Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C045207.195ON1351357022e-96
Kpol_1063.107.195ON1221113835e-48
TDEL0H025207.195ON1191103298e-40
ZYRO0D15818g7.195ON1181103235e-39
SAKL0F07480g7.195ON1131152541e-28
Ecym_43817.195ON1201112393e-26
Kwal_55.20373singletonOFF1151132332e-25
Kwal_YGOB_ADL119W7.195ON1151132332e-25
KLTH0E04576g7.195ON1151132253e-24
CAGL0D05148g7.195ON1081072201e-23
NCAS0E018207.195ON1141142168e-23
KAFR0G029907.195ON1101111672e-15
KNAG0L012307.195ON1281111664e-15
KLLA0D16192g7.195ON1211061639e-15
ADL119W7.195ON1851141652e-14
TBLA0J015107.195ON1071141471e-12
NDAI0G019907.195ON101911341e-10
Scer_YGOB_ADL119W (ADL119W)7.195ON961021141e-07
Skud_6.1257.195ON2251001182e-07
CAGL0B04147g3.430ON56639720.25
Suva_6.1147.195ON268115670.99
SAKL0D06512g1.337ON196427661.9
KLTH0B09372g5.25ON1002102626.7
TBLA0D003202.125ON1671101618.4
NCAS0A099303.63ON53948609.5
NDAI0K021902.490ON117862619.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C04520
         (135 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.19...   275   2e-96
Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON...   152   5e-48
TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON...   131   8e-40
ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON} conse...   129   5e-39
SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserv...   102   1e-28
Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON} ...    97   3e-26
Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {O...    94   2e-25
Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa...    94   2e-25
KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {O...    91   3e-24
CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {O...    89   1e-23
NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON...    88   8e-23
KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.19...    69   2e-15
KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON} Anc_7.1...    69   4e-15
KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON} conse...    67   9e-15
ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No...    68   2e-14
TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {O...    61   1e-12
NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON...    56   1e-10
Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON} ANN...    49   1e-07
Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)         50   2e-07
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    32   0.25 
Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)         30   0.99 
SAKL0D06512g Chr4 (531948..537842) [5895 bp, 1964 aa] {ON} simil...    30   1.9  
KLTH0B09372g Chr2 complement(767865..770873) [3009 bp, 1002 aa] ...    28   6.7  
TBLA0D00320 Chr4 complement(73022..78037) [5016 bp, 1671 aa] {ON...    28   8.4  
NCAS0A09930 Chr1 (1984926..1986545) [1620 bp, 539 aa] {ON} Anc_3...    28   9.5  
NDAI0K02190 Chr11 complement(495649..499185) [3537 bp, 1178 aa] ...    28   9.7  

>TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 135

 Score =  275 bits (702), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 135/135 (100%), Positives = 135/135 (100%)

Query: 1   MAESKLASNIDSGNGSNVPQETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKI 60
           MAESKLASNIDSGNGSNVPQETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKI
Sbjct: 1   MAESKLASNIDSGNGSNVPQETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKI 60

Query: 61  LQIQKNEPATVTKYIVWKVILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYI 120
           LQIQKNEPATVTKYIVWKVILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYI
Sbjct: 61  LQIQKNEPATVTKYIVWKVILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYI 120

Query: 121 YKLVLGKDLVKPKDH 135
           YKLVLGKDLVKPKDH
Sbjct: 121 YKLVLGKDLVKPKDH 135

>Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON}
           complement(28076..28444) [369 nt, 123 aa]
          Length = 122

 Score =  152 bits (383), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 88/111 (79%)

Query: 25  VPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWKVILRDM 84
           VPDVR E++FN A+ KEAEKQR   LKK+GL   +I +I++NE   VT YIVWKVI+RDM
Sbjct: 12  VPDVRFEETFNRAINKEAEKQREYSLKKKGLTTDEISKIKENEAPEVTTYIVWKVIVRDM 71

Query: 85  ILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLVKPKDH 135
           ++MPFIQG +F+GLL+ +KPWLR VVGNGRRFG++IY  VLGK+L K K  
Sbjct: 72  LIMPFIQGIMFSGLLIILKPWLRSVVGNGRRFGTFIYNTVLGKNLTKTKKQ 122

>TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 119

 Score =  131 bits (329), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 60/110 (54%), Positives = 84/110 (76%), Gaps = 1/110 (0%)

Query: 25  VPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKIL-QIQKNEPATVTKYIVWKVILRD 83
           VPD R EQ+F  AL +EAEK R A+ +K G+ D  ++ ++QK +P +++K +V KV+LRD
Sbjct: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66

Query: 84  MILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLVKPK 133
           +I MP +QG L+TG+L+A+KPWL+  V +GRR GS IY+LVLG DLVKPK
Sbjct: 67  VIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPK 116

>ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON}
           conserved hypothetical protein
          Length = 118

 Score =  129 bits (323), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 57/110 (51%), Positives = 81/110 (73%), Gaps = 1/110 (0%)

