Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C047908.843ON55655624380.0
Kpol_541.168.843ON52850414010.0
Suva_13.4678.843ON54347813890.0
NDAI0K004008.843ON55348413890.0
YMR279C8.843ON54047513880.0
Skud_13.4518.843ON53947813870.0
TBLA0D032708.843ON55048913870.0
Smik_13.4928.843ON54348613700.0
KNAG0J002608.843ON55049713560.0
Skud_13.258.843ON53747813540.0
TDEL0B005508.843ON53748413490.0
YML116W (ATR1)8.843ON54248213480.0
NCAS0A02540singletonON53951313421e-180
NDAI0E002808.843ON54948613391e-180
Smik_13.188.843ON54548613351e-179
KAFR0B039408.843ON54747813271e-178
KLTH0C03806g8.843ON52550713211e-178
NCAS0C004008.843ON51751413181e-177
Suva_13.278.843ON55348513191e-177
CAGL0B02343g8.843ON53748113151e-176
SAKL0D01386g8.843ON52147813081e-176
KNAG0G034308.843ON54248613071e-175
NCAS0B002908.843ON54248313031e-175
Kwal_27.102458.843ON51547712971e-174
TBLA0D03280singletonON58048012961e-173
CAGL0M03003g8.843ON55848612631e-168
KAFR0B03930singletonON55546912631e-168
KAFR0A028408.843ON52051311931e-158
TBLA0C01160singletonON60051811681e-153
Smik_15.560na 1ON5164917557e-93
Suva_8.435na 1ON5154787548e-93
YOR378Wna 1ON5154927496e-92
Skud_15.545na 1ON5164847331e-89
KLTH0C10560gna 1ON5154887313e-89
KLLA0B00352gna 1ON4984557042e-85
Kwal_23.6547na 1ON5114827033e-85
TDEL0G04950singletonON5124776101e-71
KNAG0D00130na 1ON5654654626e-50
SAKL0C06116gsingletonON1851333928e-44
KAFR0C04860na 1ON5344714106e-43
NCAS0A05720na 1ON5634753889e-40
CAGL0L02519gna 1ON5295033782e-38
NDAI0K02730singletonON6045433441e-33
Smik_13.2722.473ON5611981412e-08
Skud_13.2442.473ON5621651393e-08
YMR088C (VBA1)2.473ON5621651332e-07
Smik_6.24na 2ON5445071322e-07
Suva_13.2652.473ON5611961313e-07
KLLA0C18931gna 3ON5531491199e-06
AGR076C8.272ON6862951181e-05
NCAS0A078102.473ON5681681162e-05
Kwal_34.15746na 3ON5181441134e-05
Suva_10.11singletonON5402121135e-05
SAKL0A08228gsingletonON5691491126e-05
ZYRO0C01430g8.272ON5902831127e-05
CAGL0B02079gna 4ON6241781127e-05
NDAI0H022002.473ON5711481101e-04
SAKL0E02992g2.473ON5701041101e-04
KLLA0F13684g2.473ON5711031101e-04
TDEL0G03260singletonON6121451091e-04
CAGL0J01375g2.473ON5641681082e-04
TDEL0A024902.473ON554931072e-04
SAKL0F00440gsingletonON5444591072e-04
KLTH0H16214gsingletonON5511281045e-04
ABL040W2.473ON5672301037e-04
YKR105C (VBA5)singletonON5821601029e-04
TBLA0F030408.272ON9063161010.001
Kpol_467.242.473ON370145990.002
SAKL0C05588gsingletonON677143990.002
KLTH0D16962gsingletonON571149980.003
Skud_6.16na 2ON549201980.003
SAKL0A00726gsingletonON598148950.006
Ecym_73992.473ON563160940.008
KLTH0C10120gsingletonON651150940.009
ZYRO0G03234g2.473ON56293930.011
KLTH0G19668gsingletonON508121920.012
TDEL0F039908.272ON631196930.013
Smik_11.368singletonON580179920.014
SAKL0C02178gsingletonON56582920.016
TDEL0D06570singletonON566234910.018
NCAS0C03460na 4ON630149910.019
Kpol_1048.458.570ON648146900.023
KLTH0G13464g8.272ON593280900.027
YGR224W (AZR1)na 4ON613147900.028
KLTH0C10142gsingletonON573150890.036
ACL172C3.245ON631193890.037
Smik_16.81na 4ON625147880.041
TPHA0G031502.473ON60065880.042
KLLA0A04631g8.272ON579100880.047
TDEL0D06610singletonON497100870.056
Kwal_26.6697singletonON577209870.059
YPR198W (SGE1)singletonON543157860.068
Kwal_27.12832singletonON508118860.073
KNAG0A035408.570ON538162860.077
Skud_7.560na 4ON642150830.16
YCR098C (GIT1)na 5ON518129830.17
KLLA0E24113g8.570ON575104830.19
Smik_3.200na 5ON518164820.21
KAFR0B00180singletonON530127820.24
SAKL0E04246gna 6ON56577810.28
Skud_16.503singletonON543153810.28
Smik_17.11singletonON544155810.30
SAKL0H16808g8.272ON65779810.32
Kwal_14.782na 7ON491113800.34
Skud_3.172na 5ON521129800.35
KLTH0E16720gsingletonON574206800.36
Kpol_543.448.272ON64379800.39
ZYRO0G00352gsingletonON494109800.40
Skud_18.3singletonON59066800.41
TPHA0C018608.469ON60747790.47
KAFR0C063005.227ON512120790.58
KLTH0B00594gsingletonON618147790.58
Kpol_1045.38.783ON518176770.77
Skud_2.423na 8ON560176770.89
KNAG0K01020singletonON599154770.93
KLTH0E03234gsingletonON521115770.94
ZYRO0E10230gsingletonON558188761.3
KLTH0B10054gsingletonON503113761.3
KLTH0E00462gsingletonON503113761.3
SAKL0F16478gsingletonON495126751.5
SAKL0B12716gsingletonON632143751.8
KLTH0D05434g2.473ON57661732.5
KAFR0I007108.570ON575142732.7
KLLA0F17776gna 6ON553103733.1
Suva_4.553na 8ON562169733.1
ZYRO0A00330gsingletonON57670723.2
CAGL0M06281g8.570ON542142723.4
Smik_2.434na 8ON474154723.5
NCAS0G029902.242ON581205723.7
NDAI0D017504.291aON564200724.1
ZYRO0E09988gsingletonON548138714.3
Kwal_26.77552.473ON55960714.4
TBLA0A01270singletonON522172714.5
NDAI0I020205.227ON444115714.6
TBLA0B044808.570ON608158715.1
Suva_14.4na 5ON518129705.8
Ecym_42988.272ON67890706.0
NCAS0D04970na 9ON58280706.4
KAFR0H017008.446ON64552707.0
Kwal_47.16586singletonON50293697.3
YBR293W (VBA2)na 8ON474154697.4
ZYRO0G15422gsingletonON542202697.5
Kwal_56.24353na 10ON58279697.6
ZYRO0E09966gsingletonON561129698.1
SAKL0D04510gna 11ON53186698.5
Skud_18.6singletonON61058698.8
TDEL0D02340singletonON501169698.9
TBLA0A014201.451ON572136699.0
SAKL0H09328g8.570ON596141699.0
TDEL0D038003.245ON640187689.7
KAFR0F040904.212ON58784689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C04790
         (556 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   943   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   544   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   539   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               539   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   539   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   538   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   538   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   532   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   526   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   526   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   524   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   523   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   521   e-180
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      520   e-180
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   518   e-179
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   515   e-178
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   513   e-178
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      512   e-177
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   512   e-177
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   511   e-176
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   508   e-176
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   508   e-175
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      506   e-175
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   504   e-174
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   503   e-173
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   491   e-168
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   491   e-168
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   464   e-158
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   454   e-153
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   295   7e-93
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   295   8e-93
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   293   6e-92
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   286   1e-89
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   286   3e-89
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   275   2e-85
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   275   3e-85
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   239   1e-71
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   182   6e-50
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   155   8e-44
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     162   6e-43
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            154   9e-40
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   150   2e-38
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   137   1e-33
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    59   2e-08
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    58   3e-08
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    56   2e-07
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    55   2e-07
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    55   3e-07
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    50   9e-06
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    50   1e-05
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    49   2e-05
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    48   4e-05
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    48   5e-05
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    48   6e-05
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    48   7e-05
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    48   7e-05
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    47   1e-04
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    47   1e-04
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    47   1e-04
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               47   1e-04
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    46   2e-04
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    46   2e-04
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    46   2e-04
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    45   5e-04
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    44   7e-04
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    44   9e-04
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    44   0.001
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    43   0.002
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    43   0.002
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    42   0.003
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    42   0.003
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    41   0.006
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    41   0.008
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    41   0.009
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    40   0.011
KLTH0G19668g Chr7 (1702771..1704297) [1527 bp, 508 aa] {ON} weak...    40   0.012
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    40   0.013
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    40   0.014
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    40   0.016
TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa] ...    40   0.018
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    40   0.019
Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON} (1178...    39   0.023
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    39   0.027
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    39   0.028
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    39   0.036
ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON} Syn...    39   0.037
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    39   0.041
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    39   0.042
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    39   0.047
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    38   0.056
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...    38   0.059
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    38   0.068
Kwal_27.12832 s27 (1393503..1395029) [1527 bp, 508 aa] {ON} YGR2...    38   0.073
KNAG0A03540 Chr1 (450487..452103) [1617 bp, 538 aa] {ON} Anc_8.5...    38   0.077
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    37   0.16 
YCR098C Chr3 complement(297049..298605) [1557 bp, 518 aa] {ON}  ...    37   0.17 
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    37   0.19 
Smik_3.200 Chr3 complement(296300..297856) [1557 bp, 518 aa] {ON...    36   0.21 
KAFR0B00180 Chr2 complement(43943..45535) [1593 bp, 530 aa] {ON}       36   0.24 
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    36   0.28 
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    36   0.28 
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    36   0.30 
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    36   0.32 
Kwal_14.782 s14 (42720..44195) [1476 bp, 491 aa] {ON} YGR260W (T...    35   0.34 
Skud_3.172 Chr3 complement(280981..282546) [1566 bp, 521 aa] {ON...    35   0.35 
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...    35   0.36 
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    35   0.39 
ZYRO0G00352g Chr7 (27042..28526) [1485 bp, 494 aa] {ON} weakly s...    35   0.40 
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    35   0.41 
TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.4...    35   0.47 
KAFR0C06300 Chr3 complement(1266085..1267623) [1539 bp, 512 aa] ...    35   0.58 
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    35   0.58 
Kpol_1045.3 s1045 (4998..6554) [1557 bp, 518 aa] {ON} (4998..655...    34   0.77 
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...    34   0.89 
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    34   0.93 
KLTH0E03234g Chr5 complement(293162..294727) [1566 bp, 521 aa] {...    34   0.94 
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    34   1.3  
KLTH0B10054g Chr2 complement(839166..840677) [1512 bp, 503 aa] {...    34   1.3  
KLTH0E00462g Chr5 (45358..46869) [1512 bp, 503 aa] {ON} weakly s...    34   1.3  
SAKL0F16478g Chr6 (1357813..1359300) [1488 bp, 495 aa] {ON} weak...    33   1.5  
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    33   1.8  
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    33   2.5  
KAFR0I00710 Chr9 (139612..141339) [1728 bp, 575 aa] {ON} Anc_8.5...    33   2.7  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    33   3.1  
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    33   3.1  
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    32   3.2  
CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} simil...    32   3.4  
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    32   3.5  
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    32   3.7  
NDAI0D01750 Chr4 complement(407496..409190) [1695 bp, 564 aa] {O...    32   4.1  
ZYRO0E09988g Chr5 (796142..797788) [1647 bp, 548 aa] {ON} simila...    32   4.3  
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...    32   4.4  
TBLA0A01270 Chr1 complement(300796..302364) [1569 bp, 522 aa] {O...    32   4.5  
NDAI0I02020 Chr9 (470494..471828) [1335 bp, 444 aa] {ON} Anc_5.227     32   4.6  
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    32   5.1  
Suva_14.4 Chr14 (4495..6051) [1557 bp, 518 aa] {ON} YCR098C (REAL)     32   5.8  
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    32   6.0  
NCAS0D04970 Chr4 (952902..954650) [1749 bp, 582 aa] {ON}               32   6.4  
KAFR0H01700 Chr8 complement(314217..316154) [1938 bp, 645 aa] {O...    32   7.0  
Kwal_47.16586 s47 (13925..15433) [1509 bp, 502 aa] {ON} YGR260W ...    31   7.3  
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    31   7.4  
ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} simi...    31   7.5  
Kwal_56.24353 s56 (964777..966525) [1749 bp, 582 aa] {ON} YAL067...    31   7.6  
ZYRO0E09966g Chr5 (793128..794813) [1686 bp, 561 aa] {ON} simila...    31   8.1  
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    31   8.5  
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    31   8.8  
TDEL0D02340 Chr4 (455204..456709) [1506 bp, 501 aa] {ON}               31   8.9  
TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.4...    31   9.0  
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    31   9.0  
TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.2...    31   9.7  
KAFR0F04090 Chr6 complement(797919..799682) [1764 bp, 587 aa] {O...    31   9.9  

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  943 bits (2438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/556 (85%), Positives = 475/556 (85%)

Query: 1   MDSXXXXXXXXXXXSTYEIGRXXXXXXXXXXXXXQKIDSSEQVVPTDSEKYFATVRXXXX 60
           MDS           STYEIGR             QKIDSSEQVVPTDSEKYFATVR    
Sbjct: 1   MDSKNNNNKAAIAASTYEIGRSDSDSDNSTVNSSQKIDSSEQVVPTDSEKYFATVRSSES 60

Query: 61  XXXXXQKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLF 120
                QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLF
Sbjct: 61  LSVSSQKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLF 120

Query: 121 ASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQ 180
           ASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQ
Sbjct: 121 ASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQ 180

Query: 181 GLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWP 240
           GLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWP
Sbjct: 181 GLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWP 240

Query: 241 WTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDG 300
           WTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSA        FSFVWNQAPMDG
Sbjct: 241 WTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDG 300

Query: 301 WDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIW 360
           WDKAY             AFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIW
Sbjct: 301 WDKAYIIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIW 360

Query: 361 SFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMG 420
           SFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGF               TGFTMG
Sbjct: 361 SFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMG 420

Query: 421 NLIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVN 480
           NLIFAVTPADQTYWRNTF            SFPASSIILSDQLPPEYQGMAGSLVNTMVN
Sbjct: 421 NLIFAVTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVN 480

Query: 481 YSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKE 540
           YSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKE
Sbjct: 481 YSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKE 540

Query: 541 KTKLANDIESSIERTG 556
           KTKLANDIESSIERTG
Sbjct: 541 KTKLANDIESSIERTG 556

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/504 (51%), Positives = 335/504 (66%)

Query: 40  SEQVVPTDSEKYFATVRXXXXXXXXXQKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSM 99
           +E+ + +D                  + P YF+S   E+AFIF+C++ QLLN AGTTQ++
Sbjct: 17  AEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQTL 76

Query: 100 SIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSI 159
           SIMN++     S  S + WL ASFPLVSGSFILV GR GDIYGLKKML+LGY IL IWS+
Sbjct: 77  SIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWSL 136

Query: 160 ICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPL 219
           I GL+ Y+HS  FFI+A+AFQGLG+S +LPN++GL+G IY+PG++KKN+ IS +GAM+P+
Sbjct: 137 ITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSPI 196

Query: 220 GATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGS 279
           GAT GGLFSG+V  + + +WPW FYA+ + +F+     Y+ +P+N+PTN N L MDWIGS
Sbjct: 197 GATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIGS 256

Query: 280 AXXXXXXXXFSFVWNQAPMDGWDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITG 339
                    F+FVWNQAP DGW+ AY             AF IYE+ YAE PLLP  I  
Sbjct: 257 FTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEIIR 316

Query: 340 NRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGF 399
           NR +IMIL A+  GWG+FGIW+FYYFSF LNLR++SP+W GG+YF F++SG   A   GF
Sbjct: 317 NRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCGF 376

Query: 400 XXXXXXXXXXXXXXXTGFTMGNLIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPASSIIL 459
                           GF +G +IF+VTP  QTY+RN              SFPASSIIL
Sbjct: 377 LMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSIIL 436

Query: 460 SDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIG 519
           SD LP ++QGMAGSLVNT++NYS S  LG+A TVE+  N +G DLL+GYR A Y G+   
Sbjct: 437 SDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIACS 496

Query: 520 TLGISIASLYMFETFWTDYKEKTK 543
            + + IA LYM ET +  YK++ +
Sbjct: 497 GVAVLIAGLYMVETIFDSYKDRKE 520

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/478 (54%), Positives = 333/478 (69%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YFSS   E  FI TC++ QLLNQAG T +++IMN++++ F SE+ KQAWL ASFPL
Sbjct: 58  QDPTYFSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPL 117

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           V+GSFIL+ GR GDIYGLKKML++GY  + +WS+ICGL+ Y+++D FFI  +AFQGLG++
Sbjct: 118 VAGSFILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIA 177

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           FILPN++GLVG +Y+ GS +KN+ ISFIGA AP G  FGGLF G++V +D + WPW FYA
Sbjct: 178 FILPNVMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYA 237

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           FAI  FL  +  ++ +P+N+PTN +   MDW GS         F+FVWNQAP  GW  AY
Sbjct: 238 FAIAFFLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAY 297

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                        AFF+YE+ YA+VPLLP A+T NRH+IMILLA+F+GWG+FGIW+FYY 
Sbjct: 298 IIALLIISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYM 357

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
           SF LNLRH+SPVWTGG YF F++ G   A  V                   F +G+++F+
Sbjct: 358 SFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFS 417

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           V P  Q++W+  F            SFPASSIILSD LP EYQGMAGSLVNT++NYS S 
Sbjct: 418 VLPVKQSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASL 477

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTK 543
           CLG+  TVE QIN +G DLLKGYR A Y GVG+ +LG+ I+  YM ETFW + +++ K
Sbjct: 478 CLGMGATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDRQK 535

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/484 (54%), Positives = 331/484 (68%), Gaps = 2/484 (0%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YFSS   E+ F+ TC++  LLNQAG +Q +S MN+I++ F S T  Q WL ASFPL
Sbjct: 64  QNPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPL 123

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           VSGSFIL+ GR GDIYGLK+M++ G+  + IWS+ICG T+Y HSD FFIVA+AFQGLG+S
Sbjct: 124 VSGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGIS 183

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           FILPN++GLVG IY+ G+++KN+ IS IG MAP G+ FG L+ G++V ++ K WPW FYA
Sbjct: 184 FILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYA 243

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           +A+ + +  V  Y+ VPDN+PTN N   MDWIGS         F+FVWNQ P+ GW+KAY
Sbjct: 244 YAVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAY 303

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                        AFF+YEI YA+VPLLPKA+T N HI+ IL  +F+GWG+FGIW+FYYF
Sbjct: 304 IIVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYF 363

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
           +F LNLR +SPVW+GG +F FI+ G   A+ V                  GFT G++I +
Sbjct: 364 AFQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMS 423

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           VTP  QTYWRNTF             FPASSIILSD LP +YQGMA SLVNT+VNYS S 
Sbjct: 424 VTPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSL 483

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545
           CLG+ TTVE+QIN SGDDLLKGYRAA Y GVGI  LG  IA L +    W+  K   K  
Sbjct: 484 CLGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWS--KRNAKDP 541

Query: 546 NDIE 549
            D++
Sbjct: 542 KDLQ 545

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/475 (55%), Positives = 333/475 (70%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YFSS   E  FI TC++ QLLNQAG T ++ IMN++++ F SE + QAWL ASFPL
Sbjct: 58  QDPTYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPL 117

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
            +GSFIL+ GR GDIYGLKKML++GY I+ +WSII GL+ Y++SD FFI ++AFQG+G++
Sbjct: 118 AAGSFILISGRLGDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIA 177

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           FILPNI+GLVG +Y+ GS +KNI ISFIGA AP G  FGGLF G++V +D   WPW FYA
Sbjct: 178 FILPNIMGLVGHVYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYA 237

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           F I +FL  +  ++ +P+NVPTN + L MDW GSA        F+FVWNQAP+ GWDK Y
Sbjct: 238 FGIATFLSLLMAWYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPY 297

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                        AFF+YE  YAEVPLLP+A+T NRH+IMILLA+F+GWG+FGIW+FYY 
Sbjct: 298 IIVLLIISVIFLVAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYV 357

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
           SF LNLRH+SPVWTGG YF F++ G   A  V F                 F  G+++F+
Sbjct: 358 SFQLNLRHYSPVWTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFS 417

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           V P +Q+YW+  F            SFPASSIILSD LP +YQGMAGSLVNT++NYS S 
Sbjct: 418 VLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASL 477

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKE 540
           CLG+  TVE QIN SG+DLLKGYRAA Y GVG+ +LG+ I+  YM E  W  +++
Sbjct: 478 CLGMGGTVEHQINKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRK 532

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/478 (53%), Positives = 334/478 (69%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YFSS   E  FI TC++ QLLNQAG T ++ IMN++++ FGSE++ QAWL ASFPL
Sbjct: 57  QDPTYFSSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPL 116

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
            +GSFIL+ GR GDIYGLKKML++GY I+ +WSII GL+ Y+++D FFI  +AFQG+G++
Sbjct: 117 AAGSFILISGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIA 176

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           FILPNI+GLVG +Y+ GS++KN+ IS IGA  P GA FGG+F G++V +D   WPW FYA
Sbjct: 177 FILPNIMGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYA 236

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           F I +F+  +  ++ +P+NVPTN + L MDW GS         F+FVWN+AP+ GWDKAY
Sbjct: 237 FGIATFISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAY 296

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                        AFF+YEI YAEVPLLP A+T NRH+IMILLA+F+GWG+FGIW+FYY 
Sbjct: 297 IIVLLVVSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYV 356

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
           SF LNLRH+SPVWTGG YF F + G   A  V F                 F  G+++F+
Sbjct: 357 SFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFS 416

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           V P +Q+YW+  F            SFPASSIILSD LP +YQGMAGSLVNT++NYS S 
Sbjct: 417 VLPVEQSYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASL 476

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTK 543
           CLG+  TVE QIN SG ++L+GYRAA Y G+G+ +LG+ I+  YM ET W + K+  +
Sbjct: 477 CLGMGATVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKKCQR 534

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/489 (52%), Positives = 336/489 (68%), Gaps = 4/489 (0%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YF +K  E+ FIF+ ++GQLL+QAG TQ++SIMN++A++  S +S+QAWL +SFPL
Sbjct: 63  QNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPL 122

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
             GSFILV GR GDIYGLKK+LL GY I T+WSIICGL+ Y H+D FFI A+AFQGLG++
Sbjct: 123 ALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLA 182

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           F LPN+IGL+GTIY PG  +KN+ IS IGAM+P GAT GGLF+G+ V  D  NWPW+FYA
Sbjct: 183 FALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFYA 242

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           F ++SF+  +  ++ +P+++PTN + LKMDW+GS          +FV+NQAP+ GW  AY
Sbjct: 243 FGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAY 302

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                         F +YE+ YA+ PL+PKAI+ NR ++MIL ++F GWG+FGIW+FYYF
Sbjct: 303 IIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYF 362

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
           SF LNLRH+SP+W G +YF F++SG T+A   G                 GF  GN+IFA
Sbjct: 363 SFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFA 422

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
            TP +QT++RN              SFPASSIILSD LP +YQGMAGSLVNT++NYS S 
Sbjct: 423 ATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSI 482

