Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C047808.842ON52552525760.0
Kpol_541.158.842ON49851015500.0
NDAI0E002908.842ON52252715260.0
Suva_13.288.842ON53052515150.0
KNAG0G034208.842ON51146815000.0
NCAS0B003008.842ON52346714920.0
YML115C (VAN1)8.842ON53552414930.0
Skud_13.268.842ON53951614890.0
Smik_13.198.842ON53641414800.0
CAGL0B02321g8.842ON51242014690.0
KAFR0A028308.842ON50742414660.0
ZYRO0G14234g8.842ON50949014600.0
TDEL0B005608.842ON50942614540.0
KLLA0D01529g8.842ON50151014380.0
SAKL0D01430g8.842ON44746514130.0
TBLA0B032708.842ON52047114120.0
KLTH0C03828g8.842ON40440713910.0
Ecym_46138.842ON52447913860.0
ABL124W8.842ON48542713750.0
Kwal_27.102468.842ON33933812451e-169
KLTH0C03432g1.479ON4893679081e-116
Ecym_35731.479ON4473679011e-116
CAGL0L01331g1.479ON4473679011e-116
NDAI0B012501.479ON4463668951e-115
YEL036C (ANP1)1.479ON5003618991e-115
Smik_5.571.479ON4913618951e-114
Kwal_27.101571.479ON4763678931e-114
KAFR0I027701.479ON4553678901e-114
NCAS0G041101.479ON4943678931e-114
Suva_5.331.479ON4953618901e-113
KNAG0I003001.479ON4573688861e-113
AFR357W1.479ON4343688841e-113
Skud_5.541.479ON4913588881e-113
SAKL0D11792g1.479ON4833668831e-113
TPHA0O004301.479ON5483578841e-112
TBLA0B021701.479ON5723698851e-112
KLLA0E22155g1.479ON4503678701e-111
NDAI0G003401.479ON5043598741e-111
Kpol_370.51.479ON6453618841e-111
TDEL0C026001.479ON4623688511e-108
ZYRO0F05170g1.479ON6083608541e-107
TPHA0L013708.500ON3923484262e-46
KLTH0E11616g8.500ON3943624061e-43
NDAI0E030208.500ON3963484024e-43
KLLA0E12849g8.500ON3923563991e-42
SAKL0H11110g8.500ON3933513963e-42
KNAG0A021508.500ON3963563946e-42
Kpol_1031.788.500ON3923553902e-41
TBLA0H033408.500ON3933493893e-41
NCAS0C023308.500ON3933513867e-41
KAFR0H013908.500ON3983553832e-40
Kwal_27.118648.500ON4533533829e-40
Smik_16.1868.500ON3953533771e-39
ZYRO0F08492g8.500ON3963483744e-39
Suva_16.2658.500ON3953563736e-39
Ecym_25508.500ON3903523726e-39
AGL259C8.500ON3893463701e-38
Skud_16.2328.500ON3953563701e-38
TDEL0B013708.500ON3963513701e-38
YPL050C (MNN9)8.500ON3953563702e-38
CAGL0L12804g8.500ON3933603656e-38
NCAS0B024408.500ON4003473368e-34
NDAI0C052508.500ON4023433219e-32
KNAG0A039908.500ON3571782041e-16
SAKL0H20438gsingletonON5652071126e-05
Skud_8.785.267ON192767715.5
TBLA0G001202.2ON146968698.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C04780
         (525 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   996   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   601   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   592   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   588   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   582   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   579   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   579   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   578   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   574   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   570   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   569   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   566   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   564   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   558   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   548   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   548   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   540   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   538   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   534   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   484   e-169
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   354   e-116
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   351   e-116
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   351   e-116
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   349   e-115
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   350   e-115
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   349   e-114
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   348   e-114
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   347   e-114
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    348   e-114
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   347   e-113
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   345   e-113
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   345   e-113
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   346   e-113
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   344   e-113
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   345   e-112
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   345   e-112
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   339   e-111
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   341   e-111
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   345   e-111
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   332   e-108
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   333   e-107
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   168   2e-46
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   160   1e-43
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   159   4e-43
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   158   1e-42
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   157   3e-42
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   156   6e-42
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   154   2e-41
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   154   3e-41
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   153   7e-41
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   152   2e-40
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   151   9e-40
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   149   1e-39
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   148   4e-39
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   148   6e-39
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   147   6e-39
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   147   1e-38
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   147   1e-38
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   147   1e-38
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   147   2e-38
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   145   6e-38
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   134   8e-34
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   128   9e-32
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    83   1e-16
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    48   6e-05
Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W ...    32   5.5  
TBLA0G00120 Chr7 (6738..11147) [4410 bp, 1469 aa] {ON} Anc_2.2 Y...    31   8.4  

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  996 bits (2576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/525 (92%), Positives = 486/525 (92%)

Query: 1   MKFSPLKLFRFSRNSYKLPLSEKTKEKRKNRDFRLLPKYSKFKVTNFRDKVSNFNVALSV 60
           MKFSPLKLFRFSRNSYKLPLSEKTKEKRKNRDFRLLPKYSKFKVTNFRDKVSNFNVALSV
Sbjct: 1   MKFSPLKLFRFSRNSYKLPLSEKTKEKRKNRDFRLLPKYSKFKVTNFRDKVSNFNVALSV 60

Query: 61  ILLCIFIAKTISVNVSIYKYNSFVHXXXXXXXXXXXQVLTAPEYYNYDFHDYNLDTISKY 120
           ILLCIFIAKTISVNVSIYKYNSFVH           QVLTAPEYYNYDFHDYNLDTISKY
Sbjct: 61  ILLCIFIAKTISVNVSIYKYNSFVHEEETETVTFDTQVLTAPEYYNYDFHDYNLDTISKY 120

Query: 121 DKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSREH 180
           DKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSREH
Sbjct: 121 DKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSREH 180

Query: 181 VLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQNG 240
           VLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQNG
Sbjct: 181 VLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQNG 240

Query: 241 TLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVKEAFKSPFHENYDKPFRSI 300
           TLPDVFEEMDKLDEMTDKVVENADDS            QRVKEAFKSPFHENYDKPFRSI
Sbjct: 241 TLPDVFEEMDKLDEMTDKVVENADDSKLYLKYMKKEYLQRVKEAFKSPFHENYDKPFRSI 300

Query: 301 QIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVELC 360
           QIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVELC
Sbjct: 301 QIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVELC 360

Query: 361 PGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIVE 420
           PGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIVE
Sbjct: 361 PGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIVE 420

Query: 421 GYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARARLFRAGVHFPAFTFENHAET 480
           GYAEYPTWRVHLAYLREK                SILARARLFRAGVHFPAFTFENHAET
Sbjct: 421 GYAEYPTWRVHLAYLREKDGDPNQVVDVDGVGGVSILARARLFRAGVHFPAFTFENHAET 480

Query: 481 EAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKERTA 525
           EAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKERTA
Sbjct: 481 EAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKERTA 525

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/510 (58%), Positives = 369/510 (72%), Gaps = 27/510 (5%)

Query: 20  LSEKTKEKRKNR----DFRLLPKYS---KFKVTNFRDKVSNFNVALSVILLCIFIAKTIS 72
           L+ K + K+K+     D R  PK     KF   N  + V   N  +++IL  +FI +   
Sbjct: 5   LNNKRQLKKKDELPISDSRWAPKSKYRHKFNPANSENFVK-INAIITLILFLVFICQNSF 63

Query: 73  VNVSIYKYNSFVHXXXXXXXXXXXQVLTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTY 132
            + S    +S  +           ++L   EYY+YDF +++   + K+D G + YL+  Y
Sbjct: 64  SSSSSNVVDSHTNEA---------KILEDNEYYDYDFKNFDEPLVKKFDDGAKHYLISKY 114

Query: 133 KTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAED 192
            ++    L+ + K  Y+ EL +LLS++V  YD+  +SGT +G+ +REHVLLC+PLRDAED
Sbjct: 115 GSE---VLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLRDAED 171

Query: 193 VLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKL 252
           VLPLMFKN+MNLTYPHELID+AFLVSDC+E DHTLESL+ Y+R LQ+GTL  +F+EMDK 
Sbjct: 172 VLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQEMDKD 231

Query: 253 DEMTDKVVENADDSXXXXXXXXXXXXQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVG 312
           D          D              + V++A+  PFH +Y+KPFRS+QI++KDFGQ VG
Sbjct: 232 DS-------KKDSEKLYLKYMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQEVG 284

Query: 313 QSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKD 372
           Q F++RH VKVQGIRRKLMGRARNWLMTNALKPYH+WVYWRDADVELCPGTVIEDLMSK+
Sbjct: 285 QGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMSKN 344

Query: 373 FDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHL 432
           FDV+VPNVWRPLPEF+NSEQPYDLNSWMES EA+ LAK L ED+VIVEGYAEYPTWRVHL
Sbjct: 345 FDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRVHL 404

Query: 433 AYLREKXXXXXXXXXXXXXXXXSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGF 492
           AY+REK                SIL +A+LFR+G+HFPAFTFENHAETEAFGKMAKKMGF
Sbjct: 405 AYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKMGF 464

Query: 493 RVGGLPHYTLWHIYEPSDDDLMAIATKEKE 522
           RVGGLPHYTLWHIYEPSDDDL+ IA+KE+E
Sbjct: 465 RVGGLPHYTLWHIYEPSDDDLLEIASKERE 494

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/527 (56%), Positives = 368/527 (69%), Gaps = 26/527 (4%)

Query: 8   LFRFSRNSYK-----LPLSEKTKEKRKN-RDFRLLPKYSKFKVTNFRDKVSNFNVALSVI 61
           L +F RNS K     LP+S          +  R +PK  K    N    V+  +V   +I
Sbjct: 5   LHKFGRNSRKDAKLELPISRNNSNVADELKKQRFIPK-KKSTAKN----VAIGSVVSFII 59

Query: 62  LLCIFIAKTISVNVS--IYKYNSFVHXXXXXXXXXXXQVLTAPEYYNYDFHDYNLDTISK 119
              I+   +   N S  + K N + +             L+  EYYNYDF +   D + K
Sbjct: 60  CALIYCGYSYFFNTSPRLGKINLYANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGK 119

Query: 120 YDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSRE 179
           ++ GV+ YL+  + TD    L+ + KE Y+ EL  LL +SV+ YD+K F G+ +G  +R+
Sbjct: 120 FENGVQHYLISEFGTD---VLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRD 176

Query: 180 HVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQN 239
           H+LLC+PLRDAE VLPLMFK+LMN+TYPHELID+AFLVSDCS+ D+TLE+LLQY+R LQN
Sbjct: 177 HLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQN 236

Query: 240 GTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQR----VKEAFKSPFHENYDK 295
           GTL  VF++MD+         E++DD+            Q     V+ AF +P HENYDK
Sbjct: 237 GTLSQVFQDMDEYQ------YEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDK 290

Query: 296 PFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDA 355
           PFRS+QI++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWLM NALKPYHSWVYWRDA
Sbjct: 291 PFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDA 350

Query: 356 DVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHED 415
           D+ELCPGT++ED+M+ D+DV+VPNVWRPLPEF++SEQPYDLNSW+ES EA+ LAK L ED
Sbjct: 351 DIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPED 410

Query: 416 EVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARARLFRAGVHFPAFTFE 475
           +VIVEGYAEYPTWRVHLAY+RE                 SILA+A+LFR+GVHFPAFTFE
Sbjct: 411 DVIVEGYAEYPTWRVHLAYIREAQGDPTSVVDLDGVGGVSILAKAKLFRSGVHFPAFTFE 470

Query: 476 NHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKE 522
           NHAETE FGKMAK+MG+RVGGLPHYT+WHIYEPSDDDL  IA KE++
Sbjct: 471 NHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQ 517

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/525 (55%), Positives = 365/525 (69%), Gaps = 31/525 (5%)

Query: 14  NSYKLPLS-----EKTKEKRKNRDFRLLPKYSKFKVTNFRDKVSNFNVALSVILLCIFIA 68
           N   LP+S       +K+KR + + + L     ++    R   S F +A++VI L I I 
Sbjct: 18  NGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQP---RSSSSKFQLAVNVISLVIIIV 74

Query: 69  KTI----------SVNVSIYKYNSFVHXXXXXXXXXXXQVLTAPEYYNYDFHDYNLDTIS 118
            ++           + +SI   N  +              L   EYYNYDF D + + +S
Sbjct: 75  LSLYLMILFLSEMKLGISIQNGNPLLGSENYKTID-----LEDEEYYNYDFEDIDPEVVS 129

Query: 119 KYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSR 178
           K+D GV+ YL+  + ++    L+    E Y  E+  LL S+V+ YD+ +F G  +G+ +R
Sbjct: 130 KFDDGVQHYLITQFGSE---VLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLETR 186

Query: 179 EHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQ 238
           +H+LLCIPLR+A DVLPLMFK+LMNLTYPHELID+AFLVSDCSE D TL++L+ Y+R LQ
Sbjct: 187 DHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQ 246

Query: 239 NGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVKEAFKSPFHENYDKPFR 298
           NGTL ++F+E+D +    D   +  D               RV +AF  PFH+NYDKPFR
Sbjct: 247 NGTLSEIFQEIDAV---IDSQTKGTD--KLYLKYMDEDYINRVHQAFSPPFHDNYDKPFR 301

