SS D  F
Sbjct: 191 VVDYQINGFQNIRIRSSILKSIRNFLEERDFIEVETPILSSKSNGAVAKPFMSSSKD--F 248

Query: 225 IKKRLEITNNLLDGKDNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNH 284
            K  L +   L         L++ ++    +  +I   + N G D     E  TL     
Sbjct: 249 DKLMLRVAPELW--------LKRLIISGCNKVFEIGKSFRNEGIDGSHNPEFTTLEFYQS 300

Query: 285 LYKTRDKVLKDNQRL 299
            Y T + ++K N+ L
Sbjct: 301 -YLTMEDLIKLNEDL 314

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,016,281
Number of extensions: 3529297
Number of successful extensions: 11855
Number of sequences better than 10.0: 69
Number of HSP's gapped: 12255
Number of HSP's successfully gapped: 75
Length of query: 716
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 599
Effective length of database: 40,065,477
Effective search space: 23999220723
Effective search space used: 23999220723
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)