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYK---EKT 542
           CLG+A TVE + NS G DLL GYRAA Y  +G+  L + ++  YM E  W D     E+ 
Sbjct: 483 CLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDRVLSLEEN 542

Query: 543 KLANDIESS 551
           K   DIESS
Sbjct: 543 K-QTDIESS 550

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/486 (54%), Positives = 340/486 (69%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YFSS   E  FI TC++ QLLNQAG T ++ IMN++++ F SE++ QAWL ASFPL
Sbjct: 58  QDPIYFSSFGKELMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPL 117

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
            +GSFIL+ GR GDIYGLKKMLL+GY I+ IWSII GL+ Y++SD FFI  +AFQGLG++
Sbjct: 118 AAGSFILISGRLGDIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIA 177

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           FILPNI+GLVG +Y+ GS++KN+ IS IGA AP G  FGG+F G++V +D + WPW FYA
Sbjct: 178 FILPNIMGLVGHVYKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYA 237

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           F+I +F+  +  ++ +P+NVPTN + L MDW GS         F+FVWNQAP+ GW +AY
Sbjct: 238 FSIATFISLLMAWYSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAY 297

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                        AFF+YEI YAEVPLLP A+T NRH+IMILLA+F+GWG+FGIW+FYY 
Sbjct: 298 IIVLLILSVFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYV 357

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
           SF LNLRH+SPVWTGG YF F++ G   A  V F                 F  G+++F+
Sbjct: 358 SFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFS 417

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           V P +Q+YW+  F            SFPASSIILSD LP +YQGMAGSLVNT++NYS S 
Sbjct: 418 VLPVEQSYWKLNFAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASL 477

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545
           CLG+  TVE+QIN SG +LLKGYRAA Y G+G+ +LG+ I+  YM E FW  +KE  K  
Sbjct: 478 CLGMGVTVERQINKSGQNLLKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKESEKKR 537

Query: 546 NDIESS 551
            + E+S
Sbjct: 538 LEAETS 543

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/497 (50%), Positives = 326/497 (65%)

Query: 39  SSEQVVPTDSEKYFATVRXXXXXXXXXQKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQS 98
             ++   T+SE  + +           Q P YF+++  E+AFI TC++ QLLNQAG  Q+
Sbjct: 36  EEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMLAQLLNQAGQAQA 95

Query: 99  MSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWS 158
            + MNI+A+ F S   KQ WL ASFPLVSGSFILV GR GDIYGLKK L+ GY ++ IWS
Sbjct: 96  TAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWS 155

Query: 159 IICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAP 218
           +ICG  +YTH+D FFI+ +AFQGLG++FILPN++GL+G IY+  +++KN  ISF+G  AP
Sbjct: 156 LICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAP 215

Query: 219 LGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIG 278
           +GA  GG++SG++  ++ K WPW FYA+AIV  +  V   + +P  VPTN +   MDW G
Sbjct: 216 IGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTG 275

Query: 279 SAXXXXXXXXFSFVWNQAPMDGWDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLPKAIT 338
           SA        F+FVWNQ P+DGW+K Y             AFFIYEI +A+ PLLP  + 
Sbjct: 276 SAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVI 335

Query: 339 GNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVG 398
            NRHI MILLA+FMGWG+FGIW+FYY++F LNLRH+S VW GG +F F++ G   A  V 
Sbjct: 336 KNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVA 395

Query: 399 FXXXXXXXXXXXXXXXTGFTMGNLIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPASSII 458
                           TGFT+G ++ +VTP  Q+YW+               SFPASSII
Sbjct: 396 LTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSII 455

Query: 459 LSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGI 518
           LSD LP +YQGMAGSLVNTMVNYS S CLGV +T E Q+N +G D LKGYRAA Y G+G+
Sbjct: 456 LSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGL 515

Query: 519 GTLGISIASLYMFETFW 535
           G  G+ +A  Y+FE  W
Sbjct: 516 GACGMLVAFCYLFEVLW 532

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/478 (51%), Positives = 320/478 (66%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YF +  HE+ FIFTC++ QLLNQAGTTQ++SIMNIIA  FGS  + + WL ASFPL
Sbjct: 58  QNPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPL 117

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           VSGSFIL+ GR GDIYGLKKML +GY ++ IWS+ICGLT Y+ SD FFI+++AFQGLG++
Sbjct: 118 VSGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIA 177

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           F+LPN++G++G IY  G+ +KNI IS +GAMAP+GAT G LF+G++  K+ K WPW FYA
Sbjct: 178 FVLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYA 237

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           + I S +      + +P+N+PTN  +  MDWIGSA         +FVWNQAP+ GWD+AY
Sbjct: 238 YTITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAY 297

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                         F IYE  +A+ PLLP+A+  +RH+I I+LA+F GWG+FGI++FYYF
Sbjct: 298 IIVLLVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYF 357

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
            F LN+RH+S VW GG YF F++ G   A  VG                  F +G+++ +
Sbjct: 358 QFQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMAS 417

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           VTP  +TY+R               SFPASSII SD LP EYQGMAGSLVNT+VNYS S 
Sbjct: 418 VTPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSL 477

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTK 543
           CLG+  TVE  ++  G  +LKGYR A Y G+G+ +L   I+ LYM E    D+K K +
Sbjct: 478 CLGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKAR 535

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/484 (50%), Positives = 329/484 (67%), Gaps = 2/484 (0%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YF  K  E  F+ +C+MGQLLNQAG+T ++S M ++  +  S ++K +WL ASFPL
Sbjct: 52  QDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSSWLMASFPL 111

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           VSGSFIL+ GR GDIYGLKKMLLLGY  LTIWS+ICGL+ ++H+D FFI ++AFQGLG+S
Sbjct: 112 VSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGIS 171

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           F+LPN++G+VG IY+PG+ +KNI IS IG  AP+GATFGGLF+G+VV++ D +WPW FYA
Sbjct: 172 FVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYA 231

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           + I +FL  +  YF +P+++P N N   MDWIGSA        F+FVWNQ+ + GW   Y
Sbjct: 232 YTIAAFLTTIISYFVIPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGY 291

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                         FFI+EI YA+VPLLPK +T +R IIMIL ++  GWG+FGIW FYYF
Sbjct: 292 IIALLIVSIFLIALFFIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYF 351

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
            F L LR++SPVW GG +F   + G   A  VGF                 FT G++I +
Sbjct: 352 QFVLTLRNYSPVWAGGTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILS 411

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           VTP  +TY+R+              SFPA+SIILSD+L  +YQGMAGSLVNT+VNYS S 
Sbjct: 412 VTPVHETYFRSCLGAMVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSL 471

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545
            LG+  T+E+QIN SGD LL+G+RAA Y  +G+G+LGI I+ +++ +      + K++  
Sbjct: 472 FLGIGGTIERQINKSGDRLLEGFRAALYFAIGVGSLGILISGVFVLQK--ELMRSKSRKE 529

Query: 546 NDIE 549
           N++E
Sbjct: 530 NELE 533

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/482 (50%), Positives = 327/482 (67%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YF     E+ FIFTC++ QLLNQAGTTQ++SIMNI+++ FGSE + ++WL ASFPL
Sbjct: 57  QNPNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPL 116

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           VSGSFIL+ GR GDIYGLKKMLL+GY ++ IWS+ICG+T Y+ SD FFI+++AFQGLG++
Sbjct: 117 VSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIA 176

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           F+LPN++G++G IY  G+ +KNI ISF+GAMAP+GAT G LF+G++  +D K WPW FYA
Sbjct: 177 FVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYA 236

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           ++I +F+  V   + +P  +PTN ++  MDWIGS          +FVWNQAP+ GW++AY
Sbjct: 237 YSIAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAY 296

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                         F IYEI +A+ PLLP+A+  +RH+I I+LA+F GWG+FGI++FYYF
Sbjct: 297 IIVILIISVIFLVVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYF 356

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
            F LN+R ++ +W GG YF F++ G   A  VGF                 F +G+++ +
Sbjct: 357 QFQLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMAS 416

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           VTP  +TY+R               SFPASSII SD LP EYQGMAGSLVNT+VNYS S 
Sbjct: 417 VTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSL 476

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545
           CLG+  TVE Q+NS G  LLKGYR A Y G+G+ +L   I+ LYM E+F    + +    
Sbjct: 477 CLGMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAE 536

Query: 546 ND 547
            D
Sbjct: 537 YD 538

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  521 bits (1342), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 256/513 (49%), Positives = 329/513 (64%), Gaps = 3/513 (0%)

Query: 38  DSSEQVVPTDSEKYFATVRXXXXXXXXXQKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQ 97
           +  + +   + E Y  +           Q P YFSSK  E+ FIFTC++  LLNQAG TQ
Sbjct: 23  NEDKNISHNEKEVYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQ 82

Query: 98  SMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIW 157
            +S MN+I+E F S++ KQ WL ASFPLVSGSFIL+ GR GDIYGLKK ++ GY  + IW
Sbjct: 83  VLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 142

Query: 158 SIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMA 217
           S++CG   +TH+D FFIV +AFQGLG+SFILPN++GL+G IY+ G+++KNI IS IG  A
Sbjct: 143 SLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLTA 202

Query: 218 PLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWI 277
           P GA  G L+ G++V ++ K WPW FYA+A+   +  +   + VP+ +PTN +N  MDWI
Sbjct: 203 PTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFAMDWI 262

Query: 278 GSAXXXXXXXXFSFVWNQAPMDGWDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLPKAI 337
           GS         F+FVWNQ P+ GWDKAY             AF +YE+ Y   PLLP  +
Sbjct: 263 GSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPISPLLPVEV 322

Query: 338 TGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCV 397
           T N  I+ IL  +F+GWG FGIW+FYYF+F LNLR +SPVW GG YF FI+ G   A  V
Sbjct: 323 TKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIAALIV 382

Query: 398 GFXXXXXXXXXXXXXXXTGFTMGNLIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPASSI 457
            F                GFTMG+L+ +VTP  Q YWR               SFPASSI
Sbjct: 383 AFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSFPASSI 442

Query: 458 ILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVG 517
           ILSD LP +YQGMAGSLVNT++NY+ S CLG+ TTVE+QIN SG+DLLKGYR+A Y  VG
Sbjct: 443 ILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYRSALYLAVG 502

Query: 518 IGTLGISIASLYMFETFWTDYKEKTKLANDIES 550
           +G LG  IA + +  T W   K + +LA D++S
Sbjct: 503 LGGLGSCIAFINLCYTLWM--KRRDRLA-DLKS 532

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  520 bits (1339), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 254/486 (52%), Positives = 319/486 (65%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YF +K  E+ FIF+C+M QLLNQA T Q++SIMNII + F SE  K+ WL ASFPL
Sbjct: 64  QNPDYFQNKWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPL 123

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           VSGSFIL+ GR GDIYGLKK L+ GY    IWS+I G T Y+H+D FFI+++AFQGLG++
Sbjct: 124 VSGSFILISGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIA 183

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           FILPN++G+VG IY+P + +KNI IS IGA AP+GA  G LF+G++  ++ K WPW FYA
Sbjct: 184 FILPNVMGIVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYA 243

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           FAI S +      + +P+N+PTN +   MDWIGS          +FVWNQ P+ GW KAY
Sbjct: 244 FAIASAINLAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAY 303

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                         FF YEI YA+ P+LP  +T NRHIIMIL A+F+GWG+FGI+SFYYF
Sbjct: 304 IIVLLIISIIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYF 363

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
           SF LNLRH+S +W G  YF F + G   A  VG                  F +G ++ +
Sbjct: 364 SFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLS 423

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           VTP DQTY+R               SFPA++IILSD L  +YQGMAGSL NTMVNYS S 
Sbjct: 424 VTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSL 483

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545
           CLG+ TTVE+QIN SG ++LKGYRAA Y GVG+  LGI I+ +YM E  W   KE+    
Sbjct: 484 CLGMGTTVERQINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERLSSN 543

Query: 546 NDIESS 551
            D + S
Sbjct: 544 RDHDMS 549

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  518 bits (1335), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 244/486 (50%), Positives = 329/486 (67%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P+YF     E+ FIFTC++ QLLNQAGTTQ++SIMNI+++ FGSE + ++WL ASFPL
Sbjct: 60  QNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPL 119

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           VSGSFIL+ GR GDIYGLKKMLL+GY ++ IWS+ICG+T+Y+ SD FFI+ +AFQGLG++
Sbjct: 120 VSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIA 179

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           F+LPN++G++G IY  G+ +KNI ISF+GAMAP+GAT G LF+G++  ++   WPW FYA
Sbjct: 180 FVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYA 239

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           F+I S +      + +P+N+PTN ++  MDWIGS          +FVWNQAP+ GW +AY
Sbjct: 240 FSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQAY 299

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                         F IYE+ +A+ PLLP A+  + H+I I+LA+F GWG+FGI++FYYF
Sbjct: 300 IIVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYF 359

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
            F LN+RH++ +W GG YF F++ G   A  VGF                 F +G+++ +
Sbjct: 360 QFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMAS 419

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           VTP  +TY+R               SFPASSII SD LP EYQGMAGSLVNT+VNYS S 
Sbjct: 420 VTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSL 479

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545
           CLG+  TVE Q++  G  LLKGYR A Y G+G+ +L   I+ LYM E+F  D+K K    
Sbjct: 480 CLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATE 539

Query: 546 NDIESS 551
           ND  ++
Sbjct: 540 NDCATT 545

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  515 bits (1327), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 245/478 (51%), Positives = 316/478 (66%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YF S   E+ FI TC++  LLNQAG TQ++S MN++A+   S+ + + WL ASF L
Sbjct: 62  QDPTYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTL 121

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
            SGSFILV GR GDIYGLK   + G  I  IWSI+CG++ YT +  FFI+ +AFQGLGV+
Sbjct: 122 ASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVA 181

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           F+LPN++GLVG IY  GSM+KNI ISFIG MAP+G TFGG++ G++V  +   WPW F+A
Sbjct: 182 FVLPNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFA 241

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
            AI  F+  +   + +P++VPTN  NLKMDWIGS          +FVWNQAP+ GW KAY
Sbjct: 242 TAIAVFINLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAY 301

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                        AFFIYE+  AE PLLP  +T NRHI+ I++++F+GWG FGIW+FYY+
Sbjct: 302 IIVILIVAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYY 361

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
           +F+LNLRHFSP+W G  +F FI+ G   A  V F                GFT GN+IF+
Sbjct: 362 AFNLNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFS 421

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           VT  DQTYWRN+             SFP SSIILSD LP +YQGM+GSLVNT+ NY+ S 
Sbjct: 422 VTSPDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSL 481

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTK 543
           CLG+ TT E Q N+ G D+LKGYRAA Y  +G+G LG + +  YM E  W  Y+++ +
Sbjct: 482 CLGMGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQ 539

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  513 bits (1321), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 245/507 (48%), Positives = 334/507 (65%), Gaps = 10/507 (1%)

Query: 38  DSSEQVVPT--DSEKYFATVRXXXXXXXXXQKPQYFSSKLHEWAFIFTCLMGQLLNQAGT 95
           D S +VV    DS+   A+           Q P YF  +  E+ F+ + ++ QLLNQA  
Sbjct: 16  DISRKVVDNHEDSDMLLAS-------RSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAA 68

Query: 96  TQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILT 155
            Q+  + ++++ED  ++ S+QAWL ASFPLVSGSFILV G+ GDIYGLKK LL GYA++ 
Sbjct: 69  LQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVV 128

Query: 156 IWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGA 215
           IWS+ICGL+ Y H+ DFFIVA++FQGLG++F+LPN+ G+VG IY+P +  KN+  S IGA
Sbjct: 129 IWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGA 188

Query: 216 MAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMD 275
            AP+GAT G LFSG++  + +  W WTFYA+ IV+ L G+  ++ +PDN+PTN +  KMD
Sbjct: 189 CAPIGATLGCLFSGLIGTESEA-WAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMD 247

Query: 276 WIGSAXXXXXXXXFSFVWNQAPMDGWDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLPK 335
           W+GS         F+FVWNQAP DGWD AY              F I+E  +A+ PLLP+
Sbjct: 248 WLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPR 307

Query: 336 AITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIAS 395
           A+  NR ++MIL ++F+GWG+FGIW++YY +F LNLRH++P+W GG+YF F + G   A 
Sbjct: 308 AVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAF 367

Query: 396 CVGFXXXXXXXXXXXXXXXTGFTMGNLIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPAS 455
            VG                  F +G ++ +VTP DQTY+R +             SFPAS
Sbjct: 368 LVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPAS 427

Query: 456 SIILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTG 515
           SIILSDQLP +YQGMAGSLVNTM+NYS S CLGV+ T E+Q+N  G DLLKGYRAA Y G
Sbjct: 428 SIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVG 487

Query: 516 VGIGTLGISIASLYMFETFWTDYKEKT 542
           +G+ ++GI ++  Y  E +WT  +E++
Sbjct: 488 IGLASVGIFVSGAYAIEDWWTRRRERS 514

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  512 bits (1318), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 252/514 (49%), Positives = 332/514 (64%), Gaps = 4/514 (0%)

Query: 37  IDSSEQVVPTDSEKYFATVRXXXXXXXXXQKPQYFSSKLHEWAFIFTCLMGQLLNQAGTT 96
           +++ E +V + S+K   +           Q  QYF S L E+ FIFTC+   LLNQAG T
Sbjct: 1   MENKEPIV-SSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQT 59

Query: 97  QSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTI 156
           Q +S MN+I+E F S+   Q WL ASFPLVSGSFIL+ GR GDIYGLKK ++ GY  + I
Sbjct: 60  QVLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMII 119

Query: 157 WSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAM 216
           W+++CG   YTHSD FFIV +AFQGLG+SFILPNI+GLVG IY+ G+++KNI IS IG  
Sbjct: 120 WTLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGIT 179

Query: 217 APLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDW 276
           AP GA  G L+ G++  +  + WPW FYA+A+ +F+  +   + VP+NVPTN +N  MDW
Sbjct: 180 APTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDW 239

Query: 277 IGSAXXXXXXXXFSFVWNQAPMDGWDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLPKA 336
           +G+         F+FVWNQ P++GW K Y             AF IYE+ +   PLLP+ 
Sbjct: 240 MGAIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPRE 299

Query: 337 ITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASC 396
           +T N  I+ IL  +F+GWG+FGIW+FYY++F LNLR++SP+W G  +F FI+ G   A  
Sbjct: 300 VTKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFI 359

Query: 397 VGFXXXXXXXXXXXXXXXTGFTMGNLIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPASS 456
           VGF                GFTMG+L+ +VTP  QTYWR               SFPASS
Sbjct: 360 VGFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASS 419

Query: 457 IILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGV 516
           IILSD LP +YQGMAGSLVNT++NYS S CLG+ TTVE+QIN +G++LL+GYR+A Y  V
Sbjct: 420 IILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAV 479

Query: 517 GIGTLGISIASLYMFETFWTDYKEKTKLANDIES 550
           G+G LG  +A L +    W   K K++L +DI S
Sbjct: 480 GLGGLGACVAFLNLCYDLWR--KRKSRL-DDIRS 510

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  512 bits (1319), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 238/485 (49%), Positives = 328/485 (67%), Gaps = 1/485 (0%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YF     E+ FIFTC++ QLLNQ+GTTQ++SIMNI+A+ FGS+ + ++WL ASFPL
Sbjct: 68  QNPNYFKYPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPL 127

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           VSGSFIL+ GR GDI+GLK MLL+GY ++ IWS+ICGLT Y+ SD FFIV++AFQGLG++
Sbjct: 128 VSGSFILISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIA 187

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           F+LPN++G++G +Y  G+ +KNI ISFIGAMAP+GAT G  F+G++   +   WPW FYA
Sbjct: 188 FVLPNVLGIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYA 247

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           + I + +  +   + +P+N+PTN +   MDWIGS          + VWNQAP+ GW++AY
Sbjct: 248 YTITAVINLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAY 307

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                         F +YEI++A+ PLLP+A+  +RH+I I+L++F GWG+FGI++FYYF
Sbjct: 308 IIVLLIISVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYF 367

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
            F LN+RH++P+W GG+YF F++ G   A  VGF                 F +G+++ +
Sbjct: 368 QFQLNIRHYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMAS 427

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           VTP  +TY+R               SFPASSII SD LP EYQGMAGSLVNT+VNYS S 
Sbjct: 428 VTPVHETYFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSL 487

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545
           CLG+  TVE Q++  G  +LKGYR A Y G+G+ +L   I+ LYM E +  D++ K  +A
Sbjct: 488 CLGMGATVEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKA-VA 546

Query: 546 NDIES 550
            D  S
Sbjct: 547 EDKRS 551

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  511 bits (1315), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 245/481 (50%), Positives = 317/481 (65%), Gaps = 1/481 (0%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P+YF S L E+ F+ +C + QLLNQAG  Q+  IMNI+A+   S+  KQAWL A+FPL
Sbjct: 51  QNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPL 110

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           +SGSFIL+ GR GDIYGLKK LL+GY  L +WS+ICGLT Y HSD FFIV++AFQGLG+S
Sbjct: 111 ISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGIS 170

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
            ILPNI+G+VG+IY  GS +KN+ IS IG MAP+GAT G +FSG++  +D   WPW FY+
Sbjct: 171 LILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYS 230

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           +AI + +  V   + +P+ +PTN +  KMDWIGS          +FVWNQAP+DGWD AY
Sbjct: 231 YAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAY 290

Query: 306 XXXXXXXXXXXXXAFFIYEINYAE-VPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYY 364
                        AFFIYE+++    PLLPK +  +   I++L A+F GWG+FGI+SFYY
Sbjct: 291 LIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFGWGSFGIFSFYY 350

Query: 365 FSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIF 424
           F+F LNLRH++P+W GG YF F++ G   A  VGF                 F  G++I 
Sbjct: 351 FTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIM 410

Query: 425 AVTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQS 484
           +VTP  QTY+RN              SFPASSI+LSD+LP +YQGMAGSLVNTMVNYS S
Sbjct: 411 SVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMS 470

Query: 485 FCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKL 544
           FCLGVA  VE+ +N+ G D+LKGYR AFY G+G+ ++   I+   M        K +   
Sbjct: 471 FCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQGRKNEKDS 530

Query: 545 A 545
           A
Sbjct: 531 A 531

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  508 bits (1308), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 246/478 (51%), Positives = 320/478 (66%), Gaps = 1/478 (0%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YFS+   E+ FIF  +M QLLNQAGTTQ++S++NI++++F S TS+Q WL ASFPL
Sbjct: 42  QDPTYFSAPWKEYLFIFASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPL 101

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           VSGSFILV G+ GDIYGLKK LL+GY +  IWS+ICGLT YT S +FFI+++AFQGLG++
Sbjct: 102 VSGSFILVSGKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIA 161

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           FILPNI+G+VG IY  G+ +KN+ IS IGA AP+GAT G LFSG++    ++ W WTFYA
Sbjct: 162 FILPNIMGIVGNIYVAGTTRKNMVISLIGACAPIGATMGVLFSGLIGTLSER-WAWTFYA 220

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           + I + +      + +P+ +PTN     MDWIGS         F+FVWNQ P+ GWD AY
Sbjct: 221 YTITAAINMGLSIWVIPNTIPTNVRGSSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAY 280

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                        AFF+YE  YA  PL+P+    N  ++M LLA+F GWG+FGIW+FYYF
Sbjct: 281 IIVLLIVSVAAIVAFFLYETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYF 340

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
            F LNLR ++P+W GG+YF F++ G   A  VG+                 F  G ++ +
Sbjct: 341 CFVLNLREYTPLWAGGSYFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLS 400