Query: 299 SIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVE 358
           S+Q+++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWL  NALKPYHSWVYWRDADVE
Sbjct: 302 SVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVE 361

Query: 359 LCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVI 418
           LCPG+VI+DLMSK++DVIVPNVWRPLP F+NSEQPYDLNSWMES EA+DLAK L ED+VI
Sbjct: 362 LCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVI 421

Query: 419 VEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARARLFRAGVHFPAFTFENHA 478
           VEGYAEYPTWRVHLAY+R+                 SILA+A++FR GV FPAFTFENHA
Sbjct: 422 VEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHA 481

Query: 479 ETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKER 523
           ETEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDL  IAT+E+E+
Sbjct: 482 ETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREK 526

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/468 (58%), Positives = 350/468 (74%), Gaps = 12/468 (2%)

Query: 56  VALSVILLCIFIAKTISVNVSIYKYNSFVHXXXXXXXXXXXQVLTAPEYYNYDFHDYNLD 115
           VA+S + L  ++    S+N  + K  S  H             L   EYYNYDF   +  
Sbjct: 53  VAVSTVSLSRYLRGPASINKILKKLESGNHNYKTVN-------LQENEYYNYDFETLDPH 105

Query: 116 TISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGV 175
            I K+D+GV+ YL+  +  D    L+ + +E Y+AE+ +L  S+V  YD+ +F+G+  G 
Sbjct: 106 VIGKFDQGVQHYLISEFGND---VLTPKDQERYEAEVKQLFDSTVQRYDLNEFTGSPDGE 162

Query: 176 SSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTR 235
           ++R+HVL+C+PLRDAE+VLPLMFK+LMNLTYPHELIDVAFLVSDCS++D+TLE+L+ Y+R
Sbjct: 163 TNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSDCSDDDNTLEALIAYSR 222

Query: 236 FLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVKEAFKSPFHENYDK 295
            LQNGTL  +F EMD + +  +   ++  ++             +V++AF  P+HENYDK
Sbjct: 223 QLQNGTLSQIFGEMDAVTDYLN--AKDRKNNKLYLKYMKQEYLNKVEKAFTPPYHENYDK 280

Query: 296 PFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDA 355
           PFRS+QI++K+FGQ +GQ FSDRH VKVQGIRRKLMGR+RNWL  NALKPYHSWVYWRDA
Sbjct: 281 PFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTANALKPYHSWVYWRDA 340

Query: 356 DVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHED 415
           D+ELCPG+VI+D+M+KD+DV+VPNVWRPLPEF+N EQPYDLNSWMES EA++LA+ L ED
Sbjct: 341 DIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWMESPEALELAETLDED 400

Query: 416 EVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARARLFRAGVHFPAFTFE 475
           +VIVEGYAEYPTWRVHLAY+R++                SILARA+LFR GV FPAFTFE
Sbjct: 401 DVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAKLFRNGVQFPAFTFE 460

Query: 476 NHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKER 523
           NHAETEAFGKMA+K+GFRVGGLPHYTLWHIYEPSDDDL  IA KE+E+
Sbjct: 461 NHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKEREK 508

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/467 (59%), Positives = 342/467 (73%), Gaps = 6/467 (1%)

Query: 57  ALSVILLCIFIAKTISVNVSIYKYNSFVHXXXXXXXXX-XXQVLTAPEYYNYDFHDYNLD 115
           +L +I++ IF   +++   S Y   + +H            + LT  EYY++DF D    
Sbjct: 58  SLLIIIVYIFWGSSLTEMTSKYDSVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPA 117

Query: 116 TISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGV 175
            + K+D GV+ YL+  Y TD    L+    E Y  EL  +L +SV+ YD+  F+G+S+G 
Sbjct: 118 VVKKFDNGVQHYLISQYGTD---VLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGA 174

Query: 176 SSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTR 235
           ++R+H+LLC+PLRDAE VLPLMFK+LMNLTYPHELID+AFLVSDCSE D TL++LL Y++
Sbjct: 175 TNRDHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSK 234

Query: 236 FLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVKEAFKSPFHENYDK 295
            LQNGTL  VF EMD+ +   D   ++                + V  +FK   H NYDK
Sbjct: 235 HLQNGTLSQVFTEMDQYE--MDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDK 292

Query: 296 PFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDA 355
           PFRSIQ+++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWLM NALKPYH+WVYWRDA
Sbjct: 293 PFRSIQVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDA 352

Query: 356 DVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHED 415
           D+ELCPG+VIEDLMSKD+DVIVPNVWRPLPEF++ EQPYDLNSW+ES EA+ LAK L ED
Sbjct: 353 DIELCPGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDED 412

Query: 416 EVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARARLFRAGVHFPAFTFE 475
           +VIVEGYAEYPTWRVHLAY+R+                 SILA+A++FR+GV FPAFTFE
Sbjct: 413 DVIVEGYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFE 472

Query: 476 NHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKE 522
           NHAETEAFGKMA+KMGFRVGGLPHYT+WHIYEPSDDDLM IA KE++
Sbjct: 473 NHAETEAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQ 519

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/524 (55%), Positives = 367/524 (70%), Gaps = 28/524 (5%)

Query: 11  FSRNSYKLPLSEKTKEKRKNR---DFRLLPKY--SKFKVTNFRDKVSNFNVALSVILLCI 65
            SRN     + +K  E   N     +R  P+   SKF++T     +++  + ++V+ L +
Sbjct: 24  ISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKFQLTV---SITSL-IIIAVLSLYL 79

Query: 66  FIA--KTISVNVSIYKYNSFVHXXXXXXXXXXXQVLTAPEYYNYDFHDYNLDTISKYDKG 123
           FI+    + + VS     S +              L   EYY+YDF D + + ISK+D G
Sbjct: 80  FISFLSGMGIGVSTQNGRSLLGSSKSSENYKTID-LEDEEYYDYDFEDIDPEVISKFDDG 138

Query: 124 VRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSREHVLL 183
           V+ YL+  + ++    L+ +  E Y  EL  L  S+V+ YD+ +F G  +G+ +R+H+LL
Sbjct: 139 VQHYLISQFGSE---VLTPKDDEKYQRELNMLFDSTVEEYDLSNFEGAPNGLETRDHILL 195

Query: 184 CIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQNGTLP 243
           CIPLR+A DVLPLMFK+LMNLTYPHELID+AFLVSDCSE D TL++L+ Y+R LQNGTL 
Sbjct: 196 CIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQNGTLS 255

Query: 244 DVFEEMDKL----DEMTDKVVENADDSXXXXXXXXXXXXQRVKEAFKSPFHENYDKPFRS 299
            +F+E+D +     + TDK+     D              RV +AF  PFHENYDKPFRS
Sbjct: 256 QIFQEIDAVIDSQTKGTDKLYLKYMDEGYI---------NRVHQAFSPPFHENYDKPFRS 306

Query: 300 IQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVEL 359
           +QI++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWL  NALKPYHSWVYWRDADVEL
Sbjct: 307 VQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL 366

Query: 360 CPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIV 419
           CPG+VI+DLMSK++DVIVPNVWRPLP F+ +EQPYDLNSWMES+EA+ LAK L ED+VIV
Sbjct: 367 CPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIV 426

Query: 420 EGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARARLFRAGVHFPAFTFENHAE 479
           EGYAEYPTWRVHLAY+R+                 SILA+A++FR GV FPAFTFENHAE
Sbjct: 427 EGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAE 486

Query: 480 TEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKER 523
           TEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDL  IA++E+E+
Sbjct: 487 TEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREK 530

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/516 (55%), Positives = 358/516 (69%), Gaps = 19/516 (3%)

Query: 14  NSYKLPLS-----EKTKEKRKNRDFRLLPKYSKFKVTNFRDKVS-----NFNVALSVILL 63
           N   LP+S        K KR   DF+ L    +++  +   K+         + ++V+ L
Sbjct: 18  NGLGLPISRNGSSNNIKNKRSQHDFKSLKGKYRYQSRSTLSKLQLSVSFISIIIITVLSL 77

Query: 64  CIFIAKTISVNVSIYKYNSFVHXXXXXXXXXXXQV-LTAPEYYNYDFHDYNLDTISKYDK 122
            + I++   +NV++   +                + L   EYYNYDF D + + ISK+D 
Sbjct: 78  YLLISRLAGLNVNVSLRDGKSLLSPSESSENYKTIDLEDEEYYNYDFEDIDPEVISKFDG 137

Query: 123 GVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSREHVL 182
           G + YL+  + ++    L  + +E Y  EL  LL S+V+ YD+ DF G  +G+ +R+H+L
Sbjct: 138 GEQHYLISQFGSE---VLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLETRDHIL 194

Query: 183 LCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQNGTL 242
           LCIPLR+A DVLPLMFK+LMNLTYPHELID+AFLVSDCSE D TL++L+ Y+R LQNGTL
Sbjct: 195 LCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQNGTL 254

Query: 243 PDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVKEAFKSPFHENYDKPFRSIQI 302
             +F+++D +    D   +  D               RV +AF  PFH+NYDKPFRS+QI
Sbjct: 255 SQIFQDIDAI---IDSQTKGTD--KLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQI 309

Query: 303 YKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVELCPG 362
           ++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWL  NALKPYHSWVYWRDADVELCPG
Sbjct: 310 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 369

Query: 363 TVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIVEGY 422
           +VIEDLMSK++DV+VPNVWRPLP F+NSEQ YDLNSWMESREA++LAK L ED+VIVEGY
Sbjct: 370 SVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVIVEGY 429

Query: 423 AEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARARLFRAGVHFPAFTFENHAETEA 482
           AEYPTWRVHLAY+R+                 SILA+A++FR GV FPAFTFENHAETEA
Sbjct: 430 AEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEA 489

Query: 483 FGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIAT 518
           FGKMAKKMG+RVGGLPHYT+WHIYEPSDDDL  IAT
Sbjct: 490 FGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIAT 525

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/414 (64%), Positives = 322/414 (77%), Gaps = 8/414 (1%)

Query: 103 EYYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDI 162
           EYY+YDF D + + +SK+D GV  YL+  + +D    L+ +  E Y +EL  LL S+V+ 
Sbjct: 118 EYYDYDFEDIDPEVVSKFDNGVEHYLISQFGSD---VLTPKDDEKYQSELSMLLDSTVEK 174

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+  F G S+GV +R+H+LLC+PLR+A DVLPLMFK+LMNLTYPHELID+AFLVSDCSE
Sbjct: 175 YDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSE 234

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
           +D TL++L+ Y+R LQNGTL  +F+E+D +    D   +  D               RV+
Sbjct: 235 DDTTLDALIAYSRQLQNGTLSQIFQEIDAV---IDSQTKGTD--KLYLQYMDQNYINRVR 289

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNA 342
           +AF  PFHENYDKPFRS+QI++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWL  NA
Sbjct: 290 QAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 349

Query: 343 LKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMES 402
           LKPYHSWVYWRDADVELCPG++I+DLMSK++DVIVPNVWRPLP F+ SEQPYDLNSWMES
Sbjct: 350 LKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMES 409

Query: 403 REAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARARL 462
           +E ++LAK L ED+VIVEGYAEYPTWRVHLAY+R+                 SILA+A+L
Sbjct: 410 KEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKL 469

Query: 463 FRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAI 516
           FR GV FPAFTFENHAETEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDL  I
Sbjct: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/420 (63%), Positives = 324/420 (77%), Gaps = 10/420 (2%)

Query: 104 YYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIY 163
           Y+++DF D ++D +SK+D+G+  YL+  Y T++ S+  +     Y+  L  LL S+V+ Y
Sbjct: 103 YHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAE---YNDNLQMLLDSTVEKY 159

Query: 164 DMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSEN 223
           D+ +F G++ G   +EH+L+C+PLRDAE+VLPLMFKNLMNLTYPHELID+AFLVSDCSE 
Sbjct: 160 DLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEG 219

Query: 224 DHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVKE 283
           D TLE+L  Y++ LQ G LPD+  +MD  ++          +             +RVK 
Sbjct: 220 DKTLEALETYSQLLQEGILPDILADMDNYNK-------GKSNESIHLKYMEPDYLKRVKA 272

Query: 284 AFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNAL 343
           A+K PFH NY KPFRS+QI++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWLM+NAL
Sbjct: 273 AYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNAL 332

Query: 344 KPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESR 403
           KPYHSWVYWRDADVELCPG+VIEDLM +D+DVIVPNVWRPLP+F+NS QPYDLNSWMES 
Sbjct: 333 KPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESN 392

Query: 404 EAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARARLF 463
           EA+ LAK L ED+VIVEGYAEYPT+RVHLAY+RE+                SILARAR+F
Sbjct: 393 EALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVF 452

Query: 464 RAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKER 523
           R GVHF AFTFENHAETEAFGKMAKK+GFRVGGLPHYTLWHIYEPSDDDL+A+A  EK +
Sbjct: 453 REGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEKGK 512

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/424 (62%), Positives = 327/424 (77%), Gaps = 8/424 (1%)

Query: 99  LTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSS 158
           L+  EYYN+DF D +   I K+D+G + YL+  + TD    L+ + +E Y+ E+  L  S
Sbjct: 89  LSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTD---VLTPEDQEIYEREMNMLYDS 145