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           VTP DQTY+R               SFPASSIILSD+LP E QGMAGSLV+TM+NYS S 
Sbjct: 401 VTPVDQTYFRMILGMMIILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSM 460

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTK 543
           CLG+A TVE QIN +GDDLLKGYRAA Y G+G+ +LG+ I++L+M E +    +   K
Sbjct: 461 CLGIAGTVEHQINKNGDDLLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVK 518

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  508 bits (1307), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 243/486 (50%), Positives = 318/486 (65%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q   YF ++  E+ F+ TC+M QLLNQA   Q++S+MNI+ + F S    Q WL ASFPL
Sbjct: 57  QDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPL 116

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           VSGSFIL+ GR GDIYGLK  L+ G     IW++I G T+YTHSD FFIV+++FQGLGV+
Sbjct: 117 VSGSFILISGRVGDIYGLKWSLVGGNIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVA 176

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           FILPN++G VG IY+P + +KNI IS IGA AP+GA  G  F+G++  K+  +WPW+FYA
Sbjct: 177 FILPNVMGCVGNIYKPNTFRKNIVISLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYA 236

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
            AI S L  +   + +P+++PTN +   MDWIGS          +FVWNQ P+DGW KAY
Sbjct: 237 MAIASTLTLLGALYSIPNHIPTNVHGFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAY 296

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                         FFIYE++YA  PLLP+ IT NRH++MIL+A+F+GWG+FGI+SFYYF
Sbjct: 297 IIVLLIVSVFVLTLFFIYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYF 356

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
           +F LNLRH+S VW GG YF F + G   +  VG                  F +G ++ +
Sbjct: 357 AFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISASIILFFSMIAFDVGIIMLS 416

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           VTP  QTY+R               SFPA++IILSD LP +YQGMAGSL NTMVNYS S 
Sbjct: 417 VTPVKQTYFRMNLGTMIILSFGMDMSFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSL 476

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545
           CLG+ +TVE QIN +G DLLKGYRAA Y G+GI +L + ++ +YM E  W D KE+ +  
Sbjct: 477 CLGMGSTVESQINQNGKDLLKGYRAAEYLGIGIASLAVILSLIYMCERLWIDRKERMEST 536

Query: 546 NDIESS 551
           ++   S
Sbjct: 537 SETNLS 542

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  506 bits (1303), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 257/483 (53%), Positives = 317/483 (65%), Gaps = 2/483 (0%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YF ++  E+ FIF+C+M QLLNQA T Q++SIMNII + F SE  K+ WL ASFPL
Sbjct: 57  QNPDYFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPL 116

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           VSGSFIL+ GR GDIYGLKK L+ GY    IWSII GLT Y+HSD FFIV++AFQGL ++
Sbjct: 117 VSGSFILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIA 176

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           FILPN++G+VG IY+P S +KNI IS IGA AP+GA FG LF+G++  +D   WPW FYA
Sbjct: 177 FILPNVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYA 236

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           FAI S        + +P++VPTN +   MDWIGS          +FVWNQ P+ GW  AY
Sbjct: 237 FAIASAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAY 296

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                         FF YE+ YAE PLLP  +T NRHIIMIL A+F+GWG+FGI+SFYYF
Sbjct: 297 IIALLVVSVFFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYF 356

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
           SF LNLRH+S +W G  YF F + G   A  VG                  F +G ++ +
Sbjct: 357 SFLLNLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLS 416

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           VTP DQTY+R               SFPA++IILSD L  +YQGMAGSL NTMVNYS S 
Sbjct: 417 VTPVDQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSL 476

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545
           CLG+ TTVE+QIN SG+DLLKGYR A Y G+G+  LGI I ++Y+ E  W   K K  LA
Sbjct: 477 CLGMGTTVERQINKSGNDLLKGYRGAEYLGIGLAGLGIIITAIYLGEILWG--KRKQHLA 534

Query: 546 NDI 548
            ++
Sbjct: 535 ANV 537

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  504 bits (1297), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 236/477 (49%), Positives = 321/477 (67%), Gaps = 1/477 (0%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YF     E+ F+ + ++ QLLNQA TTQ+  + +++++D  ++ S+Q WL ASFPL
Sbjct: 39  QNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPL 98

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           VSGSFILV G+ GDIYGLKK LL GY ++ IWS+ICGL+ Y H+ DFF+VA++FQGLG++
Sbjct: 99  VSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIA 158

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           F+LPN++G+VG IY+P +  KN+  S IGA AP+GAT G +FSG++  + D  W WTFYA
Sbjct: 159 FVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSGLIGARTDL-WGWTFYA 217

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           +AI + L G+   + +P+N+PTN N  KMDWIGSA        F+FVWNQAP+ GW  AY
Sbjct: 218 YAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAY 277

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                        AF  YEI +A+ PLLP ++  NR ++MIL ++F GWG+FGIW+FYY 
Sbjct: 278 IIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYM 337

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
           SF LNLRH+SP+W GG YF F + G   +  VG+                 F  G ++ A
Sbjct: 338 SFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLA 397

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           VTP  QTY+R T             SFPA+SIILSDQLP +YQGMAGSLV+TM++YS S 
Sbjct: 398 VTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSL 457

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKT 542
           CLG++ T E Q+N +G DLLKGY+AA Y G+G+ +LG+ I+  +M E +WT  +++T
Sbjct: 458 CLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKRT 514

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  503 bits (1296), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 243/480 (50%), Positives = 322/480 (67%), Gaps = 1/480 (0%)

Query: 68  PQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVS 127
           P+YF ++ HE+ FI +C++ Q ++QAG TQ++SIMNI+AE+  +E S+QAWL ASF L  
Sbjct: 89  PKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSM 148

Query: 128 GSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFI 187
           GSFILV GR GDIYGLKK+LL GYAILTIWS+ICG + Y+H+D FFI ++AFQGLG++F+
Sbjct: 149 GSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFV 208

Query: 188 LPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFA 247
           LPN +GL+G IYEPGSMKKN+ I  +GAM+P+GAT GGLF+GI+  KD K WPW+FY+F 
Sbjct: 209 LPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFG 268

Query: 248 IVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAYXX 307
           IVSF   +  ++ +P+N+PTN  NL MDWIG+          +FV+NQAP+ GW  AY  
Sbjct: 269 IVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYII 328

Query: 308 XXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYFSF 367
                       F +YE+ YA+ PL+PKAI+ NR ++MIL A+F GWG FG W+FYYFSF
Sbjct: 329 VLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSF 388

Query: 368 SLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFAVT 427
            LN+R ++  W GG+YF FI+SG  IA+  GF                GF  G ++  VT
Sbjct: 389 VLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVT 448

Query: 428 PADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSFCL 487
           P  Q+Y++N              SFPA+SIILSD LP +YQGMAGSLV T+ NYS S CL
Sbjct: 449 PIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICL 508

Query: 488 GVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLAND 547
           G+A +VE   N +G ++LKGYR A      +  LGI ++ +YM     T  +E +K  N 
Sbjct: 509 GMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLIT-IRENSKSTNK 567

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  491 bits (1263), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 246/486 (50%), Positives = 320/486 (65%), Gaps = 1/486 (0%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P+YF +   E  FI +C++ QLLNQAG TQS+S MN++A+ F S +SKQ WL ASFPL
Sbjct: 74  QNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPL 133

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           VSGSFIL+ GR GDIYGLKK L +GY I+T+WSIICGL  YT+SD FFIV ++FQGLG++
Sbjct: 134 VSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIA 193

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           FILPNI+GLVG IY+ G+++KNI IS IG MAP GA  G LF G++V +D + WPW FYA
Sbjct: 194 FILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFYA 253

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           F I SF+  +   + +P+NVPTN NNL MDWIGS          + VWNQAP+ GW +AY
Sbjct: 254 FGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAY 313

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                         F +YEI YA  PLLP ++  N+ I+MIL A+F GWG+FGIW++YY+
Sbjct: 314 IIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYY 373

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
           +F LNLR ++P+W GG +F F++ G   A  V                   F  G+++ +
Sbjct: 374 AFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLS 433

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           VTP  QTYWR               SFPASSIILSD LP +YQGMAGSLVNT+VNYS S 
Sbjct: 434 VTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSL 493

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545
           CLG+  TVE+Q N+ G DLLKGYR+A Y  +G+ + G+ + SL    T     + + ++ 
Sbjct: 494 CLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCV-SLVFLVTDIIAKRHRKRIE 552

Query: 546 NDIESS 551
           ++ ES 
Sbjct: 553 SECESC 558

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  491 bits (1263), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 241/469 (51%), Positives = 316/469 (67%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q P YFSS+  E+ FI TC++  LLNQAG TQ+ S MN+I   F +++S + WL ASFPL
Sbjct: 70  QNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPL 129

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           VSGSFILV GR GDIYGLK+ ++ G  ++ IWS+ICG  +Y+ S  FFI+ +AFQGLG++
Sbjct: 130 VSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIA 189

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           F+LPN++GLVG IY+ GS++KNI IS IG  AP GA FG  ++G++  K +K WPW FYA
Sbjct: 190 FVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYA 249

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           +A    L  V   + +PD VP N +   MDW GS         F+FVWN+AP+ GW+KAY
Sbjct: 250 YAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAY 309

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                         FFIYEI +A+ PLLP+A+T N +IIMIL A+FMGWG+FGIW+FYY+
Sbjct: 310 IIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYY 369

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
           +F LNLR ++P+  G ++  FIL G   A  V F                 FT+G+++ +
Sbjct: 370 AFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLS 429

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
           +TP  QTYW+ TF            SFPASSIILSD LP EYQGMAGSLVNT+VNYS S 
Sbjct: 430 ITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSL 489

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETF 534
           CLG+ TT E Q+N +G DLLKGYRAA Y G+G+G +G+ IA+L++FE+ 
Sbjct: 490 CLGMGTTAEIQVNKNGTDLLKGYRAALYVGIGLGVVGVIIAALFLFESL 538

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  464 bits (1193), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 239/513 (46%), Positives = 320/513 (62%), Gaps = 4/513 (0%)

Query: 35  QKIDSSEQVVPTDSEKYFATVRXXXXXXXXXQKPQYFSSKLHEWAFIFTCLMGQLLNQAG 94
           + I S   +  + +EK    VR         Q P YF +   E+ F+ +C+  QLLNQA 
Sbjct: 11  EHIQSDISIDKSSNEKCEVIVREKSKW----QDPGYFKNSFQEYLFVGSCMTTQLLNQAT 66

Query: 95  TTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAIL 154
           T Q++SIMN++++ F S  S Q WL ASFPLV+GSFIL+ GR GDIYGLKK L+ GY  L
Sbjct: 67  TPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFL 126

Query: 155 TIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIG 214
            IWS+ICG T+Y+ SD F I+A+AFQGLG++F LPN++G +G IY  GS++KN+ IS I 
Sbjct: 127 IIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIA 186

Query: 215 AMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKM 274
           A AP+GA  GG F+G++V +    WPW+FYAFAI      +   + +P N+PTN N  KM
Sbjct: 187 ASAPVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKM 246

Query: 275 DWIGSAXXXXXXXXFSFVWNQAPMDGWDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLP 334
           DWIGSA        F+F WNQ P+ GWD AY             AF  YEIN+A  PL+ 
Sbjct: 247 DWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLIA 306

Query: 335 KAITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIA 394
           + IT +R++I+ +  +F+GWG++GIWSFYYFSF LNLRH+SPVW GG+YF F + G   +
Sbjct: 307 REITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLAS 366

Query: 395 SCVGFXXXXXXXXXXXXXXXTGFTMGNLIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPA 454
           + VG                  F +G  + +V P DQ+Y++ T             SFPA
Sbjct: 367 AFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPA 426

Query: 455 SSIILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYT 514
           ++IILSD LP EYQGMAGSL  TMVNYS S CLG+  TVE+QIN  G D+LKGYR+A Y 
Sbjct: 427 ATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYL 486

Query: 515 GVGIGTLGISIASLYMFETFWTDYKEKTKLAND 547
           G+G+  LG+ +A + + +     Y+ K  + N 
Sbjct: 487 GIGLSGLGLLLACILVIDKLVAKYRNKNSIKNS 519

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  454 bits (1168), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 222/518 (42%), Positives = 313/518 (60%), Gaps = 11/518 (2%)

Query: 38  DSSEQVVPTDSEKYFATVRXXXXXXXXXQKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQ 97
           +SS    P D++ +    +         ++P  F ++  E+ F+   ++GQ L+Q G TQ
Sbjct: 90  ESSLSATPPDNKPFITESQNL-------RRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQ 142

Query: 98  SMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIW 157
            +S MNI+AE+  +   +Q WL A+FPL  G  IL+ GR GDI+GLKK+LLLGY I TIW
Sbjct: 143 VLSTMNILAEELHTTKMRQPWLMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIW 202

Query: 158 SIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMA 217
           ++ICG + Y HSDD FIV++ FQGLG++  LPN+  L+G IY+P   KKN+    IGAM+
Sbjct: 203 TLICGFSSYAHSDDLFIVSRTFQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMS 262

Query: 218 PLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWI 277
           P+GAT GG+F+G+ V  + KNWPW+FY+FAIV+FL G+  +F +P+++  N   LKMDWI
Sbjct: 263 PIGATLGGIFAGLSVKYNIKNWPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWI 322

Query: 278 GSAXXXXXXXXFSFVWNQAPMDGWDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLPKAI 337
           GSA         +FV+NQ P+DGW  AY              F IYE+  A  PL+PK I
Sbjct: 323 GSALGLFGLVVLNFVFNQTPIDGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGI 382

Query: 338 TGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSG--FTIAS 395
             N  +I+ILL +F GWG F IW+FYYF+F LNLRH+SP+W   + F  I+SG  +TI  
Sbjct: 383 HSNYRLILILLTLFCGWGGFAIWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIIC 442

Query: 396 CVGFXXXXXXXXXXXXXXXTGFTMGNLIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPAS 455
           C+                  GF  GN++FAVTP  QT++RN F            SFP++
Sbjct: 443 CLA--VQRMKPPILLFFSMLGFLGGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSA 500

Query: 456 SIILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTG 515
           S++ ++ LP  Y+ MAGSLVN  +NY+ S C+G+A +     N+ G DLL G+RAA Y  
Sbjct: 501 SMMTAETLPTHYKSMAGSLVNVAINYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLA 560

Query: 516 VGIGTLGISIASLYMFETFWTDYKEKTKLANDIESSIE 553
           +G+    + ++ LYM  + WTD  +K K    I +  E
Sbjct: 561 IGLSGFSVFLSGLYMIGSIWTDRNQKMKENKLINTDSE 598

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  295 bits (755), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 174/491 (35%), Positives = 257/491 (52%), Gaps = 16/491 (3%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQ-AWLFASFP 124
           +KP+   S L E AF+      QL+ QAG  QS++ ++II + FG+    Q +W  +++ 
Sbjct: 35  EKPE---SLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYS 91

Query: 125 LVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGV 184
           L  G+FIL+ GR GDI+G KK  +LG+    +WS++ G + Y++   FF   +AFQG+G 
Sbjct: 92  LTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGP 150

Query: 185 SFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244
           +F+LPN I ++G  Y+PG  +KN+  S  GA AP G   G +FS ++       WPW ++
Sbjct: 151 AFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYW 207

Query: 245 AFAIVSFLVGVTCYFFVPDNVPTNTNNL------KMDWIGSAXXXXXXXXFSFVWNQAPM 298
              I  FL+ V  Y+ +P     N +        ++D+ GS         F+F WNQ P+
Sbjct: 208 LMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPV 267

Query: 299 DGWDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFG 358
            GW   Y              F   E + A  PLLP A   +     +L  I  GW +FG
Sbjct: 268 VGWQTPYTYALLIVGTVFLIIFAFIE-SRAAFPLLPFAAL-SSDTAFVLSCIAAGWASFG 325

Query: 359 IWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFT 418
           IW FY + F  + R  +P+ +   +    +SGF  A   GF               T FT
Sbjct: 326 IWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFT 385

Query: 419 MGNLIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTM 478
           +G ++ A  P  QTYW  TF            SFPA++I+LSD +P E+QG+A SLVNT+
Sbjct: 386 VGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTV 445

Query: 479 VNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDY 538
           VNYS S  LG+A T+E  +N  G ++LKGYR ++Y G+G+   GI +A+ Y   TF    
Sbjct: 446 VNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATYAVSTFMKSK 505

Query: 539 KEKTKLANDIE 549
           K  ++  + IE
Sbjct: 506 KRVSEKQHFIE 516

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  295 bits (754), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 172/478 (35%), Positives = 254/478 (53%), Gaps = 13/478 (2%)

Query: 73  SKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQ-AWLFASFPLVSGSFI 131
           S + E AF+      QL+ QAG  QS++ ++II + FG+    Q +W  +S+ L  G+FI
Sbjct: 39  SLVWEAAFVGVLCSAQLMTQAGLGQSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFI 98

Query: 132 LVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNI 191
           L+ GR GDI+G +K  +LG+    +WS++ G + Y++   FF   +AFQG+G +F+LPN 
Sbjct: 99  LIAGRLGDIFGHRKFFILGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNA 157

Query: 192 IGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSF 251
           I ++G  Y+PG  +KN+  S  GA AP G   G +FS ++       WPW ++   I  F
Sbjct: 158 IAILGRTYKPGK-RKNMVFSLFGASAPGGFVLGAVFSSML--GQLAWWPWAYWIMGIACF 214

Query: 252 LVGVTCYFFVPD------NVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           L+ V  YF +P       + P+     ++D+ GS         F+F WNQ P+ GW+  Y
Sbjct: 215 LLAVAGYFVIPHVQMPSRDSPSFNMLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPY 274

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                         F   E + A  PLLP A   +     +L  I  GW +FGIW FY +
Sbjct: 275 TYVLLIVGTVFLGVFVFIE-SRAAYPLLPFAAL-SSDAAFVLGCIAAGWSSFGIWIFYTW 332

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
            F    R  SP+ +   +    +SGF  A   GF               T FT+G ++ A
Sbjct: 333 QFMEESRKQSPLLSSAQFAPVAISGFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIA 392

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
             P  QTYW  TF            SFPA++I+LS+ +P E+QG+A SLVNT+VNYS S 
Sbjct: 393 TAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISI 452

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTK 543
            LG+A T+E Q+N  G + LKGYR ++Y G+G+  LGI +A++Y   TF    K+ ++
Sbjct: 453 GLGIAGTIESQVNDGGANALKGYRCSWYMGIGLSGLGIFVAAVYASSTFLKSKKKASE 510

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  293 bits (749), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 174/492 (35%), Positives = 260/492 (52%), Gaps = 18/492 (3%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQ-AWLFASFP 124
           ++P+   S L E AF+      QL+ QAG  QS++ ++II   FG+  + Q +W  +++ 
Sbjct: 34  ERPK---SLLWESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTNAGQLSWFASAYS 90

Query: 125 LVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGV 184
           L  G+FIL+ GR GDI+G KK  +LG+    +WS++ G + Y++   FF   +AFQG+G 
Sbjct: 91  LTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGMGP 149

Query: 185 SFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244
           +F+LPN I ++G  Y+PG  +KN+  S  GA AP G   G +FS ++       WPW ++
Sbjct: 150 AFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSML--GQLAWWPWAYW 206

Query: 245 AFAIVSFLVGVTCYFFVPDNVPTNTNNL-------KMDWIGSAXXXXXXXXFSFVWNQAP 297
              I  F++ V  YF +P + P  + +        ++D+ GS         F+F WNQ P
Sbjct: 207 IMGIACFVLAVAGYFVIP-HTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGP 265

Query: 298 MDGWDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTF 357
           + GW   Y               F Y  + A  PLLP A   +     +L  I  GW +F
Sbjct: 266 VVGWQTPYTYALLIVGTFFL-VIFAYIESRAAFPLLPFAAL-SSDTAFVLSCIAAGWASF 323

Query: 358 GIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGF 417
           GIW FY + F  + R  +P+ +   +    +SGF  A   GF               T F
Sbjct: 324 GIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPPSTVMLFAMTAF 383

Query: 418 TMGNLIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNT 477
           T+G ++ A  P  QTYW  TF            SFPA++I+LSD +P E+QG+A SLVNT
Sbjct: 384 TVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNT 443

Query: 478 MVNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTD 537
           +VNYS S  LG+A T+E ++N  G   LKGYR ++Y G+G+  LGI +A+ Y + TF   
Sbjct: 444 VVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAATYAWSTFMKS 503

Query: 538 YKEKTKLANDIE 549
            K  ++  + IE
Sbjct: 504 KKRISEKQHFIE 515

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  286 bits (733), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 170/484 (35%), Positives = 253/484 (52%), Gaps = 13/484 (2%)

Query: 73  SKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQ-AWLFASFPLVSGSFI 131
           S L E AF+      QL+ QAG  QS++ ++II + FG+    Q +W  +++ L  G+FI
Sbjct: 39  SLLWETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNPGQLSWFASAYSLTVGTFI 98

Query: 132 LVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNI 191
           L+ GR GDI+G KK  +LG+    +WS++ G + Y++   FF   +AFQG+G +F+LPN 
Sbjct: 99  LIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSN-KIFFDCCRAFQGMGPAFLLPNA 157

Query: 192 IGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSF 251
           I ++G  Y+ G  +KN+  S  GA AP G   G +FS ++       WPW ++   I  F
Sbjct: 158 IAILGRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLL--GQLAWWPWAYWIMGIACF 214

Query: 252 LVGVTCYFFVPDN-VPTNTNN-----LKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
            + +  YF +P   +P+   +      ++D+ GS         F+F WNQ P+ GW   Y
Sbjct: 215 FLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILFNFAWNQGPVVGWQTPY 274

Query: 306 XXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365
                         F   E + A  PLLP A   +     +L  I  GW +FGIW FY +
Sbjct: 275 TYILLIVGTVFLAIFAFIE-SRAAFPLLPFAAL-SSDTAFVLSCIAAGWASFGIWIFYTW 332

Query: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFA 425
            F  + R  +P+ +   +    +SGF  A   G+               T FT G ++ A
Sbjct: 333 QFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTVMLFAMTAFTAGTILIA 392

Query: 426 VTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485
             P  QTYW  TF            SFPA++I+LSD +P E+QG+A SLVNT+VNYS S 
Sbjct: 393 TAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISI 452

Query: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545
            LG+A T+E  +N  G   LKGYR ++Y G+G+  LGI +A++Y + TF    K  ++  
Sbjct: 453 GLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIYAWSTFKKSKKRTSEKQ 512

Query: 546 NDIE 549
           + IE
Sbjct: 513 HFIE 516

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  286 bits (731), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 172/488 (35%), Positives = 253/488 (51%), Gaps = 19/488 (3%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQ-AWLFASFP 124
           QKP+   S L E AF+      QL+ QAG  QS++ ++II + FG+    Q +W  A++ 
Sbjct: 37  QKPE---SLLGEAAFVGVICGAQLMTQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYS 93

Query: 125 LVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGV 184
           L  G+FIL+ GR GD+YG KK  ++G+    +WS++ G + Y++   FF   +AFQG+G 
Sbjct: 94  LTVGTFILIAGRLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSN-QIFFDCCRAFQGIGP 152

Query: 185 SFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244
           + +LPN I ++G  Y PG  +K + +S  GA AP G   G +FS I        WPW ++
Sbjct: 153 ALLLPNAIAILGRTYVPGR-RKAMILSLFGATAPAGFVLGAVFSSIF--GQLTWWPWAYW 209

Query: 245 AFAIVSFLVGVTCYFFVPD-NVPTNTNNL----KMDWIGSAXXXXXXXXFSFVWNQAPMD 299
           A  IV F + V     +P   +P    ++    ++D  GS          +F WNQ P+ 
Sbjct: 210 AMGIVCFFLAVAGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVV 269

Query: 300 GWDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGI 359
           GW   Y              F   E + A  PLLP +   +     +L  +  GW +FGI
Sbjct: 270 GWQTPYTYSLLIVSAVFLCVFAFIE-SRAPHPLLPLSAL-SSDAAFVLGCVGAGWSSFGI 327

Query: 360 WSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTM 419
           W +Y++ F   LR  SP+ T   +    +SG   A   GF               T FT+
Sbjct: 328 WIYYFWLFLEELRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLVMLFAMTAFTV 387

Query: 420 GNLIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMV 479
           G ++ A  P  Q YW   F            SFPA++I+LSD +P E+QG+A SLVN +V
Sbjct: 388 GGILIATAPVKQVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVV 447

Query: 480 NYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYK 539
           NYS S  LG+A TVE ++N+ G +LLKGYR A+Y G+G+   GI IA +Y + TF    K
Sbjct: 448 NYSISIGLGLAGTVEGRVNNGGANLLKGYRGAWYMGIGLSGFGILIAFMYEYHTF----K 503

Query: 540 EKTKLAND 547
           +  K+ ++
Sbjct: 504 KSKKMPSE 511

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  275 bits (704), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 160/455 (35%), Positives = 235/455 (51%), Gaps = 14/455 (3%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQ-AWLFASFP 124
           Q  + ++S L E   I      QL+ QAG  QS+  + II + FG +   Q +W  ++F 
Sbjct: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77

Query: 125 LVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGV 184
           L  G+FIL+ GR GD +G KK  ++G+    +WSI+ G + Y++   FF   +AFQG+G 
Sbjct: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSN-QIFFDCCRAFQGIGP 136

Query: 185 SFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244
           +F LPN I ++   Y PG  K+N+  S  GA AP G   G +FS ++   +   WPW ++
Sbjct: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193

Query: 245 AFAIVSFLVGVTCYFFVPDNVPTNTNNL-----KMDWIGSAXXXXXXXXFSFVWNQAPMD 299
              I  FL+GV  Y  +P + P + +       ++D  GS         F+F WNQ P+ 
Sbjct: 194 IMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPVV 253

Query: 300 GWDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLP-KAITGNRHIIMILLAIFMGWGTFG 358
           GW+ +Y             AF   E + A+ PLLP + ++ +   I ++  I  GW +FG
Sbjct: 254 GWETSYTYALLIVGSAFLAAFGFIE-SRAKHPLLPVRKLSSDT--IFVMGCIAAGWSSFG 310

Query: 359 IWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFT 418
           IW +Y +    NLR   P+ +   +    +SG   A    F                 FT
Sbjct: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370

Query: 419 MGNLIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTM 478
           +G+++ A  P  QTYW  TF            SFPA++IILS  +P  +QG+A SLVNT+
Sbjct: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430

Query: 479 VNYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFY 513
           +NYS S  LG A T+E QI+   DDLLKGYR A+Y
Sbjct: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYRGAYY 465

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  275 bits (703), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 162/482 (33%), Positives = 249/482 (51%), Gaps = 16/482 (3%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFG-SETSKQAWLFASFP 124
           +KPQ   S + E  F+      QL+ QAG  QS++ + II   FG S   + +W  A++ 
Sbjct: 31  EKPQ---SLMREALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFGISNPGQLSWFSAAYS 87

Query: 125 LVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGV 184
           L  G+FIL+ GR GD++G KK+ ++G+   ++WS++ G + Y++   FF   +A QG+G 
Sbjct: 88  LTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSN-QIFFDCCRALQGIGP 146

Query: 185 SFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244
           +F+LPN I ++G  Y PG  +K +  S  GA AP G   G +FS I        WPW ++
Sbjct: 147 AFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGSVFSSIF--SQLAWWPWAYW 203

Query: 245 AFAIVSFLVGVTCYFFVPDNVPTNTN-----NLKMDWIGSAXXXXXXXXFSFVWNQAPMD 299
           A      ++GV     +P   P   +       ++D  G+          +F WNQ P+ 
Sbjct: 204 AMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILGLALVNFAWNQGPVV 263

Query: 300 GWDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGI 359
           GW   Y              F + E + A  PLLP A   +  +  +L  I  GW +FGI
Sbjct: 264 GWQTPYTYALLIVGFVFLLVFSLIE-SRARFPLLPFAAL-STDLAYVLGCIAAGWSSFGI 321

Query: 360 WSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTM 419
           W FY++ F  + R  SP+ T   +    +SG   A   G+                 FT+
Sbjct: 322 WIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVPACAVMLIAMIAFTV 381

Query: 420 GNLIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMV 479
           G ++ A  P +QTYW  TF            SFPA++I++S+ +P E+QG+A SLVNT+V
Sbjct: 382 GGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPHEHQGLAASLVNTVV 441

Query: 480 NYSQSFCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYK 539
           NYS S  LG A T+E ++N+ G + L+GYR A+Y G+G+  LG+ +A +Y + T    +K
Sbjct: 442 NYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLVAIVYAWSTL-KKFK 500

Query: 540 EK 541
           E+
Sbjct: 501 EE 502

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  239 bits (610), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 150/477 (31%), Positives = 249/477 (52%), Gaps = 15/477 (3%)

Query: 72  SSKLH----EWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVS 127
           SS  H    E+AF+FT +M Q  NQAG T  + ++N++++ F  +     +L  S+P+V 
Sbjct: 41  SSNFHFLCKEYAFVFTGVMAQAFNQAGGTMILPLVNVLSDSFHGK-----FLLNSYPMVC 95

Query: 128 GSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFI 187
           GSF+L+GGR G+++G K+ LL GY IL + S++ GL+ Y+ S  F+++ +AFQG+G++ I
Sbjct: 96  GSFMLIGGRLGEVHGYKETLLGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALI 155

Query: 188 LPNIIGLVGTIY--EPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           LPN        Y  +  + +K I  + IG  A  GA  G   SGI V + + NW W +Y 
Sbjct: 156 LPNFSAAYDYRYQSQAKAHRKTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYT 215

Query: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIG-SAXXXXXXXXFSFVWNQAPMDGWDKA 304
           + I + L     Y+ VPDN+ T  N   ++ +G  +         +   N A +   + +
Sbjct: 216 YTIAATLTLALSYYSVPDNI-TKKNKPCLNGLGWFSNRSCGLLMLNVACNLAAVASSNWS 274

Query: 305 YXXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYY 364
           +              F ++E+ ++E P+  K +  N  + ++L +IF GWGT+GIWS Y+
Sbjct: 275 HIIVLLVVFVCLLLLFLVFELKFSEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYF 334

Query: 365 FSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIF 424
           F F LNLR++SP+  G  Y   ++ G+     +                  GFT   +I 
Sbjct: 335 FRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIIL 394

Query: 425 AVTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQS 484
           +VTP  Q+Y+R+T             SFP+S+IIL ++LP +Y  M   L N + NY+ S
Sbjct: 395 SVTPIHQSYFRSTLGSMIFLALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAIS 454

Query: 485 FCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEK 541
           F  G+  +  + ++S   +L+K YR  +Y  +G+  +G+  A + +       Y+ K
Sbjct: 455 FWPGICNSALRSLSS--IELIKYYRYVYYFAIGLSAIGLFAAGIQLARASIMYYRGK 509

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  182 bits (462), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 128/465 (27%), Positives = 208/465 (44%), Gaps = 17/465 (3%)

Query: 73  SKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFG-SETSKQAWLFASFPLVSGSFI 131
           S LHE  F+      Q+L  AG  Q +  M++I E F  +  S   W    +    GSF+
Sbjct: 74  SLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFV 133

Query: 132 LVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNI 191
           L+ G+ GD+ G K M L+GYA L +WS++ G + Y  S  FF   +A QG+G +F   + 
Sbjct: 134 LIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSA 193

Query: 192 IGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSF 251
           + ++G  Y P   +KN   SF GA    G   G +FS +       +W W +++ AI   
Sbjct: 194 LSILGKSYPP-CKRKNFIFSFFGACGSFGVVLGMVFSALFT--QLAHWSWAYWSMAIACV 250

Query: 252 LVGVTCYFFVPDNV---PTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAYXXX 308
           ++ +   FF+P +V      +N    D++G+         FS  WNQAP  G+ + Y   
Sbjct: 251 VIIILSIFFIPGDVVEKHETSNVFYFDYLGAFLFVTGLVLFSVAWNQAPTYGFGRTY-VY 309

Query: 309 XXXXXXXXXXAFFIYEINYAEVPLLP-KAITGNRHIIMILLAIFMGWGTFGIWSFYYFSF 367
                     A  +Y     + PLLP   I+ N   + +LLAIF  + +F +W+ Y F F
Sbjct: 310 VLLIVSVVILALAMYVETKVDDPLLPWTHISANT--LKVLLAIFFAYASFTMWAAYTFRF 367

Query: 368 SLNLRHFSPVWTGGAYFAFILSG-FTIASCVGFXXXXXXXXXXXXXXXTGFTMGNLIFAV 426
           +L  +  + +          +SG F                         F +  ++ A 
Sbjct: 368 NLMAKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLISLLAFLVPPILMAT 427

Query: 427 TPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSFC 486
             A QTYW   F            SFP+++++LS+++P +++G+  SLV  ++NY+ +  
Sbjct: 428 MGAGQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGASLVGAVLNYATALG 487

Query: 487 LGVATTVEKQ-----INSSGDDLLKGYRAAFYTGVGIGTLGISIA 526
              A +V +      +   G+   K      Y G+G   LG  +A
Sbjct: 488 PPTAASVLRYQCPDCMAHKGNAFTKTINIIGYVGIGTAGLGTLVA 532

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  155 bits (392), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 100/133 (75%)

Query: 85  LMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLK 144
           +M QLLNQ GTTQ++ ++N+++  F S T++Q  L AS PLVSGSFILV G+ GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 145 KMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSM 204
             LL GYA + +WS ICGLT Y  S  FF++A+AFQGLG++F+LPN++G V  +Y  GS+
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 205 KKNITISFIGAMA 217
           +KN+  ++  A++
Sbjct: 121 RKNMVYAYTVAVS 133

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 462 QLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQINSSGDDLL 505
            +P   +G A      M+ YS   CLG+A TVE +++  G D L
Sbjct: 146 NIPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  162 bits (410), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 130/471 (27%), Positives = 211/471 (44%), Gaps = 27/471 (5%)

Query: 87  GQLLNQAGTTQSMSIMNIIAEDFGSETSKQ---AWLFASFPLVSGSFILVGGRFGDIYGL 143
           GQ ++  G  Q +  M  IA  F     +     W  A++   + +F+++ G+ GDI G 
Sbjct: 58  GQFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFVIIAGKLGDINGH 117

Query: 144 KKMLLLGYAILTIWSIICGLTHYTHSDD-FFIVAKAFQGLGVSFILPNIIGLVGTIYEPG 202
           K M + GYA LT+WS++ G + Y  ++  FF   +  QG+G +F+ P  + L+G  Y P 
Sbjct: 118 KNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPTGLALLGKHYPP- 176

Query: 203 SMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVP 262
             +KN   SF GA  P G   G +FS +        W WT+++ A+   ++ +  Y F+P
Sbjct: 177 CKRKNYVFSFYGACGPFGIVAGSVFSALFT--QLTTWAWTYWSMAVTCLIITILSYIFIP 234

Query: 263 -DNVPTNTNNL--KMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAYXXXXXXXXXXXXXA 319
            DN P    +     D++G          FS VWNQAP+  +   Y              
Sbjct: 235 KDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVYSLLIVSVVFMTM 294

Query: 320 FFIYEINYAEVPLLP-KAITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVW 378
             I +    + PL+P K++  N  +I  L+ +F G+  F IW FY + F L  ++ S + 
Sbjct: 295 ALIIDSRVKD-PLIPWKSMCSN--VIKALIVVFFGFLGFTIWLFYSWRFYLVAKNDSLLL 351

Query: 379 TGGAYFAFILSGFTIASC--VGFXXXXXXXXXXXXXXXTGFTMGNLIFAVTPADQTYWRN 436
               +    +SG   A+C  V                   F +  ++ +     +TYW N
Sbjct: 352 AAAKFIPLGISGI-FAACFSVLLLNKKVPVQLRLLTAVCAFLICAILISTMTLQETYWGN 410

Query: 437 TFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQ 496
            F            +FP+++++LS+ +  E QG+A +L  T +NY  +   GVAT +   
Sbjct: 411 AFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALGPGVATLI--- 467

Query: 497 INSSGDDLLKGYRAAFYTG------VGIGTLGISIASLYMFETFWTDYKEK 541
           I    DD L      F         V IGT GI++  + +F +    YKE+
Sbjct: 468 ITYQCDDCLARSDGRFVHAVHIAGYVAIGTAGIAVV-VAIFGSITEYYKER 517

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  154 bits (388), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 123/475 (25%), Positives = 210/475 (44%), Gaps = 29/475 (6%)

Query: 73  SKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDF---GSETSKQAWLFASFPLVSGS 129
           S+L E  FI      Q ++ A  +Q++  M+ I   F      + +  W  A+F +  G+
Sbjct: 67  SRLRECMFIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGT 126

Query: 130 FILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDD--FFIVAKAFQGLGVSFI 187
           FI+  G+  D+ G K + + GYA  T+WS++ G++ Y       FF   +  QG+G + +
Sbjct: 127 FIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAAL 186

Query: 188 LPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFA 247
            P+ + L+G  Y P S KKNI  S  G   PLG   GG+FS I       +W W +++ A
Sbjct: 187 FPSSLALLGKYYPP-SCKKNIVFSLYGFCVPLGVVVGGVFSAIFT--QLAHWSWNYWSMA 243

Query: 248 IVS-FLVGVTCYFFVPDNVPTNTNNL---------KMDWIGSAXXXXXXXXFSFVWNQAP 297
           IVS F   ++C++  PD +  +             K D++G+         F+  WNQA 
Sbjct: 244 IVSAFFTLISCFYIPPDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQAT 303

Query: 298 MDGWDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTF 357
              +                 A  I E  Y + P++P A   +   I  LL +F  + +F
Sbjct: 304 GFKFKSVQVYVTLIVSLVCFVAMVIVEF-YVDDPIIP-ARKIHPQTIKALLVVFFSYLSF 361

Query: 358 GIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIAS-CVGFXXXXXXXXXXXXXXXTG 416
            IW FY + +   +R+ + +     +    ++GF  A   +                   
Sbjct: 362 TIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACS 421

Query: 417 FTMGNLIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVN 476
           F + +++F      ++YW   F            SFP+++++LS+ +P E +G++ +LV 
Sbjct: 422 FLLAHILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVG 481

Query: 477 TMVNYSQSFCLGVATTV----EKQINSSG--DDLLKGYRAAFYTGVGIGTLGISI 525
           T +NY       +A T+      +  +SG  D  +K    A    VGIG  GI++
Sbjct: 482 TALNYGTGIGPPIAQTIIGYQCDKCMASGDMDQFVKAIHIA--AAVGIGASGIAV 534

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  150 bits (378), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 127/503 (25%), Positives = 212/503 (42%), Gaps = 35/503 (6%)

Query: 75  LHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSK---QAWLFASFPLVSGSFI 131
           + E   +   +  QL+   G  Q + I   + E +  E +K     W  AS+ L S   +
Sbjct: 36  IREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSAVMV 95

Query: 132 LVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDD-FFIVAKAFQGLGVSFILPN 190
           L+ G+ GD+ G K+M++ G+  LTIWS+I G ++Y   +  F+  A+A QG+G  FI+PN
Sbjct: 96  LIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFIVPN 155

Query: 191 IIGLVGTIY-EPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIV 249
            + ++G  Y EPG +KK I  S  G M   G   G  FS +        W W ++A A V
Sbjct: 156 SLAIMGRTYFEPG-LKKTIIFSIFGMMTSTGFVIGTTFSSL--FAQLTKWAWNYWALACV 212

Query: 250 SFLVGVTCYFFV-PDNVPTNTNN----LKMDWIGSAXXXXXXXXFSFVWNQAPMDGWD-- 302
             L  V    F+ PDN+    N+     + D++G+         F   + QA   GW   
Sbjct: 213 CVLYTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGWSPP 272

Query: 303 KAYXXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSF 362
             Y              F  + ++   VPL  + +  +  +++IL+ ++ G+ +F IW+ 
Sbjct: 273 HTYITLIIGVILILIAMFVDWRVDDPLVPL--QHLRAD--VVVILICVYFGFLSFVIWAN 328

Query: 363 YYFSFSLNLRHFSPVWTGGAYFAFILSGFTIAS-CVGFXXXXXXXXXXXXXXXTGFTMGN 421
           +++ F   + + SP+          +     A   V                   F + N
Sbjct: 329 WFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVPN 388

Query: 422 LIFAVTPADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNY 481
           ++ A    + TYW   F            + P ++++ SD +  E QG+A SL+ T+++Y
Sbjct: 389 ILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVISY 448

Query: 482 SQSFCLGVATTVEKQINSSGDDLLKG-----YRAAFYTGV---GIGTLGISIASLYMFET 533
           + S        V   +   G+D   G       + F  G+   GIG +   IA L     
Sbjct: 449 AISIGPSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFICGIVLSGIGLVTAVIAGL----- 503

Query: 534 FWTDYKEKTKLANDIESSIERTG 556
              DYK       DI   + + G
Sbjct: 504 --IDYKITRTHCGDIPPPLSKIG 524

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  137 bits (344), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 127/543 (23%), Positives = 223/543 (41%), Gaps = 83/543 (15%)

Query: 72  SSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFG---SETSKQAWLFASFPLVSG 128
           +S L++  FIF     Q +  A  +Q++  M+ ++  F    + T +  W+ ASF +  G
Sbjct: 66  NSYLNDIIFIFLICSSQFITLASASQAILQMDSLSVWFKIPPTSTLQLGWVNASFAMTCG 125

Query: 129 SFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFI-VAKAFQGLGVSFI 187
           +FI++ G+  DI   + + + GY   ++W++I G   Y   +  F+ + +  QG+G + +
Sbjct: 126 AFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFLYICRGCQGIGGALL 185

Query: 188 LPNIIGLVGTIY--------------------EPG------------------------- 202
            P+ + L+   Y                     P                          
Sbjct: 186 FPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDDDNDGDSSIADDSDI 245

Query: 203 -SMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFV 261
               K+I  S  GA APLG   GG+FS I        WPW +++ +IV+ L+ +  YF+V
Sbjct: 246 ICTSKSIAFSLYGACAPLGIVIGGIFSAIF--TQLATWPWNYWSMSIVTTLLSILSYFYV 303

Query: 262 PDNVP-----TNTNNLK----MDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAYXXXXXXX 312
              +P     +N N+LK     D++G          F   W+QA M  +   +       
Sbjct: 304 VVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWDQATMYKFKTIHVYLTLLF 363

Query: 313 XXXXXXAFFIYEINYAEVPLLPKAITGNRHI----IMILLAIFMGWGTFGIWSFYYFSFS 368
                 A  I+E  Y   P++P      R I    I  LL +F  + +F  W FY +   
Sbjct: 364 SLVSFIAMIIWE-YYFNNPIIPI-----RQIHPGTIKALLVVFFSYISFTQWLFYTWKLF 417

Query: 369 LNLRHFSPVWTGGAYFAFILSGFTIAS-CVGFXXXXXXXXXXXXXXXTGFTMGNLIFAVT 427
             ++  SP+     +    ++G   A+  +                 + F + +++    
Sbjct: 418 TEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSFLLSHILLLTC 477

Query: 428 PADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSFCL 487
             D +YW   F            SFP+++++L++ +PPE QG+  +LV +++NY  +   
Sbjct: 478 KLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGSVLNYGTAIGP 537

Query: 488 GVATT-VEKQINSSGDD------LLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKE 540
            +A T ++ Q  S   D       LKG   A   GVG   + + I    ++ T  T+Y  
Sbjct: 538 PIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSGIAVLIG---IYGTI-TEYSW 593

Query: 541 KTK 543
           KTK
Sbjct: 594 KTK 596

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 90/198 (45%), Gaps = 21/198 (10%)

Query: 35  QKIDSSEQVVPTDSEKYFATVRXXXXXXXXXQKPQYFSSKLHEWAFIFTCLMGQLLNQAG 94
           Q +D +  ++P   E                QK   ++  L ++  +F+  +G  L+   
Sbjct: 2   QTLDETSNLLPVPEE---------VETLPLEQKFHEYNLALPKFPILFSLWLGSFLSSLD 52

Query: 95  TTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAIL 154
            T   +IMN +AE+F SE+S++ W+  SF L + +F  + G+  DI G K  LL  +   
Sbjct: 53  GTIVANIMNRVAEEF-SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHF-- 109

Query: 155 TIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVG-----TIYEPGSMKKNIT 209
             + I C LT +  +   F +A+A  G+G   +  N IG +      T  E G  +    
Sbjct: 110 -FFGIGCLLTCFARNVTEFSIARAICGIGAGGL--NAIGSIAVSDICTARERGVYQGYAN 166

Query: 210 ISFIGAMAPLGATFGGLF 227
           I F G    LGA  GG+F
Sbjct: 167 IVF-GLGQLLGAPLGGVF 183

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 83/165 (50%), Gaps = 8/165 (4%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           QK   ++  L ++  +F+  +G  L+   +T   +IMN +AEDF SE+S++ W+  SF L
Sbjct: 24  QKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLL 82

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGL--- 182
            + +F  + G+  DI G K  LL+       + + C LT +  +   F +A+A  G+   
Sbjct: 83  TNTAFQPLYGKLSDITGRKSALLIAQF---FFGLGCLLTCFARNVTEFSIARAICGIGAG 139

Query: 183 GVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLF 227
           G++ I    +  + T  E G  +    I F G    LGA  GG+F
Sbjct: 140 GLNAISSIAVSDICTARERGVYQGYANIVF-GFGQLLGAPLGGVF 183

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 82/165 (49%), Gaps = 8/165 (4%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           QK   ++  L ++  +F+  +G  L+   +T   +IMN +AE+F SE+SK+ W+  SF L
Sbjct: 24  QKFHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLL 82

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGL--- 182
            + +F  + G+  DI G K  LL        + + C LT +  +   F +A+A  G+   
Sbjct: 83  TNTAFQPLYGKLSDITGRKSALLTAQF---FFGLGCLLTCFARNVTEFSIARAICGIGAG 139

Query: 183 GVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLF 227
           G++ I    +  + T  E G  +    I F G    LGA  GG+F
Sbjct: 140 GLNAISSIAVSDICTARERGVYQGYANIVF-GFGQLLGAPLGGVF 183

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 97/507 (19%), Positives = 179/507 (35%), Gaps = 57/507 (11%)

Query: 88  QLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKML 147
            LLN A     +S+++ +A+ +    +  +W   S+ +    FI   GR GDI G   + 
Sbjct: 41  DLLNVASM---ISLIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLF 97

Query: 148 LLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKN 207
            +  +   I S++C +     +   F V +A QG+  + ++P    L+  +     ++K 
Sbjct: 98  TISCSCFAILSLLCAVMPNFPA---FAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 208 ITISFIG--AMAPLGATFGGLFSGIVVVKDDKNWPWTFY-AFAIVSFLVGVTCYFFV--- 261
            +I   G  +   LG   GG F+   +      +   FY  FA++S L+ V  +FF    
Sbjct: 155 FSIVSCGFSSTIGLGLIIGGAFAATKI-----GYRGIFYLTFAVMS-LISVIAFFFTYNV 208