Query: 159 SVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVS 218
           +++ YD++DF G  +G  +R+HVLLCIPLRDA  VLPLMF++LMNLTYPHELID+AFLVS
Sbjct: 146 TIETYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVS 205

Query: 219 DCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXX 278
           DCSEND+TL++L+++++ LQNGTL  V  E+D   +      E +  S            
Sbjct: 206 DCSENDNTLDALIEFSKNLQNGTLSQVLNEIDAFTKE-----ETSTKSNLHLKYMDPEYL 260

Query: 279 QRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWL 338
           +RV++AF  PFHE+YDKPFRS+QI++K+FGQ +GQ FSDRH VKVQGIRRKLMGRARNWL
Sbjct: 261 KRVQKAFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWL 320

Query: 339 MTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNS 398
             NALKPYHSWVYWRDAD+ELCPG+VIEDLM+KD+DVIVPNVWRPLP F++ EQPYDLNS
Sbjct: 321 TANALKPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNS 380

Query: 399 WMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILA 458
           W ES EA+ LA+ L ED+VIVEGYAEYPTWRVHLAY+R+                 SILA
Sbjct: 381 WRESAEALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVSILA 440

Query: 459 RARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIAT 518
           +A+LFR+GV FPAFTFENHAETEAFGKMAKKMG++VGGLPHYTLWHIYEPSDDDL  +A 
Sbjct: 441 KAKLFRSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMAN 500

Query: 519 KEKE 522
           KE+E
Sbjct: 501 KERE 504

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/490 (56%), Positives = 343/490 (70%), Gaps = 5/490 (1%)

Query: 33  FRLLPKYSKFKVTNFRDKVSNFNVALSVILLCIFIAKTISVNVSIYKYNSFVHXXXXXXX 92
           ++L   +SK      R    N  +   VI+  + +    + +  +      +        
Sbjct: 21  YKLPTSHSKLSPKGKRSSWQNRKIVSWVIITVMVLILYKAFSGVVRGGREVMKTVGSNTS 80

Query: 93  XXXXQVLTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAEL 152
               QVL    YY+YDF D +   I K+D GV+ YL+  +  D    L+ Q  E ++ E 
Sbjct: 81  SNDGQVLEEDAYYDYDFEDIDPKVIEKFDGGVQHYLITQFGND---VLTPQDGEVFEREQ 137

Query: 153 PKLLSSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELID 212
             LLSS+V+ YD+  F G+++G ++ EHVLLC+PLRDAE VLPLMFK+LMNLTYPHELID
Sbjct: 138 KMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELID 197

Query: 213 VAFLVSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXX 272
           +AFLVSDC+E+D TL++L+ Y+R LQ+GTL  VF +MD+     ++  +  +        
Sbjct: 198 LAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFADMDQAAAEAEQASKGTE--KLYLKY 255

Query: 273 XXXXXXQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMG 332
                 + VKE+F  PFHENYDKPFRS+Q+++KDFGQ +GQ FSDRH VKVQGIRRKLMG
Sbjct: 256 MNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMG 315

Query: 333 RARNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQ 392
           RARNWL  NALKPYHSWVYWRDADVELCPG+VIEDLMSKD+DV VPNVWRPLP+F++ EQ
Sbjct: 316 RARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQ 375

Query: 393 PYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXX 452
           PYDLNSWMES EA++LAK L ED+VIVEGYAEYPT+RVHLAY+R+               
Sbjct: 376 PYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDPNEILDLDGVG 435

Query: 453 XXSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDD 512
             SILA+A LFR G+ FPAFTFENHAETE FGKMAKKMG+RVGGLPHYTLWHIYEPSDDD
Sbjct: 436 GVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDD 495

Query: 513 LMAIATKEKE 522
           L  IA KE+E
Sbjct: 496 LREIANKERE 505

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/426 (62%), Positives = 323/426 (75%), Gaps = 8/426 (1%)

Query: 98  VLTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLS 157
            L+   YY+YDF + + D I K+D GV  Y +  +       ++ +    ++ E+  LL 
Sbjct: 89  TLSDEAYYDYDFENIDPDVIKKFDNGVTYYKITQFGE---ETMTSEETTKFEQEVSMLLD 145

Query: 158 SSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLV 217
           S+V+ YDM+ F GT++   ++EHVLLC+PLRDAE+VLPLMFK+LMN+TYPHELID+AFLV
Sbjct: 146 STVEKYDMEQFRGTTNAAENQEHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLV 205

Query: 218 SDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXX 277
           SDCSE DHTL++L+ Y+R LQNGTL  VF E++  ++   K  EN               
Sbjct: 206 SDCSEGDHTLDALIAYSRQLQNGTLSQVFAEVEMSEKERKKGGEN-----LYLQYMDQDY 260

Query: 278 XQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNW 337
            QRVK++F  PFHENYDK FRS+QI++KDFGQ +GQ FSDRH VKVQG+RRKLM RARNW
Sbjct: 261 LQRVKDSFSPPFHENYDKSFRSVQIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNW 320

Query: 338 LMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLN 397
           L  NALKPYHSWVYWRDADVELCPG+VI+DLM+KD+DV+VPNVWRPLP F++ +QPYDLN
Sbjct: 321 LTANALKPYHSWVYWRDADVELCPGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLN 380

Query: 398 SWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSIL 457
           SW+ESREA+DLAK L ED+VIVEGYAEYPTWR HLAY R+                 SIL
Sbjct: 381 SWIESREALDLAKTLDEDDVIVEGYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSIL 440

Query: 458 ARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIA 517
           ARARLFR G+HFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL  I 
Sbjct: 441 ARARLFRLGIHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIG 500

Query: 518 TKEKER 523
            KE+E+
Sbjct: 501 NKEREK 506

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/510 (54%), Positives = 348/510 (68%), Gaps = 29/510 (5%)

Query: 17  KLPLSEKTKEKRKNRDFRLLPKYSKF--KVTNFRDKVSNFNVALSVILLCIFI--AKTIS 72
           +LP+   +K+K  +  FR    +  F  K+   R   S      +++L+  F+  +K + 
Sbjct: 11  ELPMHHDSKQKGNH--FRPKSGFGLFFAKINGLRYAKSRIVFLFALVLVSTFLLLSKLVG 68

Query: 73  VNVSIYKYNSFVHXXXXXXXXXXXQVLTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTY 132
            NV++ +Y                  L   EYY+YDF   ++DTI KYD+GV  Y++   
Sbjct: 69  GNVNLMQY--------------IPTSLDEQEYYDYDFKGLDIDTIKKYDEGVSHYII--- 111

Query: 133 KTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAED 192
               +  LS + KEA++ E   LL+S+ D+YD+  ++G S+G ++R+HVLLC+PLRDA  
Sbjct: 112 SKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRDHVLLCVPLRDAAS 171

Query: 193 VLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKL 252
           +LP++FKNLMNLTYPHELID+AFLVSDC++N  T+ SLL +++ LQNGTL    ++ +  
Sbjct: 172 LLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQNGTLSKTLQDFE-- 229

Query: 253 DEMTDKVVENADDSXXXXXXXXXXXXQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVG 312
               DK   N+ +             + VK AF  PFH++YDKPFRSIQI++KDFGQ +G
Sbjct: 230 ---ADKDKGNSAEQLYLKYMGKDYL-KMVKNAFNPPFHDDYDKPFRSIQIFEKDFGQQIG 285

Query: 313 QSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKD 372
           Q FSDRH VKVQG+RRKLMGRARNWL  NALKPYHSWVYWRD DVELCPGTVIEDLM  D
Sbjct: 286 QGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGTVIEDLMKHD 345

Query: 373 FDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHL 432
           +DVIVPNVWRPLP F+   Q YDLNSW+ES EAI LAK L ED+VIVEGYAEYPTWRVHL
Sbjct: 346 YDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYAEYPTWRVHL 405

Query: 433 AYLREKXXXXXXXXXXXXXXXXSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGF 492
            YLR+                 SILARA+LFR G+HFPAFTFENHAETEAFGKMAKKMGF
Sbjct: 406 GYLRKDNGNPDDLLDLDGVGGVSILARAQLFRKGIHFPAFTFENHAETEAFGKMAKKMGF 465

Query: 493 RVGGLPHYTLWHIYEPSDDDLMAIATKEKE 522
           +VGGL HYTLWHIYEPSDDDL  IA  E+E
Sbjct: 466 KVGGLMHYTLWHIYEPSDDDLREIAKLERE 495

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/465 (57%), Positives = 329/465 (70%), Gaps = 23/465 (4%)

Query: 60  VILLCIFIAKTISVNVSIYKYNSFVHXXXXXXXXXXXQVLTAPEYYNYDFHDYNLDTISK 119
           VIL+  F+  +I        Y +F               L   EYYNYDF + ++D I K
Sbjct: 2   VILIIFFLLNSILGGDPYVNYKTFS--------------LKDHEYYNYDFKNIDVDIIQK 47

Query: 120 YDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSRE 179
           YDKG   +L+          L+ +  E Y+ E+  LL ++VD+YD+  + G+ +G  +R+
Sbjct: 48  YDKGAEHFLI---SQGGAEVLTPEDNERYEKEVEMLLGATVDVYDLSKYEGSENGAENRD 104

Query: 180 HVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQN 239
           HVLLC+PLR+A +VLPLMFK+LMNLTYPHELID+AFLVSDCSE+D TL++L+ Y++ LQN
Sbjct: 105 HVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDDTLDALIAYSKELQN 164

Query: 240 GTLPDVFEEMDKLDEMTDKV-VENADDSXXXXXXXXXXXXQRVKEAFKSPFHENYDKPFR 298
           GTL ++F E D   EM  K  ++ + D               V+ AFK PFH++YDKPFR
Sbjct: 165 GTLSELFAEQD---EMRRKASIKGSPD--LYLKYMNQDYLNMVEMAFKPPFHKDYDKPFR 219

Query: 299 SIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVE 358
           S+Q+++KDFGQ +GQ FSDRH V VQGIRRKLMGRARNWL  NALKPYHSWVYWRD D+E
Sbjct: 220 SVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPYHSWVYWRDVDIE 279

Query: 359 LCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVI 418
           LCPG+VIEDLMS + DV VPNVWRPLPEF+  EQ YDLNSW+ES EA+ LA  L ED+VI
Sbjct: 280 LCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESGEALKLANTLDEDDVI 339

Query: 419 VEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARARLFRAGVHFPAFTFENHA 478
           VEGYAEYPTWRVHL Y+R                  SILA+A+LFRAGVHFPAFTFENHA
Sbjct: 340 VEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLFRAGVHFPAFTFENHA 399

Query: 479 ETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKER 523
           ETEAFGKMAKKM +RVGGLPHYT+WHIYEPSDDDL  IA KE+E+
Sbjct: 400 ETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDLKEIAKKEREK 444

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/471 (57%), Positives = 330/471 (70%), Gaps = 10/471 (2%)

Query: 56  VALSVILLCIFIAKTISVN--VSIYKYNSFVH---XXXXXXXXXXXQVLTAPEYYNYDFH 110
             L++ LLC       S +   +I  YNS+                + L   EYY+YDF 
Sbjct: 49  TCLAIYLLCKATLGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKNAKELEDVEYYDYDFR 108

Query: 111 DYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSG 170
             +  +   +D+G + YL+  Y  D V+    + KE Y  E+  LLSSSVD YD+  F G
Sbjct: 109 SIDEMSFHNFDQGEQHYLITQYGGDVVTS---KDKERYIQEMENLLSSSVDKYDLSQFEG 165

Query: 171 TSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESL 230
           T++G  +REH+L   PLRDAE VLP+MFK+LMNLTYPHELID+AFLVSDCSE D TL++L
Sbjct: 166 TANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTL 225

Query: 231 LQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVKEAFKSPFH 290
           + + R LQ+GTL D+F++MD     ++K  EN +              +    +F  P H
Sbjct: 226 ITFARHLQDGTLVDIFKDMDASIAKSEKKNENPN--KHYLKFMDQNYIKMADASFAGPHH 283

Query: 291 ENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWV 350
             Y+KPFRS+QI++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWL  NALKPYHSWV
Sbjct: 284 NEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWV 343

Query: 351 YWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAK 410
           YWRDADVELCPG+VI+DLMSK++DVIVPNVWRPLPEF+N EQPYDLNSWMES EA++LAK
Sbjct: 344 YWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAK 403

Query: 411 KLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARARLFRAGVHFP 470
            L ED+VIVEGYAEYPTWRVHLAYLR+                 SILA+A+LFR GVHFP
Sbjct: 404 TLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFP 463

Query: 471 AFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEK 521
           AFTFENHAETEAFGKMAKKMG+ VGGLP+Y LWHIYEPSDDDL  +A  E+
Sbjct: 464 AFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/407 (63%), Positives = 307/407 (75%), Gaps = 7/407 (1%)

Query: 117 ISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVS 176
           + K+D G   YL+     +    L    KE Y+ E+  LL S+V+ YD++DF G++ G  
Sbjct: 2   LRKFDNGAEHYLISKGGQE---ILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEV 58

Query: 177 SREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRF 236
           +REHVLL +PLR+AE VLPLMFKNLMNLTYPHELID+AFLVSDCSE+D TLE+LL+Y + 
Sbjct: 59  NREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKE 118

Query: 237 LQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVKEAFKSPFHENYDKP 296
           LQ+GTL DVF      +E+    ++                 + VK+A+  PFH+ YDKP
Sbjct: 119 LQSGTLSDVFAAHSSDEEL----IKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKP 174