Query: 262 ------PDNVPTNTNNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAYXXXXXXXXXX 315
                 P  +   T+   +D+IGS               +   + W++            
Sbjct: 209 ENFDKKPQKIQAQTSVKSLDFIGSLIFVAGSILIVVGLTEGG-ESWNRPVTYVTLIIGIL 267

Query: 316 XXXAFFIYEINYAEVP-------------------LLPKAITGNRHIIMILLAIFMGWGT 356
               FF++   YA++                    L+P  +   ++ I I+LA  +    
Sbjct: 268 LFFGFFVWNCTYAKIVRGIRFVGIDTSKYFEKVQLLIPVDVLFMKNFIPIVLAFALNNAC 327

Query: 357 FGIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXXXXXXXXXXXXXXXTG 416
                +    +S      SP+  G      I+      +   F               + 
Sbjct: 328 LFSCLYIIDQYSQYAEKDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGFSL 387

Query: 417 FTMGNLIFAVTP--ADQTYWRNTFXXXXXXXXXXXXSFPASSIILSDQLPPEYQGMAGSL 474
              G++I        D  +W+  F             +P +  I     P + +G+A  +
Sbjct: 388 ALAGSIILIQLHLIKDNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGV 447

Query: 475 VNTMVNYSQSFCLGVATTVEKQINS--SGDDLLKGYRAAF----YTGVGIGTLGISIASL 528
             T           V  +V   IN     +D ++ +R  F    Y  V +G LG  + ++
Sbjct: 448 AQTFGQLGIEITFSVMASVLGDINEMKGKEDAIQNFRTGFQNCSYFTVAVGALGFLVTAI 507

Query: 529 YMFETFWTDYKEKTKLANDIESSIERT 555
            +      D        +D+ESSI RT
Sbjct: 508 CI-----RDIHTPNDDISDLESSIHRT 529

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 91/196 (46%), Gaps = 17/196 (8%)

Query: 35  QKIDSSEQVVPTDSEKYFATVRXXXXXXXXXQKPQYFSSKLHEWAFIFTCLMGQLLNQAG 94
           + +D +  ++P   E     +          QK   ++  L ++  +F+  +G  L+   
Sbjct: 2   ETLDETANLLPAPEEAEVLPLE---------QKYHEYNLALPKFPILFSLWLGSFLSSLD 52

Query: 95  TTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAIL 154
           +T   +IMN +AE+F SE+SK+ W+  SF L + +F  + G+  DI G +  LL      
Sbjct: 53  STIVANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQF-- 109

Query: 155 TIWSIICGLTHYTHSDDFFIVAKAFQGL---GVSFILPNIIGLVGTIYEPGSMKKNITIS 211
             + + C +T +  +   F +A+A  G+   G++ I    +  + T  E G  +    I 
Sbjct: 110 -FFGLGCLMTCFARNVTEFSIARAVCGIGAGGLNAISSIAVSDICTARERGVYQGYANIV 168

Query: 212 FIGAMAPLGATFGGLF 227
           F G    LGA  GG+F
Sbjct: 169 F-GFGQLLGAPLGGIF 183

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 71/149 (47%), Gaps = 6/149 (4%)

Query: 82  FTC-LMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDI 140
           F C L+   L+ A     + ++  I   F    ++  W   S+ +    FI   GR GDI
Sbjct: 25  FICILIACGLDLASVGAMIVLVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDI 84

Query: 141 YGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYE 200
            G   M+ +   I  I+S++C +     +   F V +AFQG+  + I+P    LV  +++
Sbjct: 85  VGNGIMMCVFSVIFGIFSLLCAVVPNFIA---FTVFRAFQGMAGAGIVPCAYALVNKMFQ 141

Query: 201 PGSMKKNITI--SFIGAMAPLGATFGGLF 227
             ++++  +I  S I AMA +G   GG F
Sbjct: 142 GPNLQRYFSILSSVISAMAGVGFIIGGAF 170

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/295 (20%), Positives = 117/295 (39%), Gaps = 40/295 (13%)

Query: 100 SIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSI 159
           ++++ IA +F +E  + +W+  ++ L S +F  + G+  DI+G + +L+    +  + ++
Sbjct: 162 TLLDHIASEF-NELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGAL 220

Query: 160 ICGLTHYTHSDDFFIVAKAFQGLG-------VSFILPNIIGLVGTIYEPGSMKKNITISF 212
           ICG++         ++ +   G+G        S    +I+ L        ++ + I   F
Sbjct: 221 ICGMSKNLW---VLVLGRFVAGIGGGGLTSMCSITTTDIVPL-----RSRALYQGICNVF 272

Query: 213 IGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFL--VGVTCYFFVPDNVPTN-- 268
            G     G   GGLF+   V      W   F     ++ L    +  +  +P  V  +  
Sbjct: 273 FGLGTACGGLVGGLFADRAV-----GWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKG 327

Query: 269 --------TNNLKM-DWIGSAXXXXXXXXFSFVWNQAPMDGWDKAYXXXXXXXXXXXXXA 319
                   T  L+M DW G+         F+ V +   + G D  +              
Sbjct: 328 AGQRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSY 384

Query: 320 FFIYEINYAEVPLLPKAITGNRHIIMILLA---IFMGWGTFGIWSFYYFSFSLNL 371
           F  +E+  A  P+LP     NR ++   L+     MG  T G +   Y++  LN+
Sbjct: 385 FIYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM 439

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 82/168 (48%), Gaps = 14/168 (8%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           ++   ++  L ++  + +  +G  L+   +T   +IMN +AE+F  E+ K+ W+  SF L
Sbjct: 28  EQYHEYNLSLPKFPILLSLWLGSFLSSLDSTIVANIMNKVAEEF-EESDKKQWIATSFLL 86

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILT---IWSIICGLTHYTHSDDFFIVAKAFQGL 182
            + +F  + G+  DI G K      +A+LT    + + C LT +  +   F +A+A  G+
Sbjct: 87  TNTAFQPLYGKLSDITGRK------FAVLTSHFFFGLGCFLTCFAQNITQFSIARAICGI 140

Query: 183 ---GVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLF 227
              GV+ +    +  + +  E G  +    I F G    LGA  GGLF
Sbjct: 141 GAGGVNAMSSITVSDICSTRERGIYQGYANIVF-GLGQLLGAPLGGLF 187

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 68/144 (47%), Gaps = 12/144 (8%)

Query: 89  LLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLL 148
           LLN AG    +S++  + E +    +  +W   S+ +    FI   GR GDI G   +  
Sbjct: 41  LLNVAGV---ISVIEDLGETYKLGYTGASWALTSYAITFAGFIAFMGRLGDIVGNSVLFT 97

Query: 149 LGYAILTIWSIICGLTHYTHSDDF--FIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKK 206
           +   + T++S++C +       DF  F V +A QG+  + I+P    L+  + EP  ++K
Sbjct: 98  ISCFLFTLFSLLCAVVR-----DFPTFAVFRALQGISAAGIVPCGYALIPLLAEPQDIQK 152

Query: 207 NITISFIG--AMAPLGATFGGLFS 228
             +I   G  +   +G   GG F+
Sbjct: 153 FFSIVSCGFSSTIGIGLIVGGAFA 176

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 89/212 (41%), Gaps = 22/212 (10%)

Query: 79  AFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFG 138
           A IF      LLN A     +S+++ +A+ +    +  +W   S+ +    FI   GR G
Sbjct: 32  ALIFLGCTFDLLNVASM---ISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLG 88

Query: 139 DIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTI 198
           DI G   +  +      I S++C +     +   F V +A QG+  + ++P    L+  +
Sbjct: 89  DIVGNSILFTVSCFFFAILSLLCAVMPNFPA---FAVFRAIQGISAAGLVPCAYALIPML 145

Query: 199 YEPGSMKKNITISFIG--AMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVT 256
                ++K  +I   G  +   LG   GG F+   +      +   FY    V FL+ + 
Sbjct: 146 APEEEVQKYFSIVSCGFSSTIGLGLIIGGAFAATKI-----GYKGIFYLTFAVMFLISIV 200

Query: 257 CYFFV--------PDNVPTNTNNLK-MDWIGS 279
            +FF         P      TN ++ +D+IGS
Sbjct: 201 AFFFTYGVENLSEPPRKDQATNRVRSLDFIGS 232

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 71/149 (47%), Gaps = 14/149 (9%)

Query: 99  MSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWS 158
           ++I+N IA+ F +  SK  WL   + L +  F L+ GRF  I+G K  L++   I  I S
Sbjct: 41  VTILNTIADKFNAY-SKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 159 IICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTI---YEPGSMKKNITISFIGA 215
           ++  +   ++S D  I  +   G G S I   +  +  ++   +  G++   +++S+  A
Sbjct: 100 LVIAV---SNSMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHTRGTIVTLLSLSYAVA 156

Query: 216 MAPLGATFGGLFSGIVVVKDDKNWPWTFY 244
            A LG   GG  +  V       W W FY
Sbjct: 157 SA-LGPYIGGALTEYV------TWRWCFY 178

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 115/283 (40%), Gaps = 45/283 (15%)

Query: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145
           +G  L  A  T   +IM  IA +F +E  + +W+  ++ L S +F  + G+  DI+G K 
Sbjct: 87  LGIFLAAADGTLVSTIMAHIASEF-NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKP 145

Query: 146 MLLLGYAILTIWSIICGLTHYTHSDDF--FIVAKAFQGLG-------VSFILPNIIGLVG 196
           +L+L   +  +  ++CGLT       F   + A+   G+G        S  + +I+ L  
Sbjct: 146 LLMLNNIVFLVGCLMCGLT-----PSFWGLVGARFISGIGGGGVTSMCSITISDIVPL-- 198

Query: 197 TIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFY----AFAIVSFL 252
                 ++ + +   F G     G   GG FS          W   F       A+ S L
Sbjct: 199 ---RDRALYQGMCNFFFGLGTACGGVVGGWFS-----DHGGGWRMAFLIQVPLSALSSLL 250

Query: 253 VGVTCYFFVPD-----NVPTNTNN--LKMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAY 305
           + V  +  +P      N P +  N  L +DWIG++        F      A + G + A+
Sbjct: 251 IAV--FMKLPPRSKRVNSPASIKNKLLSVDWIGASALVVFLSLFLVT---ASLGGKEIAF 305

Query: 306 XXXXXXXX---XXXXXAFFI-YEINYAEVPLLPKAITGNRHII 344
                           AFFI  E+  A+ P+LP +   NR ++
Sbjct: 306 NSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVL 348

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 75/178 (42%), Gaps = 12/178 (6%)

Query: 69  QYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSG 128
           Q F + +  WA + + ++   L         +I+  +++ FG + SK  WLF  + L + 
Sbjct: 34  QRFPTGVELWAPLGSLVLCLFLAALDVMTVSTIIEEVSQKFG-DYSKVGWLFTGYSLPNA 92

Query: 129 SFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFIL 188
             +L+ GR   + G K   L    I  + S++  L    +S D  I  +   G+G S + 
Sbjct: 93  LLVLIWGRIATLVGFKTSTLAAIVIFEVGSLVSAL---ANSMDMLIGGRVIAGIGGSGVQ 149

Query: 189 PNIIGLVGTIYEPGSMKKNITI--SFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244
             +  +  T+ E  +    I +  S  G  + +G   GG F+  V       W W FY
Sbjct: 150 SLVFVISSTLVEERNRGLIIAVMSSSFGIASVVGPFLGGAFTTHV------TWRWCFY 201

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 73/148 (49%), Gaps = 14/148 (9%)

Query: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145
           +G   +   +T   +IMN +AE+F +E+ K+ W+  SF L + +F  + G+  DI G K 
Sbjct: 51  LGSFFSSLDSTIVANIMNRVAEEF-AESDKKQWIATSFLLTNTAFQPLYGKLSDITGRK- 108

Query: 146 MLLLGYAILT---IWSIICGLTHYTHSDDFFIVAKAFQGLGVSFI--LPNI-IGLVGTIY 199
                +A+LT    + + C LT +  +   F +A+A  G+G   I  + +I    + T  
Sbjct: 109 -----FAVLTAHFFFGLGCLLTCFAQNVTQFSIARAICGMGAGGINAMSSITTSDICTTR 163

Query: 200 EPGSMKKNITISFIGAMAPLGATFGGLF 227
           E G  +    I F G    LGA  GGLF
Sbjct: 164 ERGIFQGYANIVF-GMGQVLGAPLGGLF 190

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 54/104 (51%), Gaps = 4/104 (3%)

Query: 75  LHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVG 134
           L +   +F+  MG  L     T   +IMN +AE+F  E+ K+ W+  SF L + +F  + 
Sbjct: 48  LPKLPIVFSLWMGSFLGALDGTIVANIMNRVAEEF-QESDKKQWIATSFLLTNTAFQPLY 106

Query: 135 GRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKA 178
           G+  DI G K  LL+ +   T + + C LT +  +   F +A+A
Sbjct: 107 GKLSDITGRKFALLVAH---TFFCLGCLLTCFARNVTEFSIARA 147

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 54/103 (52%), Gaps = 4/103 (3%)

Query: 81  IFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDI 140
           +++  MG  L    +T   +IMN +AE+F  E+ K+ W+  SF L + +F  + G+  D+
Sbjct: 43  LYSLWMGSFLGSLDSTIVANIMNKVAEEF-EESDKKQWIVTSFLLTNTAFQPLYGKLSDL 101

Query: 141 YGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLG 183
            G K  L++ ++   +    C  T  + +   F +A+A  G+G
Sbjct: 102 AGRKTALMVAHSFFLVG---CLFTALSRNLVEFSIARAVCGMG 141

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 64/145 (44%), Gaps = 8/145 (5%)

Query: 100 SIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSI 159
           +I+  +A +FG + SK  W++A + L S    L+ GR   + G K  +L    I  + S+
Sbjct: 77  TIIENVAREFG-DYSKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSL 135

Query: 160 ICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPL 219
           +  L    +S D  I  +   GLG S I      ++ T+ E    K+ + I+ +G+   +
Sbjct: 136 VAAL---ANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEES--KRGLLIACMGSAFGI 190

Query: 220 GATFGGLFSGIVVVKDDKNWPWTFY 244
            +  G    G         W W F+
Sbjct: 191 ASVVGPFLGG--AFTTHVTWRWCFW 213

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 80/168 (47%), Gaps = 14/168 (8%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q+    +  L +   + +  +G  L+    T   +IMN +AE+F  E+ K+ W+  S+ L
Sbjct: 25  QEYHEHNLSLPKLPIVLSLWLGSFLSSLDGTIVANIMNRVAEEF-QESDKKQWIATSYLL 83

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILT---IWSIICGLTHYTHSDDFFIVAKAFQGL 182
            + +F  + G+  D+ G K      +A+LT    + + C LT + +S   F +A+A  G+
Sbjct: 84  TNTAFQPLYGKLSDLTGRK------FAVLTAHFFFGLGCLLTCFANSVTQFAIARAICGV 137

Query: 183 ---GVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLF 227
              G++ +    +  + T  E G  +    I F G    LGA  GGLF
Sbjct: 138 GGGGINAMSSITVSDICTQRERGIYQGYANIVF-GLGQILGAPIGGLF 184

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 49/93 (52%), Gaps = 4/93 (4%)

Query: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145
           +G  ++    T   +IMN +AE+F SE+ K+ W+  SF L + +F  + G+  D+ G K 
Sbjct: 43  LGSFVSSLDGTIVANIMNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKF 101

Query: 146 MLLLGYAILTIWSIICGLTHYTHSDDFFIVAKA 178
            LL+ Y  L I    C LT    +   F VA+A
Sbjct: 102 ALLMAYFFLVIG---CLLTCLARNVTEFAVARA 131

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 87/459 (18%), Positives = 156/459 (33%), Gaps = 45/459 (9%)

Query: 76  HEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGG 135
           H +  +   ++    +    T  +S    I   +  E +  +W   ++ +    FI   G
Sbjct: 22  HRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTTASWALTAYAITFAGFIAFLG 81

Query: 136 RFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLV 195
           R GDI G   + +    + +I S+IC + +   +   F V +A QG+  + I+P+   L+
Sbjct: 82  RVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGT---FAVFRALQGIAAAGIVPSGYALI 138

Query: 196 GTIYEPGSMKKNITISFIGAMAPLGATF--GGLFSGIVVVKDDKNWPWTFYAFAIVSFLV 253
            T+ +   ++    I   G     G  F  GG F+   +      +   FY    V  ++
Sbjct: 139 PTLSDEHEVQSFFAIVSCGFSTSFGIGFIIGGAFTLTRI-----GYKGIFYLTFAVMLVI 193

Query: 254 GVTCYFFV---------PDNVPTNT---NNLKMDWIGSAXXXXXXXXFSFVWNQAPMDGW 301
            +  YF +           + P  T   + L +D+IGS               +   + W
Sbjct: 194 SIISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFMFISSTILIVVGLTEGG-ESW 252

Query: 302 DKAYXXXXXXXXXXXXXAFFIYEINY---------AEVP-----------LLPKAITGNR 341
            K                FFI+ I Y         A  P           L+PK +   +
Sbjct: 253 KKPSAYVTLIVGIALFVLFFIWNICYGVLVKNLKSASNPKVYNYFRTIQVLIPKDVLMMK 312

Query: 342 HIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFXX 401
           + I I +A+F  +G      +    +   +   SP+         ++S       +    
Sbjct: 313 NFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKLLPLVVSMLIPNVVIAIKS 372

Query: 402 XXXXXXXXXXXXXTGFTMGNLIFAVTP--ADQTYWRNTFXXXXXXXXXXXXSFPASSIIL 459
                            +G++I        D  YW+  F             FP S  IL
Sbjct: 373 DLISPRKAVVLGFFIMFIGSIILIQLHLITDNLYWKIFFCSQSLIAFGAAIFFPYSLNIL 432

Query: 460 SDQLPPEYQGMAGSLVNTMVNYSQSFCLGVATTVEKQIN 498
               P EY+G+A  ++ T   +       V T++   IN
Sbjct: 433 IGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNIN 471

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 61/128 (47%), Gaps = 8/128 (6%)

Query: 79  AFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFG 138
           A IF      LLN AG    +S++  + E +G E +  +W   S+ +     I   GR G
Sbjct: 35  ALIFLGCTFDLLNVAGV---ISVIEDLGETYGLEYTTASWALTSYAITFAGLIAFMGRLG 91

Query: 139 DIYGLKKMLLLGYAILTIWSIICG-LTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGT 197
           DI G   +  +     +++ ++C  +T++      F V +A QG+  + ++P    L+ T
Sbjct: 92  DIIGNSVLFTISGFFFSLFCLLCAVVTNFPA----FAVLRALQGIAAAGLVPCGYALIPT 147

Query: 198 IYEPGSMK 205
           + +P  ++
Sbjct: 148 LADPEDVQ 155

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 97/230 (42%), Gaps = 22/230 (9%)

Query: 37  IDSSEQ-----VVPTDSEKYFATVRXXXXXXXXXQKPQYFSSKLHEWAFIFTCLMGQLLN 91
           +D SE      ++P DS +Y              Q+ Q  +  L +   + +  +G  L 
Sbjct: 1   MDESESQLRGTLLPHDSLEYGTN---SDKTLTETQRCQEHNRSLPKAPILTSLWLGSFLA 57

Query: 92  QAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGY 151
               +   +IMN IAE+F  E+ K+ W+  SF L + +F  + GR  DI G K  LL+  
Sbjct: 58  SIDASIVANIMNKIAEEF-HESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQ 116

Query: 152 AILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNI---IGLVGTIYEPGSMKKNI 208
           +   + ++   LT +  +   F +A+A  G+G   I       +  + T  E G  +   
Sbjct: 117 SFFLLGTL---LTCFARNVTEFAIARAICGMGGGGIGAMSSITVSDICTTKERGMYQGYA 173

Query: 209 TISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCY 258
            + F GA   LGA  GGL      + +  NW   F A  +   +  +  Y
Sbjct: 174 NVIF-GAGQVLGAPVGGL------IMETFNWRIIFAAQVVAIMICMILAY 216

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 68/160 (42%), Gaps = 14/160 (8%)

Query: 100 SIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSI 159
           +I++++AE FG+  SK  WL   + L +    L+ GRF  I G +  L+L   I    S+
Sbjct: 59  TIIDVVAEQFGNY-SKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSL 117

Query: 160 ICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPL 219
           I  L     S +  I  +   G+G S  L  +  ++G     G   + + IS +     +
Sbjct: 118 IAAL---ASSMNMLIFGRVVAGVGGSG-LQTLCFVIGCTM-VGERSRPLVISILSCAFAV 172

Query: 220 GATFGGLFSGIVVVKDDKNWPWTFY------AFAIVSFLV 253
            A  G +  G         W W FY        AI+ FL+
Sbjct: 173 AAIVGPIIGG--AFTTHVTWRWCFYINLPIGGLAIIMFLL 210

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 122/316 (38%), Gaps = 44/316 (13%)

Query: 81  IFTCLM--GQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFG 138
           I  C M  G  L     T   ++M  I  +F ++  K  W+  S+ L S  F  + G+  
Sbjct: 398 IIMCSMYLGVFLAALDNTVVSTLMAHIGSEF-NQIPKVPWVATSYLLSSAVFQPLYGKLS 456

Query: 139 DIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLG-------VSFILPNI 191
           DI+G K +L+    I     IICG+   ++S +  +  +   G+G        +  + +I
Sbjct: 457 DIFGRKALLIFSNLIFFFGCIICGM---SNSLNMLVWGRFVAGIGGGGITSMTTITVSDI 513

Query: 192 IGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSF 251
           + L        ++ + I   F G    LG  FGG+  GI  V     W   F++   VS 
Sbjct: 514 VPL-----RSRAVYQGICNFFFG----LGTAFGGVIGGI-FVDHQYGWRMVFWSQVPVSG 563

Query: 252 LVG-VTCYFFVPDNVPTNTNN--------LKMDWIGSAXXXXXXXXFSFVWNQAPMDG-- 300
           L   + C F V   VP   N         +++DW+GS         F  +     M G  
Sbjct: 564 LSTLLICSFLV---VPRIKNYEVSLGRKLMRVDWLGSISMILWLTSFLLITTM--MGGIS 618

Query: 301 --WDKAYXXXXXXXXXXXXXAFFIYEINYAEVPLLPKAITGNRHIIMILLAIF---MGWG 355
              D                 F + E+  A  P+LP     NR ++   L  F   MG+ 
Sbjct: 619 LDIDSDQFHYLIMFSSVSAIIFVLTELFVASDPVLPLRFLSNRSVLGASLGNFFCVMGFM 678

Query: 356 TFGIWSFYYFSFSLNL 371
           T   +   YF+  L++
Sbjct: 679 TICFYLPIYFASVLDI 694

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 70/145 (48%), Gaps = 8/145 (5%)

Query: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145
           +G  L+   +T   +IMN +AE+F     KQ W+  SF L + +F  + G+  DI G K 
Sbjct: 42  LGSFLSSIDSTIVANIMNKVAEEFQESQEKQ-WIATSFLLTNTAFQPLYGKLSDITGRKF 100

Query: 146 MLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAF---QGLGVSFILPNIIGLVGTIYEPG 202
            LL     L+ + + C LT  + +   F +A+A     G G++ I    +G + T  + G
Sbjct: 101 ALLTA---LSFFGLGCFLTSLSTNIKQFAIARAICGIGGGGINAISSITVGDICTAKDRG 157

Query: 203 SMKKNITISFIGAMAPLGATFGGLF 227
             +    I F G    LGA  GGLF
Sbjct: 158 IYQGYANIVF-GMGQLLGAPVGGLF 181

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 61/143 (42%), Gaps = 8/143 (5%)

Query: 102 MNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIIC 161
           + +IAE F  + SK  W+ + + L      L+ GRF  I G K  LL+   I    S+I 
Sbjct: 142 IEVIAEQF-KDYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLIS 200

Query: 162 GLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGA 221
            +   ++S +  I  +   G+G S I  ++  ++ +   P    + I IS +     + A
Sbjct: 201 AI---SNSMNMLIGGRVVAGIGGSGI-QSLCFVIASTLTP-DRSRVIIISVLSCSYAVAA 255

Query: 222 TFGGLFSGIVVVKDDKNWPWTFY 244
             G    G   +     W W FY
Sbjct: 256 VVGPFLGG--ALTTHVTWRWCFY 276

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 66/149 (44%), Gaps = 14/149 (9%)

Query: 99  MSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWS 158
           +++ + I ++F ++ +   WL A + L +  F+L+ GR   + GLK  L+    I    S
Sbjct: 28  ITLYDTIGQEF-NDYANVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGS 86

Query: 159 IICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAP 218
           ++ G     +S    I A+   G G S I   + G+  +I E     + IT+  I  M  
Sbjct: 87  LMAG---AANSMGMLIGARVISGFGGSGIESLVYGVGTSIVEEKHRARVITVLGIAYMLA 143

Query: 219 LGA---TFGGLFSGIVVVKDDKNWPWTFY 244
            GA     GGL        +  +W W FY
Sbjct: 144 EGAGPFVGGGL-------AEHVSWRWCFY 165

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 83/201 (41%), Gaps = 18/201 (8%)

Query: 88  QLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKML 147
            LLN A     +S+++ +A+ +    +  +W   S+ +    FI   GR GDI G   + 
Sbjct: 41  DLLNVASM---ISLIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLF 97

Query: 148 LLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKN 207
            +  +   + S++C +     +   F V +A QG+  + ++P    L+  +     ++K 
Sbjct: 98  TISCSCFAVLSLLCAVMPNFPA---FAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKY 154

Query: 208 ITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFV------ 261
            +I   G  + +G    GL  G         +   FY    V  L+ +  +FF       
Sbjct: 155 FSIVSCGFSSTIGL---GLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKL 211

Query: 262 ---PDNVPTNTNNLKMDWIGS 279
              P     +T+   +D+IGS
Sbjct: 212 NKKPQKDQASTSVKSLDFIGS 232

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 65/148 (43%), Gaps = 14/148 (9%)

Query: 100 SIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSI 159
           +I+  ++ DF +E SK  WL   + L +    LV GR   I G K  +LL   I  + S+
Sbjct: 65  TIIETVSRDF-NEYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSL 123

Query: 160 ICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITI---SFIGAM 216
           +  L    +S +  I  +   G+G S +      ++ T+    S    I++   SF  A 
Sbjct: 124 VSAL---ANSMNMLIGGRVISGVGGSGLQTLCFLIISTLVNERSRGMAISVLSCSFAVA- 179

Query: 217 APLGATFGGLFSGIVVVKDDKNWPWTFY 244
           + +G   GG F+  V       W W FY
Sbjct: 180 SIVGPFLGGAFTTHV------TWRWCFY 201

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 70/160 (43%), Gaps = 8/160 (5%)

Query: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145
           M   L     T   +IMN + E+F  E+ +  W+  SF L S  F  + G+  D+ G + 
Sbjct: 55  MANFLASMDRTIIANIMNSVTEEF-KESHRIQWVATSFLLTSTVFQPIYGKLSDVTGRRF 113

Query: 146 MLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMK 205
           +L+L Y++  +    C +T Y  +   F   +A  G+G   I    +  +G ++     +
Sbjct: 114 VLVLAYSLFLLG---CLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFSVK--E 168

Query: 206 KNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
           ++I  S+   +  +G   G    GI +  +   W   F A
Sbjct: 169 QSIYQSYAHIIYTIGEVLGAPIGGIAL--ETVGWRAIFLA 206

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 68/150 (45%), Gaps = 16/150 (10%)

Query: 99  MSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWS 158
           +++   I E F ++ +   WL   + L S  F L+ GR   + GLK  L+L   I  I S
Sbjct: 64  VTLYETIGEKF-NDYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGS 122

Query: 159 IICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTI----YEPGSMKKNITISFIG 214
           +I  +   ++S    I  +   G G S I  +++ +VGT        G +   +T +F+G
Sbjct: 123 LIAAV---SNSMGMLIAGRVVAGAGGSGI-QSLVYIVGTSLVSERSRGMVIMVLTFAFVG 178

Query: 215 AMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244
           + A  G   GG       + +  +W W F+
Sbjct: 179 SNAG-GPILGG------ALNEHASWRWCFF 201

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 4/93 (4%)

Query: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145
           +G  +     T   +IMN +AE+F  E+ K+ W+  SF L + +F  + G+  DI G + 
Sbjct: 41  LGSFIGSLDGTIVANIMNRVAEEF-EESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRF 99

Query: 146 MLLLGYAILTIWSIICGLTHYTHSDDFFIVAKA 178
            LL  +     + + C LT +  S + F +A+A
Sbjct: 100 ALLTAHF---FFGLGCLLTCFAQSVEQFALARA 129

>KLTH0G19668g Chr7 (1702771..1704297) [1527 bp, 508 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W TNA1 High affinity nicotinic acid plasma
           membrane permease
          Length = 508

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 50/121 (41%), Gaps = 8/121 (6%)

Query: 157 WSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAM 216
           WSII   + +  S    I  +   G       P ++ LV  IY+P    K I  +F  + 
Sbjct: 144 WSIITLCSGFVKSYHSLIALRVLLGAFEGGYFPAMVLLVSMIYKPEEQAKRI--AFFFSC 201

Query: 217 APLGATFGGLFS-GIVVVKDD---KNWPWTFYAFAIVSFLVGVTCYFFVPDNV--PTNTN 270
           A L   FGGL + G+  V        W W +    +VS    V  YF +P +V  P   N
Sbjct: 202 AALAGAFGGLIATGLATVHGAGGLNGWRWLYIIEGLVSTTAAVWIYFGLPTDVEMPAFMN 261

Query: 271 N 271
           N
Sbjct: 262 N 262

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 86/196 (43%), Gaps = 38/196 (19%)

Query: 105 IAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLT 164
           +A +F ++ SK +W+  S+ L S +F  + G+  DI+G K +L+       I  ++CGL 
Sbjct: 138 VASEF-NQLSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGL- 195

Query: 165 HYTHSDDF--FIVAKAFQGLG-------VSFILPNIIGLVGTIYEPGSMKKNITISFIGA 215
               S  F   ++A+   G+G        S  + +++ L        +M + I   F G 
Sbjct: 196 ----SKSFWWLVIARFVAGVGGGGLTSMSSITITDLVPL-----RERAMYQGICNVFYGL 246

Query: 216 MAPLGATFGGLFSGIVVVKDDK-NWPWTFY---AFAIVSFLVGVTCYFFVPDNVPT-NTN 270
               G   GG FS      D+K  W   F      + +S LV +  +  +P    T N +
Sbjct: 247 GTACGGIVGGWFS------DNKGGWRMAFLIQVPLSAISLLV-IILHLKLPSKRATRNQD 299

Query: 271 N------LKMDWIGSA 280
           N      L +DW+G++
Sbjct: 300 NSIKRKLLAIDWLGAS 315

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 71/179 (39%), Gaps = 17/179 (9%)

Query: 100 SIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSI 159
           +I++++AE FG+  SK  WL   + L +    LV GRF  I G +  L+L   I    S+
Sbjct: 57  TIIDVVAEQFGNY-SKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSL 115

Query: 160 ICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPL 219
           +  L +  +     ++            L  +  ++G         + + IS +     +
Sbjct: 116 VAALANSMN----MLIVGRVVAGVGGSGLQTLCFVIGCTM-VNERSRPLVISILSCAFAV 170

Query: 220 GATFGGLFSGIVVVKDDKNWPWTFY------AFAIVSFLVGVTCYFFVPDNVPTNTNNL 272
            A  G +  G         W W FY       FA++ FL+    Y    +N+   T N+
Sbjct: 171 AAIVGPIIGG--AFTTHVTWRWCFYINLPIGGFAVIMFLL---TYKTKSENILQQTRNI 224

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 81  IFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDI 140
           +   LMG  L+   TT   +++  IA D  + +S+ +W+  ++ L   +F  + G+  DI
Sbjct: 44  VLALLMGSFLSALDTTIVATLLPTIASDLDA-SSQMSWIATAYLLSCSAFQPLYGKLSDI 102

Query: 141 YGLKKMLLLGYAILTIWSIICG 162
           +G K +L+L      +   ICG
Sbjct: 103 FGRKILLILSNLTFALGCAICG 124

>TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa]
           {ON} 
          Length = 566

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 95/234 (40%), Gaps = 18/234 (7%)

Query: 35  QKIDSSEQVVPTDSEKYFATVRXXXXXXXXXQKPQYFSSKLHEWAFIFTCLMGQLLNQAG 94
           + I + E+   T+S       R          K  Y  S   +W  +    + QL     
Sbjct: 17  ENIQNREKQRETNSRGSSEDPRRILREYECYDKLGYSFSTRKKWTILTIIFITQLSMNFN 76

Query: 95  TTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAIL 154
            +     + +IA++FG  T         F +  G    +   + + YG  +++ L     
Sbjct: 77  ASAYPHAIPLIAKEFGVSTQAANTSQMIFLVSYGFGCELWAPWSEEYGRWRVMQLSLLFS 136

Query: 155 TIWSIICGLTHYTHSDDF--FIVAKAFQGL---GVSFILPNIIGLVGTIYEPGSMKKNIT 209
            IW I+ GL     + +F   IVA+   G+   G S  L    G+V  +++P  +     
Sbjct: 137 NIWQILGGL-----APNFGTIIVARFLGGMSLAGGSVTL----GVVADMFDP--IDHGYA 185

Query: 210 ISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPD 263
           ++FI   +  G+  G +F G++  ++  +W W F+   I + +  +  +F VP+
Sbjct: 186 VAFIVLSSVCGSVIGPIFGGLM--QEHLSWHWNFWIQLIFNGVAQILHFFIVPE 237

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 65/149 (43%), Gaps = 16/149 (10%)

Query: 100 SIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSI 159
           +I+  +A+ FG+  SK  W+FA + L +    L+ GR   I G K  +L    I  I S+
Sbjct: 100 TIIEDVAKKFGA-YSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSL 158

Query: 160 ICGLTHYTHSDDFFIVAKAFQGLGVSFI--LPNIIG--LVGTIYEPGSMKKNITISFIGA 215
           I G+    +S +  I  +   G+G S I  L  +IG  LV         ++ + I+ + +
Sbjct: 159 ISGV---ANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNLV------DERRRGLIIACMSS 209

Query: 216 MAPLGATFGGLFSGIVVVKDDKNWPWTFY 244
              + +  G    G         W W FY
Sbjct: 210 AFAVASVIGPFLGG--AFTTHATWRWCFY 236

>Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON}
           (117855..119801) [1947 nt, 649 aa]
          Length = 648

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 59/146 (40%), Gaps = 6/146 (4%)

Query: 132 LVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNI 191
           L+ G F DI G K + L    ++TI +I+  L             + FQ    S ++   
Sbjct: 225 LIWGHFADICGRKWLYLCSLLLMTIVNIL--LASLPAKIGLLYFLRIFQAFSSSSVMSMG 282

Query: 192 IGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSF 251
            G V  I  P    K I    +G    +G     + +G++++ D  NW W F   +I+S 
Sbjct: 283 AGTVTDITAPKHRGKAIAYFMMGPN--MGPIVAPIIAGVILIND--NWRWLFGFTSIMSG 338

Query: 252 LVGVTCYFFVPDNVPTNTNNLKMDWI 277
           +       F+P+ +     N    WI
Sbjct: 339 VAFFLVLVFLPETLRCMVGNGDKRWI 364

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 59/280 (21%), Positives = 105/280 (37%), Gaps = 34/280 (12%)

Query: 81  IFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDI 140
           +F+  +G  L     T   +++  I  +F S   K +W+  S+ L S +   + G+  D 
Sbjct: 89  MFSMFLGIFLAALDGTIVSTLLTHIGSEFNS-LDKASWIATSYLLSSSTCQPLYGKLSDR 147

Query: 141 YGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAF----QGLGVSFILPNIIGLVG 196
            G K +L+   A+  I  +ICGL++      + +VA  F     G G++ +   I+  + 
Sbjct: 148 LGRKPLLVFSNAVFAIGCLICGLSNSI----WAVVAGRFISGIGGCGLTSLATMIMSDLV 203

Query: 197 TIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVG-- 254
            + +    +      F      LG   GGL          ++W   F     +S L G  
Sbjct: 204 PLRDRAVYQGLCNFVF-----GLGTASGGLVGAYF-----RDWRLAFILQCPISVLSGIL 253

Query: 255 VTCYFFVPDNVPTNTNNL------KMDWIGSAXXXXXXXXFSFVWNQAPMDGWDKAYXXX 308
           +  Y  +P     +  +       ++DW G+         F      + M G   AY   
Sbjct: 254 IVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLFMLT---SSMGGSSVAYGSR 310

Query: 309 XXXXXXXXXXAF---FIY-EINYAEVPLLPKAITGNRHII 344
                      F   F+Y E+  A  P+LP     +R ++
Sbjct: 311 LFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVL 350

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 62/147 (42%), Gaps = 12/147 (8%)

Query: 100 SIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSI 159
           +I+  +A+ FGS  S+  WLF  + L +    L+ GR     G K+ +L    I  I S+
Sbjct: 89  TIIEEVAKQFGSY-SEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSL 147

Query: 160 ICGLTHYTHSDDFFIVAKAFQGLGVSFI--LPNIIGLVGTIYEPGSMKKNITISFIGAMA 217
           I  L    +S    I  +   G+G   I  L  +IG   T+ E    ++ I I+ +    
Sbjct: 148 ISAL---ANSMSMLIGGRVIAGVGGCGIQSLSFVIG--STLVEES--QRGILIAVLSCSF 200

Query: 218 PLGATFGGLFSGIVVVKDDKNWPWTFY 244
            + +  G    G  V      W W FY
Sbjct: 201 AIASVVGPFLGG--VFTSSVTWRWCFY 225

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 69/150 (46%), Gaps = 16/150 (10%)

Query: 99  MSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWS 158
           +++   I E F  + ++  WL   + L +  F L+ GR   I GLK  L     I  I S
Sbjct: 28  ITLYETIGEKF-KDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGS 86

Query: 159 IICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGT-IYEPGSMKKNITI---SFIG 214
           +I  +   ++S    I  +   G G S I  +++ +VGT + E  +    IT+   +F  
Sbjct: 87  LIVAV---SNSMGMIIGGRVVAGCGGSGI-QSLVFVVGTSLVEERNRGMVITVLGLAFAV 142

Query: 215 AMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244
           A A +G   GG F+      ++ +W W FY
Sbjct: 143 AFA-VGPVIGGAFT------ENVSWRWCFY 165

>ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR043C
          Length = 631

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 84/193 (43%), Gaps = 17/193 (8%)

Query: 82  FTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIY 141
           F C++G +    GT+     +  I +DFG+     +    ++    G F +      D  
Sbjct: 103 FACILGPM----GTSIIYPAIGTIMQDFGTSRFLVSVSVGTYLAALGIFPIWWSSLADKN 158

Query: 142 GLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEP 201
           G + + +L +A+L ++S+    T ++ + + FI+ +   G   + +     G +  +Y P
Sbjct: 159 GRRTVYVLSFALLVVFSVG---TAFSRNIETFIILRILCGAASASVQSVGAGTIADLYVP 215

Query: 202 GSMKKNITISFIGA-MAPLGATFGGLFSGIVVVKDDKNWPW--TFYAFAIVSFLVGVTCY 258
               +N+   ++G  MAPL      + S ++V      W W  T +   I++ L  +   
Sbjct: 216 EERGRNLGYYYLGPLMAPL---LSPIVSSLLV----NRWSWRSTQWFMVILAALTFLLLV 268

Query: 259 FFVPDNVPTNTNN 271
           F +P+ + T  N 
Sbjct: 269 FALPETLRTQDNK 281

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 62/147 (42%), Gaps = 12/147 (8%)

Query: 100 SIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSI 159
           +I+  +A+  GS  S+  WLF  + L +   +L+ GR     G K  +L    I  I S+
Sbjct: 83  TIIEEVAKQLGSY-SEIGWLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSL 141

Query: 160 ICGLTHYTHSDDFFIVAKAFQGLGVSFI--LPNIIGLVGTIYEPGSMKKNITISFIGAMA 217
           I  L     S +  I  +   G+G   I  L  +IG   T+ E    K+ + I+ + +  
Sbjct: 142 ISAL---ASSMNMLIGGRVIAGIGGCGIQSLSFVIG--STLVEES--KRGMLIAILSSSF 194

Query: 218 PLGATFGGLFSGIVVVKDDKNWPWTFY 244
            + +  G    G  V      W W FY
Sbjct: 195 AIASVVGPFLGG--VFTSSVTWRWCFY 219

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 81  IFTCL-MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGD 139
           I T L +G  L+    T    IMN +AEDF +   KQ W+  S+ L + +F  + GR  D
Sbjct: 68  ILTSLWLGSFLSALDATIVAVIMNRVAEDFNASNQKQ-WIATSYLLTNTAFQPLYGRLSD 126

Query: 140 IYGLK 144
           I G K
Sbjct: 127 IIGRK 131

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 51/100 (51%), Gaps = 3/100 (3%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125
           Q  +   ++LH    I +  +G  L     T   ++++ IA +F +E S  +W+  ++ L
Sbjct: 51  QVSEMSRARLH--IIISSMCLGSFLAALDNTIVTTLLSHIASEF-NELSHISWIATAYLL 107

Query: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTH 165
            S +F  + G+  DI+G + ++++      +  +ICGL+ 
Sbjct: 108 SSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSK 147

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 46/100 (46%), Gaps = 3/100 (3%)

Query: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145
           +G  ++    +  +S+++ ++  +    +  +W   S+ +    FI   GR GDI G  +
Sbjct: 36  LGCSIDLINVSSMISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSR 95

Query: 146 MLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185
           +  +      I S++CGL     +   F V +A QG+  +
Sbjct: 96  LFTVSCGCFAILSLLCGLMPNFEA---FAVMRALQGIAAA 132

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 87/209 (41%), Gaps = 34/209 (16%)

Query: 90  LNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLL 149
           L+   +T + SI  +I  +F  +    +W+  ++ +   SF  + G F D  G ++ L  
Sbjct: 58  LSGLDSTITASIYQLIGNEF-EDVKVSSWITTAYLVTCTSFQPLYGSFSDTLGRRRCLFF 116

Query: 150 GYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPG---SMKK 206
              I  +  + CGLT   +S    I+ +A     V+ I    +  + TI       + K+
Sbjct: 117 ANTIFALGCLGCGLTSTIYS---LIIMRA-----VTGIGGGGLITLSTIVNSDIIPAKKR 168

Query: 207 NITISF----IGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVP 262
            +  SF    +G  A +GA+ GG       +     W W F     +S    V  Y FV 
Sbjct: 169 GMYQSFQNILVGTGAVVGASCGG------EIASSMGWRWCFLLQVPISIGGAVMAYLFVQ 222

Query: 263 DN-----------VPTNTNNL-KMDWIGS 279
           D            +P+N + + K+D++G+
Sbjct: 223 DQDVVDKNPRSGALPSNVSKIKKIDFLGA 251

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 70/157 (44%), Gaps = 27/157 (17%)

Query: 107 EDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHY 166
            DFG+      WL   + L +  F+L+ GR  +I G K+ L++   +  I S+I  L   
Sbjct: 40  HDFGN----IGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISAL--- 92

Query: 167 THSDDFFIVAKAFQGLGVSFILPNIIGLVGTIY----EPGSMKKNITISFIGAMAPLGAT 222
           ++S    I  +   G G S I  ++  +VGT        G M   + IS++ A   +G  
Sbjct: 93  SNSMATLISGRVVAGFGGSGI-ESLAFVVGTSIVRENHRGIMITALAISYVIAEG-VGPF 150

Query: 223 FGGLFSGIVVVKDDKNWPWTFY--------AFAIVSF 251
            GG F+      +  +W W FY        AF I++F
Sbjct: 151 IGGAFN------EHLSWRWCFYINLPIGAFAFIILAF 181

>Kwal_27.12832 s27 (1393503..1395029) [1527 bp, 508 aa] {ON} YGR260W
           (TNA1) - 1:1 [contig 261] FULL
          Length = 508

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 48/118 (40%), Gaps = 6/118 (5%)

Query: 152 AILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITIS 211
           A++  WS+I     +  S    I  +   G       P +I LV  IY+P    K I + 
Sbjct: 139 AMVFCWSVITLGNGFIQSYHSLIALRVLLGAFEGGYFPAMILLVSMIYKPEEQAKRIALF 198

Query: 212 FIGAMAPLGATFGGLFS-GIVVVKDD---KNWPWTFYAFAIVSFLVGVTCYFFVPDNV 265
           F    A L   FGGL + G+  V        W W +    ++S    +  YF +P ++
Sbjct: 199 F--GCAALAGAFGGLIATGLATVNGASGLNGWRWLYIIEGLISITASIWIYFGLPTDI 254

>KNAG0A03540 Chr1 (450487..452103) [1617 bp, 538 aa] {ON} Anc_8.570
           YBR180W
          Length = 538

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 72/162 (44%), Gaps = 12/162 (7%)

Query: 119 LFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKA 178
           +FA  PL+ G++  VGGR       K + LL  A++ I +++  L   + +     + + 
Sbjct: 124 VFAVGPLLWGAYADVGGR-------KILYLLSLALMFIVNVL--LASLSPNIVALFILRI 174

Query: 179 FQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKN 238
            Q    S ++    G V  +  P +  K I    +G    +G     + +G++++  D+ 
Sbjct: 175 AQAFASSSVIALGAGTVTDLIVPSARGKAIGYFMMGP--NMGPVIAPIVAGLILINTDR- 231

Query: 239 WPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSA 280
           W W F   AI+S +  +  + F+P+ +     N    W G +
Sbjct: 232 WRWLFGFCAIMSGVALLCVWIFLPETLRCIVGNGDPSWKGES 273

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 67/150 (44%), Gaps = 18/150 (12%)

Query: 100 SIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSI 159
           +I+  +A+ FGS  S+  WLF  + L +    L+ GR     G K+ +L    I  + S+
Sbjct: 98  TIIEEVAKQFGSY-SEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSL 156

Query: 160 ICGLTHYTHSDDFFIVAKAFQGLGVSFI--LPNIIGLVGTIYEP---GSMKKNITISFIG 214
           I  L    +S +  I  +   G+G   I  L  +IG    + E    G +   ++ SF  
Sbjct: 157 ISAL---ANSMNVLIGGRVIAGVGGCGIQSLSFVIG--SNLVEESNRGVLIAILSCSFAI 211

Query: 215 AMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244
           A + +G   GG+F+  V       W W FY
Sbjct: 212 A-SVVGPFLGGVFTSRV------TWRWCFY 234

>YCR098C Chr3 complement(297049..298605) [1557 bp, 518 aa] {ON}
           GIT1Plasma membrane permease, mediates uptake of
           glycerophosphoinositol and glycerophosphocholine as
           sources of the nutrients inositol and phosphate;
           expression and transport rate are regulated by phosphate
           and inositol availability
          Length = 518

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 56/129 (43%), Gaps = 13/129 (10%)