Query: 297 FRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDAD 356
           FRS+QI++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWL  NALKPYHSWVYWRDAD
Sbjct: 175 FRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDAD 234

Query: 357 VELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDE 416
           VELCPG+VI+DLMS DFDV VPNVWRPLPEF+  EQPYDLNSW+ES  A+ LA+ L ED+
Sbjct: 235 VELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDD 294

Query: 417 VIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARARLFRAGVHFPAFTFEN 476
           VIVEGYAEYPTWRVHLAYLR+                 SILA+A+LFR GVHFPAFTFEN
Sbjct: 295 VIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFEN 354

Query: 477 HAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKER 523
           HAETEAFGKMAKKMG+RV GLPHYTLWHIYEPSDDDL+ IA +E+E+
Sbjct: 355 HAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREK 401

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/479 (55%), Positives = 333/479 (69%), Gaps = 12/479 (2%)

Query: 46  NFRDKVSNFNVALSVILL-CIF--IAKTISVNVSIYKYNSFVHXXXXXXXXXXXQVLTAP 102
           NFR      NV +S++ + CIF  I +T+  N S  +  + +             VL   
Sbjct: 50  NFRLSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPRSYAGL---LSISDSYDTAVLEES 106

Query: 103 EYYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDI 162
           EYYN+++   +LDT+ +YD G +  L+D   T     L+   +E ++  L  LLS++V+ 
Sbjct: 107 EYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT-----LNSNQEEGFEEHLDMLLSTTVET 161

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+  ++GT++G  +REHVL+C+PLR+AE+VLPLMF++LMNLTYPHELID+AFLVSDCS+
Sbjct: 162 YDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSK 221

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
           +DHT++SL+ Y   LQ GTL    +  D   +M  K      +               V+
Sbjct: 222 DDHTMDSLISYAEELQKGTLSKSLKLQDAY-KMHKKSKSKNKEGDLHLKYMNKDYLNMVE 280

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNA 342
            A K PFH+NYDKPFRS+QI++KDFGQ +GQ FSDRH VKVQG RRKLMG+ARNWL  NA
Sbjct: 281 NALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANA 340

Query: 343 LKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMES 402
           LKPYHSWVYWRDADVELCPG+VIEDLMS  +DVIVPNVWRPLPEF+ SEQ YDLNSW+ES
Sbjct: 341 LKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIES 400

Query: 403 REAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARARL 462
             A++LAK L ED+VIVEGYAEY TWR HLA  R+                 SILA+A+L
Sbjct: 401 DNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKL 460

Query: 463 FRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEK 521
           FR GVHF AF FENHAETEAFGKMAKKMG+RVGGL HYTLWHIYEPS+DDLM IA KE+
Sbjct: 461 FRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKER 519

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/427 (60%), Positives = 318/427 (74%), Gaps = 9/427 (2%)

Query: 97  QVLTAPEYYNYDFHDYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLL 156
           QVL  PEYY+Y+F   + + ++KYD+G   Y +    T D  Q+S    E ++ ++ +L+
Sbjct: 63  QVLDDPEYYDYEFAAASAERLAKYDEGFEHYFV----TRD-GQISRDDPE-FEEQMEELV 116

Query: 157 SSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFL 216
           S++V+ YD++++ GT +G  +REHVL+CIPLR+A  VLP+MFK+LMNLTYPHELIDVAFL
Sbjct: 117 SATVEQYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFL 176

Query: 217 VSDCSENDHTLESLLQYTRFLQNGTLPDVF-EEMDKLDEMTDKVVENADDSXXXXXXXXX 275
           VSDCSEND TL+SL++Y  +LQ GTL +V   E  ++  +  K      D          
Sbjct: 177 VSDCSENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGD--LYLKYMDQ 234

Query: 276 XXXQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRAR 335
              Q V++AF  P+HENY+KPFRS+Q++KKDFGQ +GQ FSDRH VKVQGIRR+LMGRAR
Sbjct: 235 EYLQMVRDAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRAR 294

Query: 336 NWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYD 395
           NWL  NALKPYHSWVYWRD DVELCPG+VIEDLMS  +DVIVPNVWRPLPEF+  +Q YD
Sbjct: 295 NWLTANALKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYD 354

Query: 396 LNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXS 455
           LNSW+ES +A++LAKKL ED+VIVEGYAEY TWR HL   RE                 S
Sbjct: 355 LNSWIESTDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVS 414

Query: 456 ILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMA 515
           ILA+A+LFR G HF AF FENHAETEAFGKMAKKMG++VGGLPHYTLWHIYEPSDDD+M 
Sbjct: 415 ILAKAKLFRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMD 474

Query: 516 IATKEKE 522
           IA +E+E
Sbjct: 475 IARRERE 481

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  484 bits (1245), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 226/338 (66%), Positives = 265/338 (78%), Gaps = 4/338 (1%)

Query: 185 IPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRFLQNGTLPD 244
           +PLR+A+ VLPLMFKNLMNLTYPHELID+AFLVSDCSE+D T E+LL+Y + LQ+GTL  
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 245 VFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVKEAFKSPFHENYDKPFRSIQIYK 304
           VF   +      + V+     S            + VK+AF  PFH+NYDKPFRS+QI++
Sbjct: 62  VFASHNS----GENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQ 117

Query: 305 KDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVELCPGTV 364
           K+FGQ +GQ+FSDRH VKVQG RRKLMGRARNWL  NALKPYHSWVYWRDADVELCPG+V
Sbjct: 118 KNFGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSV 177

Query: 365 IEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIVEGYAE 424
           IEDLM+  +DV VPNVWRPLPEF++ EQ YDLNSW+ES  A+DLAK+L ED+VIVEGYAE
Sbjct: 178 IEDLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAE 237

Query: 425 YPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARARLFRAGVHFPAFTFENHAETEAFG 484
           YPTWRVHL Y+RE+                SILA+A+LFR GVHFPAFTFENHAETEAFG
Sbjct: 238 YPTWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFG 297

Query: 485 KMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKE 522
           KMAKKMG+ V GLPHYTLWHIYEPSDDDL+ +  +E+E
Sbjct: 298 KMAKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERE 335

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  354 bits (908), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 180/367 (49%), Positives = 230/367 (62%), Gaps = 54/367 (14%)

Query: 159 SVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVS 218
           +V  YD++++ G + G    +HVL  +PLRDA + LP+ F ++  ++YPH LID++FLVS
Sbjct: 52  NVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVS 111

Query: 219 DCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXX 278
           D S  D T+  LL+Y +  Q  + PD                                  
Sbjct: 112 DSS--DDTMGVLLEYLQKAQ--SKPD--------------------------------RT 135

Query: 279 QRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWL 338
           QR                F +I+IY+KDFGQ +GQSFSDRH    QG RRKLMGRARNWL
Sbjct: 136 QR----------------FGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWL 179

Query: 339 MTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNS 398
            + ALKPYHSWVYWRD DVE  P T++EDLM  D DVIVPNVWRPLP+++ + QPYDLNS
Sbjct: 180 GSVALKPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNS 239

Query: 399 WMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILA 458
           W ES   + LA+ L ED VIVEGY EY TWR HLAY+R+                 SIL+
Sbjct: 240 WQESEGGLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILS 299

Query: 459 RARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL--MAI 516
           +A++FRAG HFPAF+FE HAETEAFGK+++++G+ V GLPHY +WHIYEPS DDL  MA 
Sbjct: 300 KAKVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAW 359

Query: 517 ATKEKER 523
             +E++R
Sbjct: 360 MAEEEKR 366

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  351 bits (901), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 178/367 (48%), Positives = 226/367 (61%), Gaps = 54/367 (14%)

Query: 159 SVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVS 218
            VD YD+ ++ G   G    + VL C+PLRDA + LP+ FK+L ++TYPH LID++FLVS
Sbjct: 49  GVDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVS 108

Query: 219 DCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXX 278
           D +  D T+  LL     LQ+                       AD +            
Sbjct: 109 DST--DDTMGVLLNSLHDLQS----------------------QADGT------------ 132

Query: 279 QRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWL 338
                           K F  I+I++KDFGQ +GQSFSDRH    QG RRKLM RARNWL
Sbjct: 133 ----------------KRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWL 176

Query: 339 MTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNS 398
            + A+KPYHSWVYWRD DVE  P T++EDLM  D D+IVPNVWRPLP+++N  QPYDLNS
Sbjct: 177 GSAAIKPYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNS 236

Query: 399 WMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILA 458
           W+ES   + LA  L ED+VIVEGY EY TWRVHLAY+R+                 SIL+
Sbjct: 237 WVESEGGLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILS 296

Query: 459 RARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL--MAI 516
           +A++FR G HFPAF+FE HAETEAFGK++++M + V GLPHY +WH+YEPS DDL  MA 
Sbjct: 297 KAKVFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAW 356

Query: 517 ATKEKER 523
             +E++R
Sbjct: 357 MAEEEQR 363

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  351 bits (901), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 175/367 (47%), Positives = 228/367 (62%), Gaps = 56/367 (15%)

Query: 159 SVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVS 218
            V+ YD+ D++G   G    + +L C+PLRDA + LP+ F +L  +TYPH LID++FLVS
Sbjct: 53  GVEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVS 112

Query: 219 DCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXX 278
           D S+N  T+  L+ + +  Q                                        
Sbjct: 113 DSSDN--TMGVLMHHLQQAQ---------------------------------------- 130

Query: 279 QRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWL 338
                       ++ +K F +I+I++KDFGQ +GQSFSDRH    QG RRKLM RARNWL
Sbjct: 131 ------------KDKNKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWL 178

Query: 339 MTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNS 398
            + A+KPYHSWVYWRD DVE+ P +++EDLM  D DVIVPNVWRPLP+++ + QPYDLNS
Sbjct: 179 GSVAIKPYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNS 238

Query: 399 WMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILA 458
           W+ES   + LA  L ED VIVEGY EY TWR HLAY+R+                 SIL+
Sbjct: 239 WVESEGGLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILS 298

Query: 459 RARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL--MAI 516
           +AR+FRAG HFPAF+F+ HAETEAFGK++++MGF V GLPHY +WHIYEPS DDL  MA 
Sbjct: 299 KARVFRAGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAW 358

Query: 517 ATKEKER 523
             +E++R
Sbjct: 359 MAEEEKR 365

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  349 bits (895), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 178/366 (48%), Positives = 226/366 (61%), Gaps = 53/366 (14%)

Query: 159 SVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVS 218
           SV+ YDM ++ G   G +    +L+C+PL+DA + LPL FK L  +TYPHELID++FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 219 DCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXX 278
           D S+N  T+ +LL   + L             ++D  T                      
Sbjct: 114 DSSDN--TMYNLLNMLKRL-------------QIDGGTSG-------------------- 138

Query: 279 QRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWL 338
                             F +I+IY+KDFGQ +GQ FSDRH    QG RRKLMG+ARNWL
Sbjct: 139 -----------------KFGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWL 181

Query: 339 MTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNS 398
            T A+KPYHSWVYWRD DVE+ P T++EDLM  D DVIVPNVWRPLP+++ + QPYDLNS
Sbjct: 182 NTVAIKPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNS 241

Query: 399 WMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILA 458
           W ES   + L+  L ED VIVEGY EY TWR HLAY+R+                 SIL+
Sbjct: 242 WKESEAGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILS 301

Query: 459 RARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIAT 518
           +A +FR+G HFPAF+F+ HAETEAFGK++K M F V GLP+Y +WHIYEPS +DL  +A 
Sbjct: 302 KANVFRSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAK 361

Query: 519 -KEKER 523
            +EKER
Sbjct: 362 LEEKER 367

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  350 bits (899), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 173/361 (47%), Positives = 220/361 (60%), Gaps = 52/361 (14%)

Query: 157 SSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFL 216
           + SV+ YD++++ G   G    + +L C+PLRDA + LP+ F +L  +TYPH LID++FL
Sbjct: 59  TPSVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFL 118

Query: 217 VSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXX 276
           VSD S+N  T+  LL   +  Q+                                     
Sbjct: 119 VSDSSDN--TMGVLLSNLQMAQS------------------------------------- 139

Query: 277 XXQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARN 336
                         ++  K F +I+IY+KDFGQ +GQSFSDRH    QG RRKLM RARN
Sbjct: 140 -------------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARN 186

Query: 337 WLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDL 396
           WL + ALKPYHSWVYWRD DVE  P T++EDLM  D DVIVPNVWRPLP+++ + QPYDL
Sbjct: 187 WLGSVALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDL 246

Query: 397 NSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSI 456
           NSW ES   + LA  L ED VIVEGY EY TWR HLAY+R+                 SI
Sbjct: 247 NSWKESEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSI 306

Query: 457 LARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAI 516
           LA+A++FR G HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS DDL  +
Sbjct: 307 LAKAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHM 366

Query: 517 A 517
           A
Sbjct: 367 A 367

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  349 bits (895), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 172/361 (47%), Positives = 217/361 (60%), Gaps = 52/361 (14%)

Query: 157 SSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFL 216
           +  V+ YD++++ G   G    + +L C+PLRDA + LP+ F +L  +TYPH LID++FL
Sbjct: 59  TPDVEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFL 118

Query: 217 VSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXX 276
           VSD S+N                 T+  +   + K     DK                  
Sbjct: 119 VSDSSDN-----------------TMGVLLSNLHKAQSQQDK------------------ 143

Query: 277 XXQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARN 336
                             K F +I+IY+KDFGQ +GQSFSDRH    QG RRKLM RARN
Sbjct: 144 -----------------SKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARN 186

Query: 337 WLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDL 396
           WL + ALKPYHSWVYWRD DVE  P T++EDLM  D DVIVPNVWRPLP+++ + QPYDL
Sbjct: 187 WLGSVALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDL 246

Query: 397 NSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSI 456
           NSW ES   + LA  L ED VIVEGY EY TWR HLAY+R+                 SI
Sbjct: 247 NSWKESEGGLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSI 306

Query: 457 LARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAI 516
           LA+A++FR G HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS DDL  +
Sbjct: 307 LAKAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHM 366

Query: 517 A 517
           A
Sbjct: 367 A 367

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  348 bits (893), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 175/367 (47%), Positives = 226/367 (61%), Gaps = 54/367 (14%)

Query: 159 SVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVS 218
            V+ YD++++ G   G    + VL  +PLRDA + LP+ F ++  ++YPH LID++FLVS
Sbjct: 52  GVEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVS 111

Query: 219 DCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXX 278
           D S  D T+  LL + +  Q+ T                                     
Sbjct: 112 DSS--DDTMGVLLDHLKKAQSKT------------------------------------- 132

Query: 279 QRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWL 338
                        +  K F +I+I++KDFGQ +GQSFSDRH    QG RRKLMGRARNWL
Sbjct: 133 -------------DRKKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWL 179

Query: 339 MTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNS 398
            + ALKPYHSWVYWRD DVE  P T++EDLM  D DVIVPNVWRPLP+++ + QPYDLNS
Sbjct: 180 GSVALKPYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNS 239

Query: 399 WMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILA 458
           W ES   + LA+ L ED VIVEGY EY TWR HLAY+R+                 SIL+
Sbjct: 240 WQESEGGMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILS 299

Query: 459 RARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL--MAI 516
           +A++FRAG HFPAF+FE HAETEAFGK+++++G+ V GLPHY +WHIYEPS DDL  MA 
Sbjct: 300 KAKVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAW 359

Query: 517 ATKEKER 523
             +E++R
Sbjct: 360 MAEEEKR 366

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  347 bits (890), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 176/367 (47%), Positives = 227/367 (61%), Gaps = 54/367 (14%)

Query: 159 SVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVS 218
            V+ YD++++ G S G    + +L C+PLRDA + LP+ F++L  +TYPH  ID++FLVS
Sbjct: 61  GVEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVS 120

Query: 219 DCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXX 278
           D S  D T+  LL + +  Q+        +MDK                           
Sbjct: 121 DSS--DDTMGVLLSHLQSAQS--------QMDK--------------------------- 143

Query: 279 QRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWL 338
                           K F +I+IY+KDFGQ +GQSFSDRH    QG RRKLM RARNWL
Sbjct: 144 ---------------SKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWL 188

Query: 339 MTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNS 398
            + ALKPYHSWVYWRD DVE  P T++EDLM  D DVIVPNVWRPLP+++ + QPYDLNS
Sbjct: 189 GSVALKPYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNS 248

Query: 399 WMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILA 458
           W ES   + LA+ L ED VIVEGY EY TWR HLAY+R+                 SIL+
Sbjct: 249 WQESEGGLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILS 308

Query: 459 RARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL--MAI 516
           +A++FR G HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS +DL  MA 
Sbjct: 309 KAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAW 368

Query: 517 ATKEKER 523
             +E++R
Sbjct: 369 MAEEEKR 375

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  348 bits (893), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 176/367 (47%), Positives = 224/367 (61%), Gaps = 54/367 (14%)

Query: 159 SVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVS 218
            V+ YD+ ++ G   G    + +L C+PLRDA + LP+ F +L  +TYPH LID++FLVS
Sbjct: 81  GVEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVS 140

Query: 219 DCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXX 278
           D S+N  T+  LL     LQN                                       
Sbjct: 141 DSSDN--TMGVLLSN---LQNAQ------------------------------------- 158

Query: 279 QRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWL 338
                       ++  K F +I+I++KDFGQ +GQSFSDRH  K QG RRKLM RARNWL
Sbjct: 159 ----------SQQDRSKRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWL 208

Query: 339 MTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNS 398
            + A+KPYHSWVYWRD DVE  P T++EDLM  D DVIVPNVWRPLP+++ + QPYDLNS
Sbjct: 209 GSVAIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNS 268

Query: 399 WMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILA 458
           W ES   + LA  L ED VIVEGY EY TWR HLAY+R+                 SIL+
Sbjct: 269 WQESEGGLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILS 328

Query: 459 RARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL--MAI 516
           +A++FR+G HFPAF+FE HAETEAFGK++++M F V GLPHY +WHIYEPS +DL  MA 
Sbjct: 329 KAKVFRSGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAW 388

Query: 517 ATKEKER 523
             +E++R
Sbjct: 389 MAEEEKR 395

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  347 bits (890), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 173/361 (47%), Positives = 220/361 (60%), Gaps = 52/361 (14%)

Query: 157 SSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFL 216
           +  V+ YD++++ G   G    + +L C+PLRDA + LP+ F +L  ++YPH LID++FL
Sbjct: 59  TPGVEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFL 118

Query: 217 VSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXX 276
           VSD S+N  T+  LL   +  Q+        + DK                         
Sbjct: 119 VSDSSDN--TMGVLLSKLQMAQS--------QQDKT------------------------ 144

Query: 277 XXQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARN 336
                             K F +I+IY+KDFGQ +GQSFSDRH    QG RRKLM RARN
Sbjct: 145 ------------------KRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARN 186

Query: 337 WLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDL 396
           WL + ALKPYHSWVYWRD DVE  P T++EDLM  D DVIVPNVWRPLP+++ + QPYDL
Sbjct: 187 WLGSVALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDL 246

Query: 397 NSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSI 456
           NSW ES   + LA  L ED VIVEGY EY TWR HLAY+R+                 SI
Sbjct: 247 NSWKESEGGLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSI 306

Query: 457 LARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAI 516
           LA+A++FR G HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS DDL  +
Sbjct: 307 LAKAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHM 366

Query: 517 A 517
           A
Sbjct: 367 A 367

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  345 bits (886), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 172/368 (46%), Positives = 227/368 (61%), Gaps = 54/368 (14%)

Query: 158 SSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLV 217
           ++ + YD+K++ G S+G  + + +L C+PLRDA + LP+ FK+L  +TYPH L+D++FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 218 SDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXX 277
           SD    D T+  LL   +  Q+                                      
Sbjct: 125 SDS--KDDTMGVLLSNLQTAQS-------------------------------------- 144

Query: 278 XQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNW 337
                        ++  K F +I+ ++KDFGQ +GQSFSDRH    QG RRKLM RARNW
Sbjct: 145 ------------QKDRSKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNW 192

Query: 338 LMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLN 397
           L + A+KPYHSWVYWRD DVE  P T++EDLM    DVIVPNVWRPLPE++ + QPYDLN
Sbjct: 193 LGSVAIKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLN 252

Query: 398 SWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSIL 457
           SW ES   ++LA  L +D VIVEGY EY TWR HLAY+R+                 SIL
Sbjct: 253 SWQESDAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSIL 312

Query: 458 ARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL--MA 515
           ++AR+FR+G HFPAF+FE HAETEAFGK++++MG+ V GLPHY +WHIYEPS +DL  MA
Sbjct: 313 SKARVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMA 372

Query: 516 IATKEKER 523
              +E++R
Sbjct: 373 WMAEEEQR 380

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  345 bits (884), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 180/368 (48%), Positives = 225/368 (61%), Gaps = 55/368 (14%)

Query: 159 SVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVS 218
            V+ +D+    G + G +  + VL C+PLRDA + LP+ FK+L  +TYPH L+D++FLVS
Sbjct: 41  GVEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVS 100

Query: 219 DCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXX 278
           D    D T+  L Q+ R LQ  + PD                 NA               
Sbjct: 101 DS--KDETMSVLRQHVRELQ--SQPD-----------------NA--------------- 124

Query: 279 QRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWL 338
                           + F +I+I++KDFGQ +GQSFSDRH    QG RRKLM RARNWL
Sbjct: 125 ----------------RQFGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWL 168

Query: 339 MTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNS 398
            + ALKPYHSWVYWRD DVE  P T+IEDLM  D DVIVPNVWRPLP+++   QPYDLNS
Sbjct: 169 GSVALKPYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNS 228

Query: 399 WMESREAIDLAKKL-HEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSIL 457
           W+ES   + LA     ED VIVEGY EY TWRVHLAY+R+                 SIL
Sbjct: 229 WVESEGGLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSIL 288

Query: 458 ARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL--MA 515
           +RAR+FR+G HFPAF+F+ HAETE FGK+++ MG+ V GLPHY +WHIYEPS DDL  MA
Sbjct: 289 SRARVFRSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMA 348

Query: 516 IATKEKER 523
              +E++R
Sbjct: 349 WMAEEEQR 356

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  346 bits (888), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 170/358 (47%), Positives = 218/358 (60%), Gaps = 52/358 (14%)

Query: 160 VDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSD 219
           V+ YD++++ G   G    + +L C+PLRDA + LP+ F +L  ++YPH LID++FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 220 CSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQ 279
            S+N  T+  LL   +  Q+                                        
Sbjct: 122 SSDN--TMGVLLSSLQTAQS---------------------------------------- 139

Query: 280 RVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLM 339
                      ++  K F +I+IY+KDFGQ +GQSFSDRH    QG RRKLM RARNWL 
Sbjct: 140 ----------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLG 189

Query: 340 TNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSW 399
           + ALKPYHSWVYWRD DV+  P T++EDLM  D DVIVPNVWRPLP+++ + QPYDLNSW
Sbjct: 190 SVALKPYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSW 249

Query: 400 MESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILAR 459
            ES   + LA  L ED VIVEGY EY TWR HLAY+R+                 SILA+
Sbjct: 250 KESEGGLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAK 309

Query: 460 ARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIA 517
           A++FR G HFPAF+FE HAETEAFG+++++M + V GLPHY +WHIYEPS DDL  +A
Sbjct: 310 AKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  344 bits (883), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 176/366 (48%), Positives = 224/366 (61%), Gaps = 54/366 (14%)

Query: 160 VDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSD 219
           V+ YD+ ++ G + G    + VL C+PLRDA + LP+ FK++  ++YPH LID++FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 220 CSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQ 279
            S  D T+  LL   +                      K   N D S            Q
Sbjct: 142 SS--DDTMGVLLSSLK----------------------KAQSNQDKS------------Q 165

Query: 280 RVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLM 339
           R                F +I+I++KDFGQ +GQSFSDRH    QG RRKLM RARNWL 
Sbjct: 166 R----------------FGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLG 209

Query: 340 TNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSW 399
           + ALKPYHSWVYWRD DVE  P T++EDLM  + DVIVPNVWRPLP+++ + QPYDLNSW
Sbjct: 210 SVALKPYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSW 269

Query: 400 MESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILAR 459
            ES   + LA  L ED VIVEGY EY TWR HLAY+R+                 SIL++
Sbjct: 270 KESEGGLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSK 329

Query: 460 ARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL--MAIA 517
           A++FR G HFPAF+FE HAETEAFGK++++M + V GLPHY +WH+YEPS DDL  MA  
Sbjct: 330 AKVFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWM 389

Query: 518 TKEKER 523
            +E++R
Sbjct: 390 AEEEKR 395

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  345 bits (884), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 170/357 (47%), Positives = 219/357 (61%), Gaps = 52/357 (14%)

Query: 157 SSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFL 216
           + +V+ YD++++ G   G    + ++ C+PLRDA   LP  F +L  ++YPH LID++FL
Sbjct: 62  TPNVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFL 121

Query: 217 VSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXX 276
           VSD S  D T+  LL   +  Q+                                     
Sbjct: 122 VSDSS--DDTMGVLLSNLQTAQS------------------------------------- 142

Query: 277 XXQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARN 336
             QR K            K F +I+IY+KDFGQ +GQSFSDRH    QG RRKLM RARN
Sbjct: 143 --QRDKS-----------KRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARN 189

Query: 337 WLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDL 396
           WL + ALKPYHSWVYWRD D+E  P T++EDLM  D D+IVPNVWRPLP+++ + QPYDL
Sbjct: 190 WLGSVALKPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDL 249

Query: 397 NSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSI 456
           NSW ES   + LA +L+ED VIVEGY EY TWR HLAY+R+                 SI
Sbjct: 250 NSWQESEGGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSI 309

Query: 457 LARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL 513
           L++A +FR+G HFPAF+FE HAETEAFGK++++MG+ V GLPHY +WHIYEPS +DL
Sbjct: 310 LSKANVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDL 366

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  345 bits (885), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 175/369 (47%), Positives = 221/369 (59%), Gaps = 54/369 (14%)

Query: 157 SSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFL 216
           +  V  YD+ ++ G S G    + +L C+PLRDA   LP  F +L  +TYPH LID++FL
Sbjct: 69  TPGVHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFL 128