Query: 72  SSKLHEWAFIFTCLMG--QLLNQAGTTQSMSIMNII------AEDFGSETSKQAWLFASF 123
           +SK  +W  I T +     L++      SMS++N +       +++ S+ S +    A  
Sbjct: 36  TSKKDKWKNIVTIIASGFALISDGYVNGSMSMLNKVFVMEYGKKNYSSKVSTRVSNAALV 95

Query: 124 PLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFF---IVAKAFQ 180
            ++ G F +  G   D Y  K  +L+  AIL I S +C  +H T     F    V +   
Sbjct: 96  GIIFGQFFM--GIAADYYSRKSCILVATAILVIGSALCAASHGTTVPGMFWMLTVMRGLV 153

Query: 181 GLGVSFILP 189
           G+GV    P
Sbjct: 154 GIGVGAEYP 162

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 59/148 (39%), Gaps = 25/148 (16%)

Query: 133 VGGRFGDIYGLKKMLLLGYAILTIWSII--CGLTHYTHSDDFFIVAKAFQGLGVSFILPN 190
           +G    D  G K  L+ G++   I+ +I  C           FI+  AF          N
Sbjct: 324 IGAYLSDRIGRKYTLMFGFSGYIIFGLIIGCAYDQLKKITPLFIIFYAFM---------N 374

Query: 191 IIGLVGTIYEPGSMKKNIT-----ISFIGAMAPLGATFGGLFSGIVV-----VKDDKNWP 240
           ++G  G    PG M   I+      +  G    L A  G + S + V     ++D+    
Sbjct: 375 MLGNAG----PGDMLGVISSEASATAVRGVFYGLSAVTGKIGSVVGVECFQPIRDNLGAR 430

Query: 241 WTFYAFAIVSFLVGVTCYFFVPDNVPTN 268
           WTF   AI   +  +  YFFVP ++ ++
Sbjct: 431 WTFIIAAICGLIGIIITYFFVPHSLESD 458

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 7/104 (6%)

Query: 175 VAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGA-MAP-LGATFGGLFSGIVV 232
           + + FQ +G S ++P  +G V  +  P +  K ++   +G  M P LG  FGGL     +
Sbjct: 206 ILRVFQAIGTSAVIPLGVGTVSDLISPMNRAKGVSYFMLGPNMGPILGPIFGGL-----I 260

Query: 233 VKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDW 276
           + +   W W F   +I + +  +    F+P+ +     N    W
Sbjct: 261 LMNGNQWRWLFGFTSITTGVGLILIVTFLPETLRCIVGNGDPRW 304

>Smik_3.200 Chr3 complement(296300..297856) [1557 bp, 518 aa] {ON}
           YCR098C (REAL)
          Length = 518

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 68/164 (41%), Gaps = 28/164 (17%)

Query: 37  IDSSEQVVPTDSEKYFATVRXXXXXXXXXQKPQYFSSKLHEWAFIFTCLMG--QLLNQAG 94
           +++S +++  D+E+  A                  +S+ ++W  I T +     L++   
Sbjct: 16  MNTSPRLIKYDAERRAARTE---------------TSRKNKWKNIVTIIASGFALISDGY 60

Query: 95  TTQSMSIMNII------AEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLL 148
              SMS++N +       E++ S+ S +    A   ++ G F +  G   D Y  K  +L
Sbjct: 61  VNGSMSMLNKVFVMEYGKENYSSKVSTRVSNAALVGIIFGQFFM--GIAADYYSRKSCIL 118

Query: 149 LGYAILTIWSIICGLTHYTHSDDFF---IVAKAFQGLGVSFILP 189
           +   IL I S +C  +H T     F    V +   G+GV    P
Sbjct: 119 VATTILVIGSALCAASHGTTIPGMFWMLTVMRGLVGIGVGAEYP 162

>KAFR0B00180 Chr2 complement(43943..45535) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 50/127 (39%), Gaps = 7/127 (5%)

Query: 142 GLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEP 201
           G +++ ++ + I  +  I C            I+ +   G+  S  L      +  +  P
Sbjct: 152 GRQQIYIVTFPIFMLIQIGCATVQNIEG---LIILRLLTGILCSPPLSTGGASIADVIHP 208

Query: 202 GSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFV 261
           G +   I +  +G +A      G L    +VV   KNW WTF+    +S    + C FF 
Sbjct: 209 GKLTTYIALWAVGTLA--APIIGPLLGASMVVA--KNWRWTFWLLLWLSIPCLICCIFFF 264

Query: 262 PDNVPTN 268
           P+    N
Sbjct: 265 PETSAAN 271

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145
           +G  L+   TT   +++  IA D  + +S+ +W+  S+ L   +F  + G+  DI+G K 
Sbjct: 49  LGSFLSALDTTIVSTLLPTIASDLDA-SSQMSWIATSYLLSCSAFQPLYGKLSDIFGRKI 107

Query: 146 MLLLGYAILTIWSIICG 162
           +L+    +  I   +CG
Sbjct: 108 LLVWSNLVFAIGCALCG 124

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 68/153 (44%), Gaps = 25/153 (16%)

Query: 107 EDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHY 166
            DFG+      WL   + L +  F+L+ GR  +I G  + L++   I  + S+I  L   
Sbjct: 40  HDFGN----IGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISAL--- 92

Query: 167 THSDDFFIVAKAFQGLGVSFILPNIIGLVGTIY----EPGSMKKNITISFIGAMAPLGAT 222
           ++S    I  +   G G S I  ++  +VGT        G+M   +  S++ A   +G  
Sbjct: 93  SNSMGTLISGRLIAGFGGSGI-ESLAFVVGTSIVQENHRGTMITALATSYVIAEG-VGPF 150

Query: 223 FGGLFSGIVVVKDDKNWPWTFY------AFAIV 249
            GG F+      +  +W W FY      AFA++
Sbjct: 151 IGGAFN------EHLSWRWCFYINLPIGAFALI 177

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 69/155 (44%), Gaps = 25/155 (16%)

Query: 107 EDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHY 166
            DFG+      WL   + L +  F+L+ GR  +I G  + L++   I  I S+I  L++ 
Sbjct: 40  HDFGN----IGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALSNT 95

Query: 167 THSDDFFIVAKAFQGLGVSFI--LPNIIG--LVGTIYEPGSMKKNITISFIGAMAPLGAT 222
             +    I  +   G G S I  L  ++G  +V   Y  G M   + +S++ A   +G  
Sbjct: 96  MGT---LIGGRVIAGFGGSGIESLAFVVGTSIVQENYR-GIMITALAVSYVIAEG-VGPF 150

Query: 223 FGGLFSGIVVVKDDKNWPWTFY------AFAIVSF 251
            GG F+      +  +W W FY      AFA +S 
Sbjct: 151 IGGAFN------EHLSWRWCFYINLPIGAFAFISL 179

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145
           +G  L     T   +++  IA +F +E    +W+  ++ L S +F  + G+  DI+G K 
Sbjct: 137 LGIFLASLDNTIVSTLLAHIASEF-NEMPHISWIATAYLLSSATFQPLYGKISDIFGRKP 195

Query: 146 MLLLGYAILTIWSIICGLT 164
           +L+    +  +  +ICGL+
Sbjct: 196 LLIFSNVMFALGCLICGLS 214

>Kwal_14.782 s14 (42720..44195) [1476 bp, 491 aa] {ON} YGR260W
           (TNA1) - Tna1p is a high affinity nicotinic acid plasma
           membrane permease [contig 245] FULL
          Length = 491

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 6/113 (5%)

Query: 157 WSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAM 216
           WS+I   + +  S    +  +   G       P +  L+  +Y+P    K I   F G+ 
Sbjct: 127 WSVITLSSGFVQSYGSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAF-FFGSS 185

Query: 217 APLGATFGGLF-SGIVVVKDD---KNWPWTFYAFAIVSFLVGVTCYFFVPDNV 265
           A  GA FGGL  +G+  VK     + W W +    ++S       +F +PDN+
Sbjct: 186 ALSGA-FGGLIATGLASVKSTSGLEGWRWLYIIEGLISVCATAWLFFGLPDNL 237

>Skud_3.172 Chr3 complement(280981..282546) [1566 bp, 521 aa] {ON}
           YCR098C (REAL)
          Length = 521

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 13/129 (10%)

Query: 72  SSKLHEWAFIFTCLMG--QLLNQAGTTQSMSIMNII------AEDFGSETSKQAWLFASF 123
           SSK  +W  I T +     L++      SMS++N +      A+++ S+ S +    +  
Sbjct: 39  SSKKDKWKNIITIIASGFALISDGYVNGSMSMLNKLFVMEYGAKNYSSKVSTRVSNASLV 98

Query: 124 PLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFF---IVAKAFQ 180
            ++ G F +  G   D Y  K  +L+   IL + S +C  +H T     F    V +   
Sbjct: 99  GIIFGQFFM--GIAADYYSRKSCILVATTILVVGSALCAASHGTTVPGMFWMLTVMRGLV 156

Query: 181 GLGVSFILP 189
           G+GV    P
Sbjct: 157 GIGVGAEYP 165

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 65/156 (41%), Gaps = 25/156 (16%)

Query: 133 VGGRFGDIYGLKKMLLLGYAILTIWSII--CGLTHYTHSDDFFIVAKAFQGLGVSFILPN 190
           +G  F D  G K  L++G++   ++ +I  C     +     FI+  A         L N
Sbjct: 327 IGAYFSDRIGRKYTLMIGFSGYIVFGLIIGCAYDQLSKITPLFIIFYA---------LMN 377

Query: 191 IIGLVGTIYEPGSM-----KKNITISFIGAMAPLGATFGGLFSGIVV-----VKDDKNWP 240
           ++G  G    PG+M      ++   +  G    + A  G + S + V     ++D+    
Sbjct: 378 MLGNAG----PGNMLGVISSESSATAVRGVFYGISAVTGKIGSVVGVECFQPIRDNLGAR 433

Query: 241 WTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDW 276
           WTF   AI   +  V  YF VP ++ ++     +D+
Sbjct: 434 WTFIIAAICGLVGVVITYFLVPHSLDSDLMKQDVDF 469

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 86/206 (41%), Gaps = 19/206 (9%)

Query: 66  QKPQYFSSKLHEWAFIFTCLMGQL-LNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFP 124
           ++P +  S+ H+   I T L   + L+   +T S S   +I  +FG +    +W+  ++ 
Sbjct: 32  ERPSW--SERHKVLLIETALFTNVFLSGLDSTISASTYQLIGNEFG-DVKLSSWITTAYL 88

Query: 125 LVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGV 184
           +   SF  + G F D  G +  L     I  +    CG T   +S    I+ +A  G+G 
Sbjct: 89  ITCTSFQPLYGSFSDTLGRRHCLFFANTIFALGCFGCGTTTTIYS---LILMRALTGIGG 145

Query: 185 SFILPNIIGLVGTIYEPGSMKKNITISF----IGAMAPLGATFGGLFSGIVVVKDDKNWP 240
             ++     +   I    + K+ I  +F    +G  A +GA+ GGL      +     W 
Sbjct: 146 GGLITLSTIINSDIIP--AKKRGIYQAFQNVLLGTGAVVGASCGGL------IATTMGWR 197

Query: 241 WTFYAFAIVSFLVGVTCYFFVPDNVP 266
           W F     +S    +  +FFV D  P
Sbjct: 198 WCFLLQVPISVGGTLVAFFFVHDQRP 223

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145
           +G  L     T   +++  IA +F +E  + +W+  ++ L S +F  + G+  DI+G K 
Sbjct: 129 LGIFLAALDNTIVSTLLAHIASEF-NELPRISWVATAYLLSSATFQPIYGKISDIFGRKV 187

Query: 146 MLLLGYAILTIWSIICGLT 164
           +L+       + S+ICGL+
Sbjct: 188 VLIFCNITFFVGSLICGLS 206

>ZYRO0G00352g Chr7 (27042..28526) [1485 bp, 494 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W
          Length = 494

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 49/109 (44%), Gaps = 8/109 (7%)

Query: 157 WSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAM 216
           WSII   + +  S    +  +   G       P +  ++  +Y+P    K I   F G+ 
Sbjct: 130 WSIITLCSGFVKSHKSLLALRVLLGTFEGGFFPAMTLIISIVYKPQEQAKRIAF-FFGSS 188

Query: 217 APLGATFGGLF-SGIVVVKDD---KNWPWTFYAFAIVSFLVGVTCYFFV 261
           A  GA FGGL  +G+  VKD    + W W +    ++S  +G + + F+
Sbjct: 189 ALSGA-FGGLIATGLASVKDAGGLEGWRWLYIIEGLIS--IGASIWLFL 234

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 100 SIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSI 159
           +I++++A+ FG+  SK  WL   + L +    L+ GRF  I G +  L+L   I    S+
Sbjct: 67  TIIDVVAKQFGNY-SKTGWLVTGYSLPNAVLSLLWGRFASIIGFQHSLILAVLIFEAGSL 125

Query: 160 ICGLTH 165
           +  L +
Sbjct: 126 VAALAN 131

>TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.469
           YDR243C
          Length = 607

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 160 ICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKK 206
           ICG   ++  +DF  +A+   G   SF+LP +I L  + + P S+KK
Sbjct: 209 ICGKVGHSTKNDFMGIAETGSGKTFSFVLPILIKLSRSEFRPMSIKK 255

>KAFR0C06300 Chr3 complement(1266085..1267623) [1539 bp, 512 aa]
           {ON} Anc_5.227 YLR004C
          Length = 512

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 52/120 (43%), Gaps = 9/120 (7%)

Query: 153 ILTIWSIICGLTHYTHSD----DFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNI 208
           +L+++ I  G T   HS        ++ +   GL  S      I + G  Y     +++ 
Sbjct: 133 VLSLFVICWGTTLACHSACKTYASLMIVRTLLGLFESASAVCCIAISGMYYTKS--EQSS 190

Query: 209 TISFIGAMAPLGATFGGLFS-GIVVVKDDK--NWPWTFYAFAIVSFLVGVTCYFFVPDNV 265
            I F    A +G   GGL S G +    +K  +W   F    +V+   GV  YFF+PDNV
Sbjct: 191 RIGFWATQAGMGYIVGGLISFGFLHYNGEKFTSWQIMFLVVGVVTVAFGVLTYFFLPDNV 250

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 59/147 (40%), Gaps = 12/147 (8%)

Query: 100 SIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSI 159
           +IM  +A  F    S   WL   + L +    L+ GRFG + G K  +LL   I  + S+
Sbjct: 97  TIMETVAAKFNGY-SMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSL 155

Query: 160 ICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITI-SFIGAMAP 218
           I        S    I  +   G+G S I      +  T+    +    I+I S   A+A 
Sbjct: 156 IAA---AATSMTMLIGGRVISGIGGSGIQTLCFVITSTLVTDRTRGTAISILSCAFAVAS 212

Query: 219 LGATF-GGLFSGIVVVKDDKNWPWTFY 244
           +   F GG F+  V       W W FY
Sbjct: 213 VAGPFLGGAFATHV------TWRWCFY 233

>Kpol_1045.3 s1045 (4998..6554) [1557 bp, 518 aa] {ON} (4998..6554)
           [1557 nt, 519 aa]
          Length = 518

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 76/176 (43%), Gaps = 23/176 (13%)

Query: 75  LHEWAFIFTCLMG-----QLLNQAGTTQSMSIMNIIAEDFGSETSKQ-AWLFASFPLVSG 128
           L  W  +F C +G      LLN  G  ++    +I +    +E+S+   W+F+ F  +  
Sbjct: 99  LRAWIVVFGCFLGLTACFGLLNTIGVIET----HIQSHQLSNESSQVIGWVFSIFLFICF 154

Query: 129 SFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFIL 188
           S  +  G + D  G K  +++G A       + G+ + T    FF+      G G   I+
Sbjct: 155 SSCIFSGTYFDRNGFKVPMIIGSACQV--GGLFGVANSTKIWHFFLSLSVLSGFGNGIIM 212

Query: 189 PNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVK----DDKNWP 240
             ++      ++    K+  T +   A+A +G + GG    I++ K    ++KN P
Sbjct: 213 SPLVSAPSHYFK----KRRGTAT---AVATMGGSLGGTIFPIILRKFFKMENKNNP 261

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 68/176 (38%), Gaps = 8/176 (4%)

Query: 96  TQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILT 155
           T + S    I  +F ++ S   W+  ++ + S SF  + G F D  G +  L    A  T
Sbjct: 71  TVTASTYQTIGNEF-NQMSISNWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAAFT 129

Query: 156 IWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGA 215
           I  + C L+    ++ + +             L  +  +V +   P S K+ I  +F   
Sbjct: 130 IGCLACSLS----TNIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSS-KRGIFQAFQNL 184

Query: 216 MAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNN 271
           +   GA  G  F G   +     W W F     +S +  V   ++VP+    N  N
Sbjct: 185 LLGFGAICGASFGG--TIASTIGWRWCFLIQVPISIISSVLMNYYVPNQKEYNHEN 238

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 64/154 (41%), Gaps = 23/154 (14%)

Query: 101 IMNIIAEDFGSE---TSKQAWLFASFPLVSGSFILVGGRFG-DIYGLKKMLLLGYAILTI 156
           I+  I  D G+     +K  W+ A + L +    L+ GR      G K  +L    I  I
Sbjct: 77  IVTTIINDVGAHFDAYAKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVIFEI 136

Query: 157 WSIICGLTHYTHSDDFFIVAKAFQGLGVSFI--LPNIIGLVGTIYEPGSMKKNITISFI- 213
            S+IC L    +S D  I  +   G+G S I  L  +IG   T+  P    +   I+F+ 
Sbjct: 137 GSLICAL---ANSMDMLIGGRVIAGIGGSGIQSLSFVIG--STLVSPRG--RGFIIAFMS 189

Query: 214 ---GAMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244
              G  + +G   GG F+  V       W W F+
Sbjct: 190 ASFGIASVIGPFIGGAFTSHV------TWRWCFW 217

>KLTH0E03234g Chr5 complement(293162..294727) [1566 bp, 521 aa] {ON}
           similar to uniprot|P15365 Saccharomyces cerevisiae
           YJR152W DAL5 Allantoin permease;ureidosuccinate
           permease; expression is constitutive but sensitive to
           nitrogen catabolite repression
          Length = 521

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 50/115 (43%), Gaps = 8/115 (6%)

Query: 154 LTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFI 213
           + +W  +  +T    +   FI  +   G+  S + P  + L    Y     ++ +  S  
Sbjct: 150 IVLWGFVLCMTSLPKNYASFIATRTVLGILESAVTPAFMLLTSQWYR--REEQFLRTSIW 207

Query: 214 GAMAPLGATFGGLFSGIVVVKDDK-----NWPWTFYAFAIVSFLVGVTCYFFVPD 263
            A A LGA  G L +  + V+D       +W   +    +V+ ++GV  +FFVPD
Sbjct: 208 SASAGLGAILGSLIAYGLAVRDPSSLPIASWRLLYVVLGVVTIVLGVA-FFFVPD 261

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 81/188 (43%), Gaps = 21/188 (11%)

Query: 81  IFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDI 140
           IF C +    N +    ++S+   I+++F   +         F +  G    +   + + 
Sbjct: 86  IFVCQLSMNFNGSVYPHALSL---ISKEFHVSSQAANTSQMIFKVAYGFGCELWAPWSEE 142

Query: 141 YGLKKMLLLGYAILTIWSIICGLTHYTHSDDF--FIVAKAFQGL---GVSFILPNIIGLV 195
           YG + ++ L      IW I+ G      + +F   IVA+   G+   G S  L    G+V
Sbjct: 143 YGRRNIMQLSLFFTNIWQILGG-----KAPNFGTIIVARFLGGISQAGGSVTL----GVV 193

Query: 196 GTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGV 255
             +++P        ++++   + LGA  G +F G++  ++  +W W F+   I   +  +
Sbjct: 194 ADMWQP--QDHGYAVAYVVLASVLGAVIGPVFGGLM--EEHLSWHWNFWIQLIFGGVTQL 249

Query: 256 TCYFFVPD 263
             +F VP+
Sbjct: 250 LHFFLVPE 257

>KLTH0B10054g Chr2 complement(839166..840677) [1512 bp, 503 aa] {ON}
           weakly similar to uniprot|P53322 Saccharomyces
           cerevisiae YGR260W TNA1 High affinity nicotinic acid
           plasma membrane permease
          Length = 503

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 49/113 (43%), Gaps = 6/113 (5%)

Query: 157 WSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAM 216
           WS+I   + +  S    +  +   G       P +  L+  +Y+P    K I   F G+ 
Sbjct: 139 WSVITLSSGFVKSYHSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAF-FFGSS 197

Query: 217 APLGATFGGLF-SGIVVVKDD---KNWPWTFYAFAIVSFLVGVTCYFFVPDNV 265
           A  GA FGGL  +G+  V +    + W W +    ++S       +F +PDN+
Sbjct: 198 ALSGA-FGGLIATGLASVNNAGGLEGWRWLYIIEGLISVCASFWLFFGLPDNL 249

>KLTH0E00462g Chr5 (45358..46869) [1512 bp, 503 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W TNA1 High affinity nicotinic acid plasma
           membrane permease
          Length = 503

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 49/113 (43%), Gaps = 6/113 (5%)

Query: 157 WSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAM 216
           WS+I   + +  S    +  +   G       P +  L+  +Y+P    K I   F G+ 
Sbjct: 139 WSVITLSSGFVKSYHSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAF-FFGSS 197

Query: 217 APLGATFGGLF-SGIVVVKDD---KNWPWTFYAFAIVSFLVGVTCYFFVPDNV 265
           A  GA FGGL  +G+  V +    + W W +    ++S       +F +PDN+
Sbjct: 198 ALSGA-FGGLIATGLASVNNAGGLEGWRWLYIIEGLISVCASFWLFFGLPDNL 249

>SAKL0F16478g Chr6 (1357813..1359300) [1488 bp, 495 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260w TNA1
          Length = 495

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 54/126 (42%), Gaps = 10/126 (7%)

Query: 152 AILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITIS 211
           A++  W++I     +  S    +  +   G       P +  ++   Y+     + I   
Sbjct: 126 ALVFCWAVITLCGGFVRSYSSLLATRVLLGTFEGGFFPAMTLIITMTYKKEEQARRIAF- 184

Query: 212 FIGAMAPLGATFGGLF-SGIVVVKDD---KNWPWTFYAFAIVSFLVGVTCYFFVPDNVPT 267
           F G+ A  GA FGGL  +G+  VK     + W W +    ++S    V  +F +PD+V  
Sbjct: 185 FFGSSALSGA-FGGLIATGLASVKKTGGLEGWRWLYIIEGLISICACVWLFFGLPDDV-- 241

Query: 268 NTNNLK 273
             NN+K
Sbjct: 242 --NNMK 245

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 60/143 (41%), Gaps = 8/143 (5%)

Query: 102 MNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIIC 161
           + +I+E F ++ SK  W+ + + L      L+ GRF  I+G K  LLL   I    S+I 
Sbjct: 65  IEVISEQF-NDYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLIS 123

Query: 162 GLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGA 221
            +   ++S +  I  +   G+G S I      +  T+    S  + + IS +     + A
Sbjct: 124 AV---SNSMNVLIGGRVVAGIGGSGIQSLCFVIASTLTTERS--RGVAISVLSCAYAVAA 178

Query: 222 TFGGLFSGIVVVKDDKNWPWTFY 244
             G    G         W W FY
Sbjct: 179 VAGPFMGG--AFTTHVTWRWCFY 199

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145
           +G  L     T   ++MN IAE+F  E+ K+ W+  SF L + +F  + G+  D+   +K
Sbjct: 48  LGSFLVALDGTIVANVMNRIAEEF-QESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRK 106