Query: 217 VSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXX 276
           VSD    D T+  LL + +  Q+                                     
Sbjct: 129 VSDSK--DDTMGVLLSHLQTAQS------------------------------------- 149

Query: 277 XXQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARN 336
                         +N  K F +I+IY+KDFGQ +GQSFSDRH    QG RRKLM RARN
Sbjct: 150 -------------QQNKLKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARN 196

Query: 337 WLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDL 396
           WL + ALKPYHSWVYWRD DVE CP T++EDLM    DVIVPNVWRPLP+++ + QPYDL
Sbjct: 197 WLGSVALKPYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDL 256

Query: 397 NSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSI 456
           NSW ES   + LA  L ED VIVEGY EY TWR HLAY+R+                 SI
Sbjct: 257 NSWQESEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSI 316

Query: 457 LARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL--M 514
           L++A++FR+G HFPAF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS +DL  M
Sbjct: 317 LSKAKVFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHM 376

Query: 515 AIATKEKER 523
           A   +E++R
Sbjct: 377 AWMAEEEKR 385

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  339 bits (870), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 174/367 (47%), Positives = 225/367 (61%), Gaps = 54/367 (14%)

Query: 159 SVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVS 218
            V+ YD+ ++ G ++G  + + V+ C+PLRDA   L + F  L  LTYPH LID++FLVS
Sbjct: 56  GVEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVS 115

Query: 219 DCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXX 278
           D S  D T+++LL + R  Q+                      N D S            
Sbjct: 116 DSS--DDTMKTLLSHLRRAQS----------------------NQDKS------------ 139

Query: 279 QRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWL 338
                           + F +I+I++KDFGQ+VGQSFSDRH    QG RRK M RARNWL
Sbjct: 140 ----------------RRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWL 183

Query: 339 MTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNS 398
            + ALKPYHS+VYWRD DV+  P T++EDLM  D DVIVPNVWRPLP+++ + QPYDLNS
Sbjct: 184 GSAALKPYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNS 243

Query: 399 WMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILA 458
           W+ES   + LA  L ED  IVEGY EY TWR HLAY+R+                 SIL+
Sbjct: 244 WVESEGGLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILS 303

Query: 459 RARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL--MAI 516
           +A++FR G HFPAF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS DDL  MA 
Sbjct: 304 KAKVFRTGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAW 363

Query: 517 ATKEKER 523
             +E++R
Sbjct: 364 MAEEEKR 370

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  341 bits (874), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 173/359 (48%), Positives = 217/359 (60%), Gaps = 52/359 (14%)

Query: 159 SVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVS 218
            V+ YD+ ++ G   G    + +L C+PLRDA + LP+ F +L  ++YPH  ID++FLVS
Sbjct: 86  GVEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVS 145

Query: 219 DCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXX 278
           D S  D T+  LL     LQN        + DK                           
Sbjct: 146 DSS--DDTMGVLLSN---LQNAQ-----SQQDK--------------------------- 168

Query: 279 QRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWL 338
                           K F +I+I++KDFGQ +GQSFSDRH    QG RRKLM RARNWL
Sbjct: 169 ---------------SKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWL 213

Query: 339 MTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNS 398
            + A+KPYHSWVYWRD DVE  P T++EDLM  D DVIVPNVWRPLP+++ + QPYDLNS
Sbjct: 214 GSVAIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNS 273

Query: 399 WMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILA 458
           W ES   + LA  L ED+VIVEGY EY TWR HLAY+R+                 SILA
Sbjct: 274 WKESEGGLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILA 333

Query: 459 RARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIA 517
           +A++FR G HFPAF+FE HAETEAFGK+++KM + V GLPHY +WHIYEPS +DL  +A
Sbjct: 334 KAKVFRTGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  345 bits (884), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 166/361 (45%), Positives = 220/361 (60%), Gaps = 52/361 (14%)

Query: 157 SSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFL 216
           +  V+ YD+ ++ G   G    + +L CIPLRDA   LP+ F ++  +TYPH L+D++FL
Sbjct: 63  TPGVEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFL 122

Query: 217 VSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXX 276
           VSD S  D T+  LL + + +Q+                                     
Sbjct: 123 VSDSS--DDTMGVLLSHLQTVQS------------------------------------- 143

Query: 277 XXQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARN 336
                         ++  K F +I+IY+KDFGQ +GQSFSDRH    QG RRKLM +ARN
Sbjct: 144 -------------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARN 190

Query: 337 WLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDL 396
           WL + ALKPYHSWVYWRD D+E  P T++EDLM  D D+IVPNVWRPLP+++ + QPYDL
Sbjct: 191 WLGSVALKPYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDL 250

Query: 397 NSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSI 456
           NSW ES   + LA +L E+ VIVEGY EY TWR HLAY+R+                 SI
Sbjct: 251 NSWQESEGGLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSI 310

Query: 457 LARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAI 516
           L++A++FR+G HFPAF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS +DL  +
Sbjct: 311 LSKAKVFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHM 370

Query: 517 A 517
           A
Sbjct: 371 A 371

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  332 bits (851), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 170/368 (46%), Positives = 220/368 (59%), Gaps = 55/368 (14%)

Query: 159 SVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVS 218
            V+ YD++++ G   G      +L  +PLRDA   LP  F ++  L+YPH LID++FLVS
Sbjct: 56  GVEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVS 115

Query: 219 DCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXX 278
           D S  D T+  LL + +  Q+                                       
Sbjct: 116 DSS--DDTMGELLHHLQIAQS--------------------------------------- 134

Query: 279 QRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWL 338
                       ++ +K F +I+I++KDFGQ +GQSFSDRH    QG RRKLM RARNWL
Sbjct: 135 -----------QKDRNKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWL 183

Query: 339 MTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNS 398
            +  LKPYHSWVYWRD DVE+ P +++EDLM  D DVIVPNVWRPLP+++ + QPYDLNS
Sbjct: 184 GSVTLKPYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNS 243

Query: 399 WMESREAIDLAKKL-HEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSIL 457
           W ES   I LA  L  ED VIVEGY E+ TWR HLAY+R+                 SIL
Sbjct: 244 WKESEAGIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSIL 303

Query: 458 ARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL--MA 515
           A+A++FR G HFPAF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS +DL  MA
Sbjct: 304 AKAKVFRTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMA 363

Query: 516 IATKEKER 523
              +E++R
Sbjct: 364 WMAEEEKR 371

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  333 bits (854), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 169/360 (46%), Positives = 218/360 (60%), Gaps = 53/360 (14%)

Query: 159 SVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVS 218
           +V+ YD++++ G   G      +L  +PLRDA + LP  F ++  +TYPH LID +FLVS
Sbjct: 62  NVEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVS 121

Query: 219 DCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXX 278
           D S  D T+ +LL +               ++K     DK                    
Sbjct: 122 DSS--DDTMGALLSH---------------LEKAQSNKDKT------------------- 145

Query: 279 QRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWL 338
                           + F +I+IY+KDFGQ +GQSFSDRH    QG RRKLM RARNWL
Sbjct: 146 ----------------RRFGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWL 189

Query: 339 MTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNS 398
            T ALK YHSWVYWRD DVELCP +++EDLM  D DVIVPNVWRPLP+++ + QPYDLNS
Sbjct: 190 GTVALKAYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNS 249

Query: 399 WMESREAIDLAKKLHEDE-VIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSIL 457
           W ES   + LA  L +D+ VIVEGY +Y TWR HLAY+R+                 SIL
Sbjct: 250 WKESEVGVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSIL 309

Query: 458 ARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIA 517
           ++ ++FR G HFPAF+FE HAETEAFGK++++MG+ V GLPHY +WHIYEPS +DL  +A
Sbjct: 310 SKGKVFRTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  168 bits (426), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 104/348 (29%), Positives = 169/348 (48%), Gaps = 57/348 (16%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     T   +  +EHVL+  P++   D     + NL+ ++YP  L+++ F++     
Sbjct: 99  YDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLELGFIIPRTPT 155

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D TL+ L    + +Q G + D F ++  L +          DS                
Sbjct: 156 GDETLKKLEAAVKNVQTGKVEDRFAKITILRQ----------DS---------------- 189

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNA 342
                   +++DK               +G+   +RH + VQ  RR  M  ARN L+ ++
Sbjct: 190 --------QSFDK---------------LGEK--ERHSLAVQKERRSAMALARNELLFSS 224

Query: 343 LKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPL---PEFMNSEQPYDLNSW 399
           + P  SWV W DAD+   P TVI+D+ + +  V+  NV++      +  NS +PYD N+W
Sbjct: 225 IGPSTSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQRFFDKEKNENSIRPYDFNNW 284

Query: 400 MESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILAR 459
            ES + +++AK ++EDE+IVEGYAE  T+R  +A+  +K                  L +
Sbjct: 285 AESEKGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALDGVGGGCTLVK 344

Query: 460 ARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
           A + R G  FP F F +  ETE F KMAK++ + + GLP+Y ++HI E
Sbjct: 345 AEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  160 bits (406), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 100/362 (27%), Positives = 168/362 (46%), Gaps = 73/362 (20%)

Query: 157 SSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFL 216
           +  +  YD+   + T    +++E VL+  P++   D     + NL+ LTYP +LI++ F+
Sbjct: 93  AGHISHYDLNKLTSTDKAFANKEQVLILTPMQTFHDQY---WDNLLQLTYPRDLIELGFI 149

Query: 217 VSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXX 276
           +   +  D  L  L    +  Q G                                    
Sbjct: 150 IPRTATGDTALRKLEAAVKRTQLG------------------------------------ 173

Query: 277 XXQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSF-----SDRHDVKVQGIRRKLM 331
                            D+ F  I I ++D      QSF      +RH +KVQ  RR  M
Sbjct: 174 ---------------KKDQRFSKITILRQD-----SQSFDSLQEKERHALKVQKERRAAM 213

Query: 332 GRARNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMN-- 389
             ARN L+ + + P+ SW+ W DAD+   P ++I+D+ + +  V+  NV++   ++MN  
Sbjct: 214 ALARNELLFSTIGPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQ---KYMNEE 270

Query: 390 ----SEQPYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXX 445
               +E+PYD N+W +S +A+ +A  + +DEV+ EGYAE PT+R  +A++ +        
Sbjct: 271 TKKIAERPYDFNNWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASGSQAAE 330

Query: 446 XXXXXXXXXSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHI 505
                      L +A + R G  FP+F F +  ETE F KMA+++ + + GLP+Y ++HI
Sbjct: 331 MSLDGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNYLVYHI 390

Query: 506 YE 507
            E
Sbjct: 391 EE 392

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  159 bits (402), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 99/348 (28%), Positives = 162/348 (46%), Gaps = 57/348 (16%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           +D+     T     ++E VL+  PL+         ++N++ L+YP ELI++ F+V     
Sbjct: 100 FDLNKLHSTKDASINKEKVLILTPLQKFHQE---YWENILQLSYPRELIELGFIVPRTQT 156

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D  L+SL                          +K VE                     
Sbjct: 157 GDLALQSL--------------------------EKAVEKTQT----------------- 173

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNA 342
                   +  ++ F  + I ++D       +  +RH + VQ  RR  M  ARN L+ + 
Sbjct: 174 --------DKKNQRFAKVTILRQDSESFNKLAEKERHALNVQKERRSSMALARNELLFST 225

Query: 343 LKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPL---PEFMNSEQPYDLNSW 399
           + P+ SWV W DAD+   P T+I+D+ + D  V+  NV++      +  ++ +PYD N+W
Sbjct: 226 IGPHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQRYYDDEKKASATRPYDFNNW 285

Query: 400 MESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILAR 459
            ES   ++LA K+++DE+IVEGY+E  T+R  +AY  +                   L +
Sbjct: 286 QESEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILDGVGGGCTLVK 345

Query: 460 ARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
           A + R G  FP+F F +  ETE F KMAK++G+ + GLP+Y ++HI E
Sbjct: 346 AEVHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  158 bits (399), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 105/356 (29%), Positives = 164/356 (46%), Gaps = 73/356 (20%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     TS+ + ++E VL+  P++         + NL++LTYP  LI++ F++   + 
Sbjct: 99  YDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTYPRALIELGFIIPRTAS 155

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D  L                                                   Q+++
Sbjct: 156 GDAAL---------------------------------------------------QKLE 164

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSF-----SDRHDVKVQGIRRKLMGRARNW 337
            A +       DK F  I I ++       QSF      DRH ++VQ  RR  M  ARN 
Sbjct: 165 SAVREVQTGKQDKRFAKITILRQ-----ASQSFDRLGEKDRHALEVQKERRAAMALARNE 219

Query: 338 LMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQ----- 392
           L+ + + P+ SW+ W DAD+   P TVI+DL S +  V+  NV++   +F + +Q     
Sbjct: 220 LLFSTIGPHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQ---KFYDKDQKKESI 276

Query: 393 -PYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXX 451
            PYD N+W ES   + LA++L ++E+IVEGY+E  T+R  +A+  +              
Sbjct: 277 RPYDFNNWAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGV 336

Query: 452 XXXSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
                L +A + R G  F  F F +  ETEAF KMAK++G+ V GLP+Y ++HI E
Sbjct: 337 GGGCTLVKAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  157 bits (396), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 103/351 (29%), Positives = 163/351 (46%), Gaps = 63/351 (17%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+   + T +   ++E VL+  P+++        + NL+ LTYP ELI++ F+V     
Sbjct: 98  YDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YWDNLLQLTYPRELIELGFIVPRTGS 154

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            +  LE L    + +Q G      ++ D+  ++T  ++  A  S                
Sbjct: 155 GNVALEQLEAAVKKVQTG------KKEDRFGKIT--ILRQASQS---------------- 190

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNA 342
                     +DK                     +RH ++VQ  RR  M  ARN L+ + 
Sbjct: 191 ----------FDKLLEK-----------------ERHALEVQKERRAAMALARNELLFST 223

Query: 343 LKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQ------PYDL 396
           + PY SW+ W DAD+   P +VIED+ + +  V+  NV++    + + EQ      PYD 
Sbjct: 224 IGPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ---RYYDQEQKKESIRPYDY 280

Query: 397 NSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSI 456
           N+W ES   + LA ++  DE++VEGY E  T+R  +A+  E                   
Sbjct: 281 NNWAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDSAPATVEMELDGVGGGCT 340

Query: 457 LARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
           L +A + R G  FP F F +  ETE F KMAK++G+ V GLP+Y ++HI E
Sbjct: 341 LVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIDE 391

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  156 bits (394), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 107/356 (30%), Positives = 158/356 (44%), Gaps = 73/356 (20%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     T     ++E VL+  P++   +     + N++++TYP ELI++ F+      
Sbjct: 100 YDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YWDNILHMTYPRELIELGFIAPRTPT 156

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D  L+                      KL+    K+     +                 
Sbjct: 157 GDAALK----------------------KLEAAIKKIQSGKKNER--------------- 179

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSF-----SDRHDVKVQGIRRKLMGRARNW 337
                         F  I I +++      QSF      DRH + VQ  RR  M  ARN 
Sbjct: 180 --------------FAKIIILRQE-----SQSFDMLAEKDRHALAVQKQRRSAMALARNE 220

Query: 338 LMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSE------ 391
           L+ + L P+ SWV W DAD+   P TVI+DL + D  V+  NV++    F N E      
Sbjct: 221 LLFSTLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDELSKADI 277

Query: 392 QPYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXX 451
           +PYD N+W ES   ++LA  L  DE+IVEGYAE  T+R  +A+  ++             
Sbjct: 278 RPYDFNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMALDGV 337

Query: 452 XXXSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
                L +A + R G  FP F F +  ETE F KMAK++G+ V GLP+Y ++HI E
Sbjct: 338 GGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  154 bits (390), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 105/355 (29%), Positives = 160/355 (45%), Gaps = 71/355 (20%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     TS  +S +EHVL+  P++   +     ++NL+ L+YP ELI++ F++     
Sbjct: 99  YDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YWENLLKLSYPRELIELGFIIPRSDA 155

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D  L                                                   ++++
Sbjct: 156 GDAAL---------------------------------------------------KKLE 164

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSF-----SDRHDVKVQGIRRKLMGRARNW 337
            A K+   +  +  F  I I +++      QSF      +RH + VQ  RR  M  ARN 
Sbjct: 165 TAVKNVQSDKKNNRFSKITILRQE-----SQSFDKLEEKERHSLAVQKERRAAMALARNE 219

Query: 338 LMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQ----- 392
           L+ + L P+ SWV W D+D+   P TVIE +   D  V+  NV++    F N +Q     
Sbjct: 220 LLFSTLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQRF--FDNDKQQDSIR 277

Query: 393 PYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXX 452
           PYD N+W ES   + LA K+ +DE+IVEGYAE  T+R  +A+                  
Sbjct: 278 PYDFNNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGEEMALDGVG 337

Query: 453 XXSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
               L +A + R G  FP F F +  ETE F KMAK++ + V GLP++ ++HI E
Sbjct: 338 GGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYHIEE 392

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  154 bits (389), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 105/349 (30%), Positives = 161/349 (46%), Gaps = 59/349 (16%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     TS    ++E VL+  P++   D     ++NL+ LTYP ELI++ F++     
Sbjct: 97  YDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTYPRELIELGFILPRSDS 153

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D  L++L    + +Q                 TDK                    QR  
Sbjct: 154 GDAALKALEAAVKKVQ-----------------TDK------------------KNQR-- 176

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFS-DRHDVKVQGIRRKLMGRARNWLMTN 341
                         F  I I ++D  Q  GQ    +RH + VQ  RR  M  ARN L+ +
Sbjct: 177 --------------FSKITILRQD-SQGFGQLMEKERHALHVQKERRAAMALARNELLFS 221

Query: 342 ALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQ---PYDLNS 398
            + P+ SWV W DAD+   P TVI+D+ + D  V+  NV++   +    E+    YD N+
Sbjct: 222 TIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQRYFDEEKKEKSIRAYDFNN 281

Query: 399 WMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILA 458
           W ES   + +A  +++DE+IVEGY+E  T+R  +A+  +                   L 
Sbjct: 282 WQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVNSEMMLDGVGGGCTLV 341

Query: 459 RARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
           +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++H+ E
Sbjct: 342 KADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHMEE 390

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  153 bits (386), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 102/351 (29%), Positives = 160/351 (45%), Gaps = 63/351 (17%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     TS    ++E +L+  P++         ++NL+ LTYP ELI++ F+      
Sbjct: 97  YDLNKLHSTSDAAINKEKILILTPIQKFHQE---YWENLLQLTYPRELIELGFIAPRTPT 153

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D  L +L                      +   DKV  +  +             QR  
Sbjct: 154 GDQALAAL----------------------EAAVDKVQSDKKN-------------QR-- 176

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNA 342
                         F  + I ++D       +  +RH ++VQ  RR  M  ARN L+ + 
Sbjct: 177 --------------FSKVTILRQDSVGFNKLTEKERHALEVQKERRASMALARNELLFST 222

Query: 343 LKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQ------PYDL 396
           + P+ SWV W DAD+   P ++I+D+ + D  V+  NV++    + + E+      PYD 
Sbjct: 223 IGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQ---RYYDEEKKQKAIRPYDF 279

Query: 397 NSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSI 456
           N+W ES   ++LA K+ +DE+IVEGYAE  T+R  +AY  +                   
Sbjct: 280 NNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDNSVAEEMRLDGVGGGCT 339

Query: 457 LARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
           L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 340 LVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 390

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  152 bits (383), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 105/355 (29%), Positives = 163/355 (45%), Gaps = 71/355 (20%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     T++   ++E VL+  P++         ++NL+ LTYP ELI++ F++     
Sbjct: 102 YDLNKLRSTAYAAVNKERVLILTPMQTFHKQ---YWENLLQLTYPRELIELGFIIPRTKT 158

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            ++ L+ L                       E+  K V++                    
Sbjct: 159 GENALKEL-----------------------EIAIKKVQS-------------------- 175

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSF-----SDRHDVKVQGIRRKLMGRARNW 337
                   +  ++ F  I I ++D      QSF      DRH + VQ  RR  M  ARN 
Sbjct: 176 --------DKKNQRFAKITILRQD-----SQSFDQLAEKDRHSILVQKERRAAMALARNE 222

Query: 338 LMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQ----- 392
           L+ + L P+ +WV W DAD+   P TVI+D+ S D  V+  NV++    F N E+     
Sbjct: 223 LLFSTLGPHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQKY--FDNDEKKMAIR 280

Query: 393 PYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXX 452
           PYD N+W ES   +++A  + E+E+IVEGY+E  T+R  +A+                  
Sbjct: 281 PYDFNNWRESDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELDGVG 340

Query: 453 XXSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
               L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 341 GGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  151 bits (382), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 96/353 (27%), Positives = 162/353 (45%), Gaps = 67/353 (18%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+   + T++   ++E VL+  P++   +     + NL+ LTYP EL+++ F++   + 
Sbjct: 158 YDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPRTTS 214

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D+ L                                                   ++++
Sbjct: 215 GDNAL---------------------------------------------------RKLE 223

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSF-----SDRHDVKVQGIRRKLMGRARNW 337
            A K       D+ F  I I ++D      QSF      DRH ++VQ  RR  M  ARN 
Sbjct: 224 AAVKKTQLSKKDQRFLKITILRQD-----SQSFDLLKEKDRHALEVQKKRRSAMALARNE 278

Query: 338 LMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQ---PY 394
           L+ + + PY SWV W DAD+   P T+I+D+ + D  V+  NV++   +    ++   PY
Sbjct: 279 LLFSTIGPYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPY 338

Query: 395 DLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXX 454
           D N+W +S  A+ +A  + +D V+ EGY E  T+R  +A+  ++                
Sbjct: 339 DFNNWADSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGG 398

Query: 455 SILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
             L +A + R G  FP+F F +  ETE F KMA+++ + + GLP+Y ++HI E
Sbjct: 399 CTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  149 bits (377), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 103/353 (29%), Positives = 161/353 (45%), Gaps = 67/353 (18%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     T    +++EHVL+  P++         + NL+ LTYP ELI++ F+    + 
Sbjct: 99  YDLNKLHSTPDAAANKEHVLILTPMQTFHQQY---WDNLLQLTYPRELIELGFITPRTAT 155

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D  L+                      KL+    KV                   Q  K
Sbjct: 156 GDLALK----------------------KLENAVKKV-------------------QADK 174

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSF-----SDRHDVKVQGIRRKLMGRARNW 337
           +A          + F  I I +++      QSF      +RH + VQ  RR  M  ARN 
Sbjct: 175 KA----------QRFSKITIMRQN-----SQSFDKLMEKERHALDVQKERRAAMALARNE 219

Query: 338 LMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPL---PEFMNSEQPY 394
           L+ + + P+ SWV W DAD+   P T+I+D+   +  V+  N+++      +  +S +PY
Sbjct: 220 LLFSTIGPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQRFYDQEKKQSSIRPY 279

Query: 395 DLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXX 454
           D N+W ES   +++A ++ +DE+IVEGYAE  T+R  +A+                    
Sbjct: 280 DFNNWQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLDGVGGG 339

Query: 455 SILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
             L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 340 CTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  148 bits (374), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 99/348 (28%), Positives = 157/348 (45%), Gaps = 57/348 (16%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     T+    ++EHVL+  P++         + NL+ LTYP E  ++ F++   S 
Sbjct: 100 YDLNKLHSTAEAALNKEHVLILTPMQTFHQE---YWDNLLQLTYPREFTELGFILPRTSS 156

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D  L  L    + +Q                 TDK                    QR  
Sbjct: 157 GDIALSKLEAAVKKVQ-----------------TDK------------------KNQR-- 179

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNA 342
                         F  I I +++          +RH ++VQ  RR  M  ARN L+ ++
Sbjct: 180 --------------FSKITILRQNSAGFDKLMEKERHALEVQKERRSAMASARNELLFSS 225

Query: 343 LKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSE---QPYDLNSW 399
           L P  SWV W DAD+   P  +I+D+ S +  V+  NV++   +    +   +PYD N+W
Sbjct: 226 LGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQKYYDDQAKKVQIRPYDFNNW 285

Query: 400 MESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILAR 459
            ES  A++LAK++ +DE++VEGY +  T+R  +AY  +                   L +
Sbjct: 286 QESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEMNLDGVGGGCTLVK 345

Query: 460 ARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
           A + R G  FP F F +  ETE F KMA+++ + + GLP+Y ++HI E
Sbjct: 346 ADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIEE 393

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  148 bits (373), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 100/356 (28%), Positives = 159/356 (44%), Gaps = 73/356 (20%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     T     ++EH+L+  P++         + NL+ L YP ELI++ F+    + 
Sbjct: 99  YDLNKLHSTPDAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFITPRTAT 155

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D  L+ L    + +Q                 TDK  +                     
Sbjct: 156 GDSALKKLESAIKKVQ-----------------TDKKTQR-------------------- 178

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSF-----SDRHDVKVQGIRRKLMGRARNW 337
                         F  I I +++      QSF      +RH ++VQ  RR  M  ARN 
Sbjct: 179 --------------FSKITILRQN-----SQSFDKLMEKERHALEVQKERRAAMALARNE 219

Query: 338 LMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQ----- 392
           L+ + + P+ SWV W DAD+   P ++I+D+   +  V+  N+++    F + E+     
Sbjct: 220 LLFSTIGPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQ---RFYDQEKKQASI 276

Query: 393 -PYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXX 451
            PYD N+W ES   +D+A ++ +DE+IVEGYAE  T+R  +A+  +              
Sbjct: 277 RPYDFNNWQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALDGV 336

Query: 452 XXXSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
                L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 337 GGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  147 bits (372), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 102/352 (28%), Positives = 162/352 (46%), Gaps = 66/352 (18%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YDM   + TS  ++++E VL+  P++   D     ++NL++LTYP +L  + F++     
Sbjct: 98  YDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLGFIIPRTPT 154

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D                        M +L++   KV                   Q  K
Sbjct: 155 GD----------------------VAMKRLEDAVKKV-------------------QSGK 173

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFS-----DRHDVKVQGIRRKLMGRARNW 337
           E          ++ F  I I ++D      QSF+     +RH   VQ  RR  M  ARN 
Sbjct: 174 E----------NQRFLKITILRQD-----SQSFNKLDEKERHAFNVQKERRAAMALARNE 218

Query: 338 LMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSE--QPYD 395
           L+ + + P  SW+ W DAD+   P TVI+D+ + D  ++  NV++   +  N E  +PYD
Sbjct: 219 LVFSTIGPSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYD 278