Query: 146 M 146
           +
Sbjct: 107 L 107

>KAFR0I00710 Chr9 (139612..141339) [1728 bp, 575 aa] {ON} Anc_8.570
           YBR180W
          Length = 575

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 60/142 (42%), Gaps = 5/142 (3%)

Query: 135 GRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGL 194
           G F D+ G K + L+   ++T+ +++  +     +  F  V +  Q    S ++    G 
Sbjct: 154 GMFADVGGRKILYLISLLLMTLINVLLSVLPTNIAALF--VLRILQAFSSSSVITLGAGT 211

Query: 195 VGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVG 254
           +  I  P    K I    IG    +G     + +G++++K +  W W F   +I+S +  
Sbjct: 212 ITDITPPKHRGKAIGYFMIGPN--MGPIVAPIIAGLILMKGNY-WRWLFGFTSIMSGVAF 268

Query: 255 VTCYFFVPDNVPTNTNNLKMDW 276
           +    F+P+ +     N    W
Sbjct: 269 IVVLIFLPETLRCKVGNGDPGW 290

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 48/103 (46%), Gaps = 2/103 (1%)

Query: 81  IFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDI 140
           +F   +G  L    TT   +++  IA +  + +++ +W+  S+ L   +F  + G+  D+
Sbjct: 35  VFALFVGSYLAALDTTIVTTLLPTIASELDA-SNQMSWIATSYLLSCSAFQPLYGKLSDV 93

Query: 141 YGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLG 183
           +G K +L+          I+CG   +T S     + +   G+G
Sbjct: 94  FGRKPLLIWSNLCFGFGCILCG-APFTKSLWMLCIGRFIAGVG 135

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 67/169 (39%), Gaps = 8/169 (4%)

Query: 96  TQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILT 155
           T + S    I  +F ++ S  +W+  ++ + S SF  + G F D  G +  L    A+ T
Sbjct: 76  TITASTYQTIGNEF-NQMSISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAVFT 134

Query: 156 IWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGA 215
           I  + C  +   +   F        G G+      +  +V +   P S K+ I  +F   
Sbjct: 135 IGCLACSFSTNIYMLSFMRALAGIGGGGLI----TLSTIVNSDVIPSS-KRGIFQAFQNL 189

Query: 216 MAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYFFVPDN 264
           +   GA  G  F G   +     W W F     +S +  +   ++VP+ 
Sbjct: 190 LLGFGAICGASFGG--TITSTIGWRWCFLIQVPISMIASLLMNYYVPNQ 236

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 95  TTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAIL 154
           +T + S    I  +F +     +W+ AS+ + S SF  + G F D+ G +K L     I 
Sbjct: 84  STVTASTYQTIGNEF-NHMDLSSWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIF 142

Query: 155 TIWSIICGLT 164
           +I  + CG++
Sbjct: 143 SIGCLGCGIS 152

>CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180w DTR1
          Length = 542

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 55/142 (38%), Gaps = 5/142 (3%)

Query: 135 GRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGL 194
           G   D  G K + ++  +++ I +I+  L          I  +  Q    S ++    G 
Sbjct: 136 GALADKGGRKILYIISISLMVIINIL--LASVPKKIGSLIFLRIIQAFASSSVISLGAGT 193

Query: 195 VGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVG 254
           V  +  P    K +    +G    LG     + +G++++ D+ NW W F    IVS L  
Sbjct: 194 VADLTPPKDRGKAMAYFMLGP--NLGPILAPIIAGLILL-DNNNWRWLFGFLCIVSGLGL 250

Query: 255 VTCYFFVPDNVPTNTNNLKMDW 276
           +     +P+ +     N    W
Sbjct: 251 IMVILLLPETLRCIVGNGDRQW 272

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 60/154 (38%), Gaps = 7/154 (4%)

Query: 118 WLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAK 177
           W+  ++ + S SF  + G F D  G +  L    A  TI  + CG +   +    F+ A 
Sbjct: 6   WITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSSNIYMLS-FMRAL 64

Query: 178 AFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDK 237
              G G    L  I   V +   P S K+ I  +F   +   GA  G  F G   +    
Sbjct: 65  TGIGGGGLITLSTI---VNSDVIPTS-KRGIFQAFQNLLLGFGAICGASFGG--TIASTI 118

Query: 238 NWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNN 271
            W W F     +S +  +   ++VP+    N  N
Sbjct: 119 GWRWCFLIQVPISMISSILMNYYVPNQKEYNDQN 152

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 79/205 (38%), Gaps = 19/205 (9%)

Query: 76  HEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGG 135
            +W  +    M    +  G+      +  + + FG + +K       + L  G    + G
Sbjct: 88  QKWGMVALLTMCGFWSSLGSPIYYPALRQLEKQFGLDENKVNVTVVVYLLFQGIAPTISG 147

Query: 136 RFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLV 195
              D++G + ++L+G  I  + SI  GL     S    +  +  Q +G+S  +    G+V
Sbjct: 148 GLADVFGRRPVILIGMLIYVVASI--GLA-CAPSYGVIVFLRIIQSIGISPTIAISSGVV 204

Query: 196 GTI---YEPGSMKKNITISFIGA---MAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIV 249
           G     +E G        +F+GA   +  LG  FG L   ++      NW   F+   I 
Sbjct: 205 GDFTLKHERG--------TFVGATSGLVLLGQCFGSLIGAVLAAA--WNWRAIFWFLTIG 254

Query: 250 SFLVGVTCYFFVPDNVPTNTNNLKM 274
                +  +  +P+   T   NL +
Sbjct: 255 CGTSFIIAFLLLPETKRTLVGNLSI 279

>NDAI0D01750 Chr4 complement(407496..409190) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 82/200 (41%), Gaps = 16/200 (8%)

Query: 74  KLHEWAFIFTCLM--GQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFI 131
           K+    F   CL+   Q +++  +T S ++M +  ED G    + +W+ ++F    G   
Sbjct: 97  KIDLCMFPLMCLLYAVQFMDKT-STGSAAVMGL-REDLGMHGDQYSWVGSAFYF--GYLF 152

Query: 132 LVGGRFGDIYGL-KKMLLLGYAILTIWSIICGLTHYTHSDDF--FIVAKAFQGLGVSFIL 188
           +  G    I+    KM  L    + IW I+  L H   S ++  FI  +   G   S + 
Sbjct: 153 MNLGPVQFIFQRSDKMAKLLALFVVIWGILLAL-HAVPSVNYPAFIALRVLLGCAESVVT 211

Query: 189 PNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDD----KNWPWTFY 244
           P    +    ++       + I F   M  LG+      +  V V +D    K W   F 
Sbjct: 212 PCFTIITAQYWKTEEQFTRVCIWF--GMNGLGSIILSAIAYGVYVHEDSYSIKGWRLLFV 269

Query: 245 AFAIVSFLVGVTCYFFVPDN 264
              I++  VG   YF++PD+
Sbjct: 270 ITGILTIFVGGLIYFWIPDD 289

>ZYRO0E09988g Chr5 (796142..797788) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 548

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 55/138 (39%), Gaps = 7/138 (5%)

Query: 140 IYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIY 199
           I+G +++ ++   + T+    C L H        ++ +   G+  S  L      +G + 
Sbjct: 168 IFGRQQLYIVTLFLFTMLQAGCALVHNIAG---LVILRFLTGVLCSPSLATGAASIGDVV 224

Query: 200 EPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYF 259
            P  +   I +      A      G L    +V+   KNW W F+    +S L+ VT  F
Sbjct: 225 RPKYVP--ILLGLWSGAAYAAPCVGPLIGAAMVIA--KNWRWIFWLLMWMSALLLVTLIF 280

Query: 260 FVPDNVPTNTNNLKMDWI 277
           F P+    N  + + + I
Sbjct: 281 FFPETSEDNILHRRCERI 298

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 86  MGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKK 145
           +G  L     T   ++MN IAE+F  E+ K+ W+  SF L + +F  + G+  D+   +K
Sbjct: 48  LGSFLVALDGTIVANVMNRIAEEF-QESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRK 106

>TBLA0A01270 Chr1 complement(300796..302364) [1569 bp, 522 aa] {ON} 
          Length = 522

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 71/172 (41%), Gaps = 23/172 (13%)

Query: 69  QYFSSKLHEWAFIFTCLMGQ-----LLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASF 123
           +Y    L  W  +  C  G      LLN  G  ++    N ++ +    +S   W+F+  
Sbjct: 99  EYPEGGLRSWLVVLGCFCGLFTCLGLLNAIGIVETYIQENQLSNE---SSSSIGWIFSLL 155

Query: 124 PLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDF--FIVAKAFQ- 180
             V+ S  +  G + D  G K  +++G    TI   +CGL    +S     FI++ +   
Sbjct: 156 LFVNFSSCIFSGTYFDRNGFKIPVIVG----TILH-VCGLVAMANSTKLWQFILSLSIAV 210

Query: 181 GLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVV 232
           GLG  FI+  +I          S   N       A+A LG + GG+   I++
Sbjct: 211 GLGNGFIMSPLI-------SAPSHYFNKRRGLATALATLGGSIGGVILPIML 255

>NDAI0I02020 Chr9 (470494..471828) [1335 bp, 444 aa] {ON} Anc_5.227
          Length = 444

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 48/115 (41%), Gaps = 5/115 (4%)

Query: 154 LTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFI 213
           +T+W ++        S    ++ +   G+  S      I + G  Y     +++  I F 
Sbjct: 73  ITLWGVVLTCHSACKSYASLMIVRTLLGIFESSSAVGCIAISGMYYTKS--EQSARIGFW 130

Query: 214 GAMAPLGATFGGLFS-GIVVVKDDK--NWPWTFYAFAIVSFLVGVTCYFFVPDNV 265
              A  G   GGL S G +     +  +W   F    +V+ L G+  YF++PDNV
Sbjct: 131 AIQAGTGYIVGGLISFGFLHYNGTEFTSWQIMFLVVGLVTVLFGIITYFYLPDNV 185

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 35/158 (22%), Positives = 65/158 (41%), Gaps = 12/158 (7%)

Query: 119 LFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKA 178
           LFA  PLV G F   GGR       K + ++   I T+ +I+  L     +     + + 
Sbjct: 182 LFAFMPLVWGMFADFGGR-------KFLYIISLFIFTVANIL--LASLPANIIALYLVRV 232

Query: 179 FQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKN 238
            Q +G S  +    G V  I  P    K++ +  +G    +G     + +G++++  ++ 
Sbjct: 233 LQVVGASAAISLGTGTVADISPPKHRGKSVALFMLGPN--MGPIIAPIIAGLILMNSNQ- 289

Query: 239 WPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDW 276
           W W F   AI + +  +     +P+ +     N    W
Sbjct: 290 WRWLFGFSAICTGVALMIVIVILPETLRCIVGNNDPKW 327

>Suva_14.4 Chr14 (4495..6051) [1557 bp, 518 aa] {ON} YCR098C (REAL)
          Length = 518

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 56/129 (43%), Gaps = 13/129 (10%)

Query: 72  SSKLHEWAFIFTCLMG--QLLNQAGTTQSMSIMNII------AEDFGSETSKQAWLFASF 123
           +S+  +W  I T +     L++      SMS++N +       +++ S+ S +    +  
Sbjct: 36  ASEKEKWKNIVTIIASGFALISDGYVNGSMSMLNKLFVMEYGKKNYSSKVSTRVSNASLV 95

Query: 124 PLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFF---IVAKAFQ 180
            ++ G F +  G   D Y  K  +L+  +IL + S +C  +H T     F    V +   
Sbjct: 96  GIIFGQFFM--GIAADYYSRKSCILVATSILVLGSALCAASHGTTVPGMFWMLTVMRGLV 153

Query: 181 GLGVSFILP 189
           G+GV    P
Sbjct: 154 GIGVGAEYP 162

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 45/90 (50%), Gaps = 1/90 (1%)

Query: 73  SKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFIL 132
           S++   A + + ++G  L     T   ++++ IA +F       +W+ AS+ L +  F  
Sbjct: 147 SQIRFAAIVSSLVVGVFLGSLDGTILSTLLDYIASEF-EALPYISWIAASYLLSACIFQP 205

Query: 133 VGGRFGDIYGLKKMLLLGYAILTIWSIICG 162
           + G+  DI+G K +LL    +  +  ++CG
Sbjct: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCG 235

>NCAS0D04970 Chr4 (952902..954650) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 194 LVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKN----WPWTFYAFAIV 249
           L G  Y+   M +     ++G    + ++ GG+ S +    D +N    W W+F   AI+
Sbjct: 247 LFGCFYKHDEMVRRSAFYYLGQYVGILSS-GGIQSAVYSNLDGRNGLSGWRWSFIIDAII 305

Query: 250 SFLVGVTCYFFVPDNVPTNT 269
           S  VG+  ++ +P + P N 
Sbjct: 306 SVFVGILGFYVLPGD-PDNC 324

>KAFR0H01700 Chr8 complement(314217..316154) [1938 bp, 645 aa] {ON}
           Anc_8.446 YDL199C
          Length = 645

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 141 YGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLG---VSFILP 189
           +G ++++L+G   L + S+IC L H   +   F+  ++  G+G   +SFILP
Sbjct: 168 HGRRQIILIGSFCLVVGSVICLLFHDDLTHLAFLGGRSLLGIGMGLLSFILP 219

>Kwal_47.16586 s47 (13925..15433) [1509 bp, 502 aa] {ON} YGR260W
           (TNA1) - Tna1p is a high affinity nicotinic acid plasma
           membrane permease [contig 376] FULL
          Length = 502

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 5/93 (5%)

Query: 173 FIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFS-GIV 231
            + A+ F G+  S   P II  + T Y    + + ++I +  A A +   F GL S GI 
Sbjct: 147 LMAARWFLGICESAFFPGIIYYLSTFYRRHELARRLSIFY--AAANIANAFSGLLSFGIF 204

Query: 232 VVKDD--KNWPWTFYAFAIVSFLVGVTCYFFVP 262
            +K+   K W   F     ++ +  V  + ++P
Sbjct: 205 QIKNSKLKGWQILFLVEGSLTVIFAVVAFLYLP 237

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 59/154 (38%), Gaps = 7/154 (4%)

Query: 118 WLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAK 177
           W+  ++ + S SF  + G F D  G +  L       TI  + CG +   +    F+ A 
Sbjct: 6   WITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLS-FMRAL 64

Query: 178 AFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDK 237
              G G    L  I   V +   P S K+ I  +F   +   GA  G  F G   +    
Sbjct: 65  TGIGGGGLITLSTI---VNSDVIPSS-KRGIFQAFQNLLLGFGAICGASFGG--TIASSI 118

Query: 238 NWPWTFYAFAIVSFLVGVTCYFFVPDNVPTNTNN 271
            W W F     +S +  +   ++VP+    N  N
Sbjct: 119 GWRWCFLIQVPISVISSILMNYYVPNQKEYNRQN 152

>ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} similar
           to uniprot|Q2UJ53 Aspergillus oryzae AO090003001353
           Synaptic vesicle transporter SVOP and related
           transporters and weakly similar to YBR008C
           uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 542

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 86/202 (42%), Gaps = 40/202 (19%)

Query: 71  FSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSF 130
           F++ ++ W         ++ +QAG T  M  + ++A  FG E      L+A +       
Sbjct: 73  FNAGVYPWCIPLITKEFKISSQAGNTSQM--IFLVAYGFGCE------LWAPW------- 117

Query: 131 ILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDF--FIVAKAFQGL---GVS 185
                   + YG   ++ L      IW I+ G      + +F   IVA+   GL   G S
Sbjct: 118 -------SEEYGRWIVMQLSLLFSNIWQILGG-----KAPNFGAIIVARGLCGLSQAGGS 165

Query: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245
             L    G+V  +++P   +    +++I   +  G+  G +F G++  ++  +W W F+ 
Sbjct: 166 VTL----GVVADLWDPS--EHGYAVAYIVLASVGGSVLGPVFGGLM--QEHLSWHWNFWI 217

Query: 246 FAIVSFLVGVTCYFFVPDNVPT 267
             I + +  +  +F VP+   T
Sbjct: 218 QLIFNGVSQILHFFLVPETRAT 239

>Kwal_56.24353 s56 (964777..966525) [1749 bp, 582 aa] {ON} YAL067C
           (SEO1) - putative permease [contig 163] FULL
          Length = 582

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 6/79 (7%)

Query: 194 LVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKN----WPWTFYAFAIV 249
           L G+ Y+   M +     ++G  A + +   GL S I  V D K     W W F    ++
Sbjct: 248 LFGSFYKHDEMVRRSAFYYLGQYAGILSA-SGLQSAIYAVLDGKRGLSGWRWNFIIDGVI 306

Query: 250 SFLVGVTCYFFVPDNVPTN 268
           S +VG+  ++ +P + P N
Sbjct: 307 SVVVGIIGFYVLPGD-PYN 324

>ZYRO0E09966g Chr5 (793128..794813) [1686 bp, 561 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 561

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 55/129 (42%), Gaps = 7/129 (5%)

Query: 140 IYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIY 199
           +YG +++ ++   + ++  I C L H        ++ +   G+  S  L      +G I 
Sbjct: 181 MYGRQQLYIITLFLFSMLQIGCALVHNIAG---LVILRFITGILCSPSLATGAASIGDIV 237

Query: 200 EPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGVTCYF 259
           +P  +   I +  IGA+A      G L    +VV   KNW W F+    +S  + +   F
Sbjct: 238 KPELVPVFIGMWSIGAVA--APVTGPLLGASMVVA--KNWRWIFWLLMWMSAALLILLVF 293

Query: 260 FVPDNVPTN 268
           F P+    N
Sbjct: 294 FFPETGEDN 302

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 2/86 (2%)

Query: 105 IAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLT 164
           I+ DF   T +  W      ++     ++ G  GD YG K   ++    + +  II G  
Sbjct: 101 ISHDFDVTTKQVTWGITLVLMLRVVGAVLFGYIGDRYGRKVSFIINLFFMMVLEIITGFI 160

Query: 165 HYTHSDDFFIVAKAFQGLGVSFILPN 190
              H+  +F++A+AF G+ +  I  N
Sbjct: 161 K--HNFKYFLIARAFFGVVLGGIFGN 184

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 10/58 (17%)

Query: 320 FFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYFSFSLNLRHFSPV 377
           F  +E  YA+ PLLP  + G+R I          W   G+  F YF+F +      PV
Sbjct: 317 FVFWETAYAKNPLLPFKLLGDRGI----------WAPLGVAFFNYFTFFIACDFLYPV 364

>TDEL0D02340 Chr4 (455204..456709) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 67/169 (39%), Gaps = 13/169 (7%)

Query: 105 IAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGY--AILTIWSIICG 162
           I +D     ++ AWL  +F L       +GG F     L+++  +      + IW ++  
Sbjct: 82  IQQDLNLAPNEFAWLGTAFYLA-----YLGGEFPIAQMLQRLPYVKTLSTCIVIWGVVLC 136

Query: 163 LTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGAT 222
                 +    I A+ F G+  S I P  + L    Y        I   F  +   LG  
Sbjct: 137 AHAGVSNGAGIITARVFLGIFESSITPGFVILTSQWYRKEEHFARIAYWF--SCNGLGQI 194

Query: 223 FGGLFS-GIVVVKDD---KNWPWTFYAFAIVSFLVGVTCYFFVPDNVPT 267
            GG  + G+    +    ++W   F    ++S L GV  YF++PD+  T
Sbjct: 195 LGGSIAYGLAHHAESYSIESWKILFVITGLMSILFGVLFYFYIPDSPAT 243

>TBLA0A01420 Chr1 (333707..335425) [1719 bp, 572 aa] {ON} Anc_1.451
           YCR023C
          Length = 572

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 56/136 (41%), Gaps = 9/136 (6%)

Query: 105 IAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLT 164
           IA +    +    +L A+F L         GRF D YG K  ++LG     I  +I G +
Sbjct: 53  IAPNEAQVSRYSGYLSATFSLCKFLAAYHWGRFSDEYGRKLTVILGMLGTCISLLILGFS 112

Query: 165 HYTHSDDFFIVAKAFQGL--GVSFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGAT 222
            + +     ++A++  GL  G   ++  I+G + T        + I  S I  +   G  
Sbjct: 113 KHFYQA---MIARSMMGLLNGNIAVIRTIVGELTT----EGRHQAIAFSTIPLLFQFGTV 165

Query: 223 FGGLFSGIVVVKDDKN 238
            G +  G +V   D +
Sbjct: 166 IGSIIGGFLVFHKDND 181

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 59/141 (41%), Gaps = 7/141 (4%)

Query: 137 FGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFI-VAKAFQGLGVSFILPNIIGLV 195
           F D  G K + ++   +  I +I+           FF+ +A+AF   G S ++   IG V
Sbjct: 198 FADFGGRKFLYIVSLLLTIIVNILLSAVPTNIGALFFLRIAQAF---GSSSVMSLGIGTV 254

Query: 196 GTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYAFAIVSFLVGV 255
             I  P S  + ++   +G    +G     + +G++++  + NW W F    I+S +   
Sbjct: 255 SDITPPKSRGRAVSYFMLGPN--MGPILAPIIAGLILMSSN-NWRWLFGFICIISGIALF 311

Query: 256 TCYFFVPDNVPTNTNNLKMDW 276
                +P+ +     N    W
Sbjct: 312 LVVLLLPETLRCIVGNGDPHW 332

>TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.245
           YBR043C
          Length = 640

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 79/187 (42%), Gaps = 17/187 (9%)

Query: 82  FTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPLVSGSFILVGGRFGDIY 141
           F+ LMG +     T+     +N I E   + T         + L  G F L    F +++
Sbjct: 97  FSSLMGPM----ATSIVFPAINPITESLDTTTFMVNISVGVYSLSLGIFPLWWSSFSEMH 152

Query: 142 GLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVSFILPNIIGLVGTIYEP 201
           G + + ++ + +L  + I   L+    S   FI+ +   G   + +     G V  +Y P
Sbjct: 153 GRRSVYVVSFIMLFGFCIGAALSPNISS---FIILRVLCGAASASVQSVGAGTVSDLYIP 209

Query: 202 GSMKKNITISFIGA-MAPLGATFGGLFSGIVVVKDDKNWPW--TFYAFAIVSFLVGVTCY 258
               +N+ I ++G  MAPL A    + SG+V       W W  T +   I++    +   
Sbjct: 210 EDRGRNLGIYYMGPLMAPLIAPI--IASGLVT-----RWSWRSTQWFMVILAGFDVLLLV 262

Query: 259 FFVPDNV 265
           FF+P+ +
Sbjct: 263 FFLPETL 269

>KAFR0F04090 Chr6 complement(797919..799682) [1764 bp, 587 aa] {ON}
           Anc_4.212 YGR065C
          Length = 587

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 7/84 (8%)

Query: 194 LVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKN-----WPWTFYAFAI 248
           ++G  Y P  M   +++ F G M  LG+   GL  G +    D       W W F   A+
Sbjct: 238 VMGCWYAPDEMSSRVSLFFCGNM--LGSVTSGLLQGRIYDSLDGRYGIAGWRWMFLIDAV 295

Query: 249 VSFLVGVTCYFFVPDNVPTNTNNL 272
              L  V   FF+   +P+   +L
Sbjct: 296 AISLPTVILGFFLIPGIPSKCYSL 319

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,586,948
Number of extensions: 1932077
Number of successful extensions: 5633
Number of sequences better than 10.0: 233
Number of HSP's gapped: 5631
Number of HSP's successfully gapped: 240
Length of query: 556
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 441
Effective length of database: 40,294,809
Effective search space: 17770010769
Effective search space used: 17770010769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)