Query: 396 LNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXS 455
            N+W ES+  +++A  + +DE+IVE Y E  T+R  +A L +                  
Sbjct: 279 FNNWQESQTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGC 338

Query: 456 ILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
            L +A++ R G  FP F F +  ETE F  MAK++ + V GLP+Y ++H  E
Sbjct: 339 TLVKAQVHRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  147 bits (370), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/346 (29%), Positives = 154/346 (44%), Gaps = 60/346 (17%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     T+   ++ E VL+  P++         + NL+ LTYP + I + FL+   S 
Sbjct: 97  YDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFLLPRTSS 153

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            +  L  L +  R +Q  T P                                       
Sbjct: 154 GNTALRKLEKAVRKVQ--TGPK-------------------------------------- 173

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNA 342
                      D+ F  I I ++DF      S S RH   VQ  RR  M  ARN L+ + 
Sbjct: 174 -----------DQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLFST 222

Query: 343 LKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSE---QPYDLNSW 399
           + PY SWV W D+D+   P T+IED+ S +  ++  NV++   E  N E   + YDLN+W
Sbjct: 223 IGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQRYVE--NGEPAIRAYDLNNW 280

Query: 400 MESREAIDLAKKLHEDEVIVEGYA-EYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILA 458
            ES   + +A +L ED++IVEGY  E+ T+R  +A++                     L 
Sbjct: 281 AESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCTLV 340

Query: 459 RARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWH 504
           +A + R G  FP F F +  ETE F KMAK++ + + GLP+Y ++H
Sbjct: 341 KAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  147 bits (370), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 101/356 (28%), Positives = 160/356 (44%), Gaps = 73/356 (20%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     TS    ++EHVL+  P++         + NL+ L+YP ELI++ F+    + 
Sbjct: 99  YDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YWDNLLQLSYPRELIELGFITPRTAT 155

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D  L++L    + +Q                 TDK  +                     
Sbjct: 156 GDLALKNLENAIKKVQ-----------------TDKKTQR-------------------- 178

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSF-----SDRHDVKVQGIRRKLMGRARNW 337
                         F  I I +++      QSF      +RH + VQ  RR  M  ARN 
Sbjct: 179 --------------FSKITILRQN-----SQSFDKLMEKERHALDVQKERRAAMALARNE 219

Query: 338 LMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQ----- 392
           L+ + + P+ SW+ W DAD+   P ++I+D+   D  V+  N+++    F + E+     
Sbjct: 220 LLFSTIGPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ---RFYDQEKKQPSI 276

Query: 393 -PYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXX 451
            PYD N+W ES   +++A ++ +DE+IVEGYAE  T+R  +A+                 
Sbjct: 277 RPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALDGV 336

Query: 452 XXXSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
                L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 337 GGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  147 bits (370), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/351 (29%), Positives = 157/351 (44%), Gaps = 57/351 (16%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     T+    ++E VL+  P++   +     + NL+ LTYP ELI++ F+V     
Sbjct: 100 YDLNKLHSTAKAALNKEQVLILTPMQTFHEQ---YWDNLLQLTYPRELIELGFIVPRTQS 156

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D  L                       KL+E   KV  +  +             QR  
Sbjct: 157 GDVALA----------------------KLEEAVKKVQTDKKN-------------QR-- 179

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNA 342
                         F  + I ++D          +RH + VQ  RR  M  ARN L+ + 
Sbjct: 180 --------------FVKVTILRQDSKSFDKLQEKERHALAVQKERRAAMALARNELLFST 225

Query: 343 LKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSE---QPYDLNSW 399
           + P+ SWV W DAD+   P  +I+D+ + +  V+  NV++   +    E   + YD N+W
Sbjct: 226 IGPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQRYYDEEKKESSIRAYDFNNW 285

Query: 400 MESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILAR 459
            ES   ++LA ++ EDE+IVEGY+E  T+R  +AY  +                   L +
Sbjct: 286 AESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGAEMALDGVGGGCTLVQ 345

Query: 460 ARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSD 510
           A + R G  FP F F +  ETE F KMAK++   V GLP+Y ++HI E +D
Sbjct: 346 ADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYHIEEWND 396

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  147 bits (370), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 99/356 (27%), Positives = 159/356 (44%), Gaps = 73/356 (20%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     TS    ++EH+L+  P++         + NL+ L YP ELI++ F+    + 
Sbjct: 99  YDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFITPRTAT 155

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D  L+ L    + +Q                 TDK  +                     
Sbjct: 156 GDLALKKLENAIKKVQ-----------------TDKKTQR-------------------- 178

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSF-----SDRHDVKVQGIRRKLMGRARNW 337
                         F  I I +++      QSF      +RH + VQ  RR  M  ARN 
Sbjct: 179 --------------FSKITILRQN-----SQSFDKLMEKERHALDVQKERRAAMALARNE 219

Query: 338 LMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQ----- 392
           L+ + + P+ SWV W DAD+   P ++I+D+   +  ++  N+++    F + E+     
Sbjct: 220 LLFSTIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ---RFYDEEKKQPSI 276

Query: 393 -PYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXX 451
            PYD N+W ES   +++A ++ +DE+IVEGYAE  T+R  +A+  +              
Sbjct: 277 RPYDFNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGV 336

Query: 452 XXXSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYE 507
                L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E
Sbjct: 337 GGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  145 bits (365), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 104/360 (28%), Positives = 162/360 (45%), Gaps = 57/360 (15%)

Query: 154 KLLSSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDV 213
           ++ +  V  YD+     TS    ++E VL+  P++         + NL+ LTYP +L+++
Sbjct: 88  RIPNGHVAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQA---YWDNLLQLTYPRDLLEL 144

Query: 214 AFLVSDCSENDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXX 273
            F++   +  D  L+ L    +  Q           DK +    KV     DS       
Sbjct: 145 GFIIPKSASGDAALKQLEAAVKRAQT----------DKKNNRFGKVTILRQDS------- 187

Query: 274 XXXXXQRVKEAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGR 333
                                K F  +Q               +RH + VQ  RR  M  
Sbjct: 188 ---------------------KGFDKLQE-------------KERHALAVQKERRSAMAL 213

Query: 334 ARNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVW-RPLPEFMN--S 390
           ARN L+ + + P+ SWV W DAD+     ++I+D+ + +  V+  NV+ R   E  N  S
Sbjct: 214 ARNELLFSTIGPHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQRYFDEAENKPS 273

Query: 391 EQPYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXX 450
            +PYD N+W +S+ A +L  K+ +DE+IVEGYAE  T+R  +A+                
Sbjct: 274 IRPYDFNNWADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDG 333

Query: 451 XXXXSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSD 510
                 L +A + R G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E +D
Sbjct: 334 VGGGCTLVKAEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  134 bits (336), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 91/347 (26%), Positives = 158/347 (45%), Gaps = 60/347 (17%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     +++   ++EHVL+  PL+  E      + NL+ L+YP + I++ F++    +
Sbjct: 106 YDLNKLQSSANAAENKEHVLILTPLKSFEQG---YWDNLLKLSYPRDAIELGFIIPRTKK 162

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            DH+L+                      KL+    KV                   Q  K
Sbjct: 163 GDHSLK----------------------KLESAIKKV-------------------QTAK 181

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFG--QTVGQSFSDRHDVKVQGIRRKLMGRARNWLMT 340
           +  K          F  I I +++    +TV +   +  +++ +   R  M  ARN L+ 
Sbjct: 182 QGDK----------FSKITILRQNSKGFETVPEK-KEVSEIEYEKQIRAEMALARNELLA 230

Query: 341 NALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSE---QPYDLN 397
           + L P  +W+ W D+D+   P ++I+D+   D  V+  NV+    +  + E   +PYD  
Sbjct: 231 STLGPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESGELSIRPYDFR 290

Query: 398 SWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSIL 457
           +W+ES EA+ LA  + EDE+IVEG A   T R  + +  ++                 +L
Sbjct: 291 NWIESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEISLDGVGASCLL 350

Query: 458 ARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWH 504
            ++ + R G  FP F F +  E+E F KMAK++ + V GLP+Y ++H
Sbjct: 351 VKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  128 bits (321), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 87/343 (25%), Positives = 154/343 (44%), Gaps = 49/343 (14%)

Query: 163 YDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSE 222
           YD+     +++ + ++EHVL+  PL+  ++     ++NL+NL+YP +LI++ F+V +  +
Sbjct: 105 YDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIELGFMVPNTKK 161

Query: 223 NDHTLESLLQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSXXXXXXXXXXXXQRVK 282
            D  L+ L    + +Q                          D              R K
Sbjct: 162 GDQILKQLENAVKNVQ------------------------GIDKKLGSNKFAKITILRQK 197

Query: 283 EAFKSPFHENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNA 342
           ++    F++  DK                     + +D++++  +R  M  ARN L+++ 
Sbjct: 198 DSGFHKFNDRKDK--------------------KEMNDIELEKEKRAEMALARNELLSST 237

Query: 343 LKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSE--QPYDLNSWM 400
           L    +W+ W D++V   P T+I+D+   D  V+  NV+       +    +PYD  +W+
Sbjct: 238 LSHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIRPYDFRNWI 297

Query: 401 ESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXXXXXXXXXXXXSILARA 460
           ES  A+ LA ++ EDE+IVEG A   T R  +    E                   L ++
Sbjct: 298 ESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAACTLVKS 357

Query: 461 RLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTLW 503
            + R G  FP F F +  E+E F KMAK++ + V GLP+Y ++
Sbjct: 358 EVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 81/178 (45%), Gaps = 9/178 (5%)

Query: 328 RKLMGRARNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEF 387
           RK +   +N L+ + L PY SWV W D+ +   P T+++DL +    ++  ++      F
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHI------F 236

Query: 388 MNSEQPYD---LNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLAYLREKXXXXXX 444
            NS+   D   LN+W+ S     LA  +    V++EG +   T R  +    +       
Sbjct: 237 NNSDGSPDSETLNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLT 296

Query: 445 XXXXXXXXXXSILARARLFRAGVHFPAFTFENHAETEAFGKMAKKMGFRVGGLPHYTL 502
                       L +A + R G  FP F F +  ETE F +MA+ +  +  GLP+Y +
Sbjct: 297 EMELDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 157 SSSVDIYDMKDFSGTSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFL 216
           +  +  Y++ + + +       EH+L+ IPL +        F+NL  LTYP +LID+  +
Sbjct: 76  TGGISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTYPKQLIDLGVI 132

Query: 217 VSDCSENDHTLESL 230
           V D       L++L
Sbjct: 133 VPDSKNATGILQAL 146

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 80/207 (38%), Gaps = 23/207 (11%)

Query: 314 SFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDADVELCPGTVIEDLMSKDF 373
           S  DRH   VQ  RRK + + RN+L  N       +    D+D+ + P  ++E  +    
Sbjct: 365 SREDRHKDSVQRARRKTIAKVRNFLY-NRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGK 423

Query: 374 DVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDEVIVEGYAEYPTWRVHLA 433
           ++IVP + R     + S++ YD N+W+  R   +   K +  E  V       T +    
Sbjct: 424 ELIVPRILR-----VGSDREYDKNTWIGERTKPEDTSKQNNYESYVPRPVNGKT-KFLQD 477

Query: 434 YLREKXXXXXXXXXXXXXXXXSILARA------RLFRAGVHFPAFTF----------ENH 477
            + EK                  +  A      ++F  G+ FP F             + 
Sbjct: 478 CVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEGYDG 537

Query: 478 AETEAFGKMAKKMGFRVGGLPHYTLWH 504
            ETE     AK +G++  G+P+    H
Sbjct: 538 VETEGLCYQAKTLGYKCYGVPNVICRH 564

>Skud_8.78 Chr8 (132206..137989) [5784 bp, 1927 aa] {ON} YHR023W
            (REAL)
          Length = 1927

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 11/67 (16%)

Query: 113  NLDTISKYDKGVRQYLLDTYKTDDV--------SQLSVQAKEAYDAELPKLLSSSVDIYD 164
            N D+ISKY++ +R Y L+ YK  ++        SQL++  +++   E+  LLS  +D   
Sbjct: 1404 NRDSISKYEEEIRYYKLENYKFQEILNESNGKLSQLALDLRQSKSKEV--LLSEQLDRL- 1460

Query: 165  MKDFSGT 171
             KDF  T
Sbjct: 1461 QKDFEST 1467

>TBLA0G00120 Chr7 (6738..11147) [4410 bp, 1469 aa] {ON} Anc_2.2
           YDL240W
          Length = 1469

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 144 AKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVSSREHV-LLCIPLRDAEDVLPLMFKNLM 202
            +  ++ +L K+L S   I D +   G  +  +  + V LL I L  ++ V+ L  KN +
Sbjct: 889 GEATFNNKLKKVLCSKCSINDPESLPGFKYVSNLGQLVYLLKIALVKSKTVMELQMKNRV 948

Query: 203 NLTYPHEL 210
           N TYP+++
Sbjct: 949 NSTYPNQM 956

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,187,876
Number of extensions: 2341654
Number of successful extensions: 6726
Number of sequences better than 10.0: 76
Number of HSP's gapped: 6722
Number of HSP's successfully gapped: 120
Length of query: 525
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 411
Effective length of database: 40,409,475
Effective search space: 16608294225
Effective search space used: 16608294225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)