Query: 25  VPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKIL-QIQKNEPATVTKYIVWKVILRD 83
           +PD R E +F  AL +EAEKQR  + KK G++D  ++ Q+QKN+P  +  Y+V KV+ RD
Sbjct: 7   IPDTRFESTFKRALNREAEKQRTLQWKKMGVEDPLVINQLQKNQPVKINSYVVCKVVARD 66

Query: 84  MILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLVKPK 133
           +I MP +QG L+T LL+ +KPWLR V+ NGR+FG++IY+ VLG DL+K K
Sbjct: 67  VIFMPLVQGLLWTSLLITMKPWLRSVIQNGRKFGTFIYRTVLGTDLIKKK 116

>SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserved
           hypothetical protein
          Length = 113

 Score =  102 bits (254), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 78/115 (67%), Gaps = 10/115 (8%)

Query: 17  NVPQETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIV 76
             P +T+ VPD R EQ+F NAL+KEA++ + A+L    LDD+          A VT  +V
Sbjct: 6   TTPIQTIVVPDTRFEQTFKNALKKEAKRMKAARLGITTLDDN----------APVTPMVV 55

Query: 77  WKVILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLVK 131
            KV++RD++LMP +QG L+T  L+A+KPWLR  V  GRRFG  +Y+LVLGKDLV+
Sbjct: 56  AKVVVRDVLLMPLVQGVLWTSFLIAIKPWLRNAVWQGRRFGMSVYRLVLGKDLVR 110

>Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON}
           similar to Ashbya gossypii ADL119W
          Length = 120

 Score = 96.7 bits (239), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 74/111 (66%), Gaps = 2/111 (1%)

Query: 23  LKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWKVILR 82
           L +PD+R EQ+F  AL+KEA KQ   K++K       ++     EP T+T ++V KVI+R
Sbjct: 6   LAIPDIRFEQTFMVALKKEALKQHQYKIRKLKGSQDIVVSEDFGEP-TITTFVVAKVIVR 64

Query: 83  DMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLVKPK 133
           D++L+P + G L+TG L+ +KPWL+    NGRR G+ IY +++G++ V PK
Sbjct: 65  DVVLLPLVHGMLWTGFLIMMKPWLKACTQNGRRLGAGIYNVIVGRN-VYPK 114

>Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {OFF}
           [contig 149] FULL
          Length = 115

 Score = 94.4 bits (233), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 75/113 (66%), Gaps = 10/113 (8%)

Query: 18  VPQETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVW 77
            PQ+ + +PD+R EQ+F NAL++EA K +  K K     DS+         + ++  I+ 
Sbjct: 9   TPQK-VSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSE---------SPLSASIIC 58

Query: 78  KVILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLV 130
           KV+LRD++L+PF+QGAL+TG+L+A++PWL  V   G + G  IY LVLGKDLV
Sbjct: 59  KVVLRDVLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLV 111

>Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 115

 Score = 94.4 bits (233), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 75/113 (66%), Gaps = 10/113 (8%)

Query: 18  VPQETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVW 77
            PQ+ + +PD+R EQ+F NAL++EA K +  K K     DS+         + ++  I+ 
Sbjct: 9   TPQK-VSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSE---------SPLSASIIC 58

Query: 78  KVILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLV 130
           KV+LRD++L+PF+QGAL+TG+L+A++PWL  V   G + G  IY LVLGKDLV
Sbjct: 59  KVVLRDVLLLPFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLV 111

>KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {ON}
           conserved hypothetical protein
          Length = 115

 Score = 91.3 bits (225), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 71/113 (62%), Gaps = 9/113 (7%)

Query: 21  ETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWKVI 80
           + + VPD+R EQ+F  AL++EA K + A  +     D+          AT++  ++ KV+
Sbjct: 11  QKVAVPDLRFEQTFQRALRREASKNQKATSQGHSTTDAD---------ATISASVICKVV 61

Query: 81  LRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLVKPK 133
           LRD++LMPF+QG L+T  L+A+KPWL  V   G+  G  IY++VLGK LV+ +
Sbjct: 62  LRDVLLMPFLQGILWTSALIALKPWLHMVRIRGQLVGHRIYEMVLGKGLVRKR 114

>CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {ON}
           some similarities with KLLA0D16192g Kluyveromyces lactis
           and DEHA0C08349g Debaryomyces hansenii
          Length = 108

 Score = 89.4 bits (220), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 67/107 (62%), Gaps = 11/107 (10%)

Query: 23  LKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWKVILR 82
           +K+PD R EQ+F  A+ +E  KQ    L  +  DD      +K+ P+    Y++ KV++R
Sbjct: 5   IKIPDTRFEQTFRRAIDREVAKQNA--LSGKSTDD------KKSGPSA---YVICKVVVR 53

Query: 83  DMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDL 129
           D++LMPFIQ  L+TG L+ +KPWLR VVG GRR G Y+ + + G  L
Sbjct: 54  DVLLMPFIQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRL 100

>NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON}
           Anc_7.195
          Length = 114

 Score = 87.8 bits (216), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 70/114 (61%), Gaps = 6/114 (5%)

Query: 20  QETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWKV 79
           +E L +PD+R+EQ+F  A+ KE  K+ + K  K     S I ++ + E A +      KV
Sbjct: 3   KEVLNIPDLRVEQTFKRAVAKET-KEYIIK-NKATFPRSTITELTRVEKAVICS----KV 56

Query: 80  ILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLVKPK 133
           ILRD+++MPF+Q   +TG L+ +KPWLR  V  GR+ GS    L+ G++LVK K
Sbjct: 57  ILRDILVMPFLQSVAWTGFLIVLKPWLRTTVTFGRKMGSSAMDLITGRNLVKSK 110

>KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 110

 Score = 68.9 bits (167), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 59/111 (53%), Gaps = 14/111 (12%)

Query: 23  LKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWKVILR 82
           L +PD R    F  A+QKE  KQ      KE   D+K   I KN        I+ KVI R
Sbjct: 12  LAIPDTRFGYVFRKAVQKELRKQ-----VKETDSDNK--HINKN-------LIICKVIAR 57

Query: 83  DMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLVKPK 133
           D+ILMPFIQ  L+TG L++ KP LRG +   +R G  I   +L  ++ K K
Sbjct: 58  DVILMPFIQSILWTGFLISFKPCLRGFIRFCQRLGPMIKGSILEGNIGKSK 108

>KNAG0L01230 Chr12 (218769..219155) [387 bp, 128 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 128

 Score = 68.6 bits (166), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 61/111 (54%), Gaps = 21/111 (18%)

Query: 23  LKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWKVILR 82
           +K+P++R    FNNAL+ EA +  VA                  EP T   ++V KV+ +
Sbjct: 34  IKIPEMRFNYVFNNALKAEAARHNVA------------------EPTT---WMVCKVVCK 72

Query: 83  DMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLVKPK 133
           D++LMPF+Q  L+T LL+++K  L+  +   +R  S ++  V G ++ KPK
Sbjct: 73  DVLLMPFLQSFLWTALLISMKTPLKNALNYTKRMCSALFTNVSGANMYKPK 123

>KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON}
           conserved hypothetical protein
          Length = 121

 Score = 67.4 bits (163), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 59/106 (55%), Gaps = 9/106 (8%)

Query: 25  VPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWKVILRDM 84
           +PD+R EQ+F  +L+KEA KQ   KL     D S +      +P  +T YIV KV+ RD+
Sbjct: 18  LPDLRFEQTFKQSLRKEALKQN--KLTLSVADGSVV------DPP-ITPYIVAKVVARDI 68

Query: 85  ILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLV 130
           ++ PF+QG   +   +  KPWL+     GR  G  I + + GK+ +
Sbjct: 69  LISPFLQGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFGKNAI 114

>ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No
           homolog in Saccharomyces cerevisiae
          Length = 185

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 71/114 (62%), Gaps = 9/114 (7%)

Query: 20  QETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWKV 79
           ++ + +PDVR EQ+F  AL KE+ +QR  + +KEG       +   +  A ++  +V KV
Sbjct: 77  RKAITIPDVRFEQTFRAALAKESARQRQLRAQKEG-------EAAADGEAGISALVVAKV 129

Query: 80  ILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLVKPK 133
           ++RD++LMP +QGAL+TGLL+ +KP L   +  GRR     Y+ ++G   V+P+
Sbjct: 130 VVRDVLLMPLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVGD--VRPR 181

>TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 107

 Score = 61.2 bits (147), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 58/114 (50%), Gaps = 14/114 (12%)

Query: 19  PQETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVW- 77
           P+  + +PD R E +F   L KE        L K  ++ + I++ ++     V K +   
Sbjct: 6   PKLVIPIPDTRFESTFRRKLDKE--------LNKNNVNSNSIIKDER-----VRKLLCLG 52

Query: 78  KVILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLVK 131
           KVI RD+I MPF+QG    G  + +KPWL  ++ NG+  G    +L  G+  V+
Sbjct: 53  KVICRDVIFMPFVQGMFMCGAFILIKPWLLKLLRNGKNIGRNFVELFGGQRRVR 106

>NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON}
           Anc_7.195
          Length = 101

 Score = 56.2 bits (134), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 45/91 (49%), Gaps = 26/91 (28%)

Query: 21  ETLKVPDVRLEQSFNNALQKE-------AEKQRVAKLKKEGLDDSKILQIQKNEPATVTK 73
           +T+ +PD R +Q F NAL++E         KQ    L  E L                  
Sbjct: 2   KTIVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESL------------------ 43

Query: 74  YIVWKVILRDMILMPFIQGALFTGLLMAVKP 104
            +++KVILRD+IL+PFIQ  L+T  L+  KP
Sbjct: 44  -VIFKVILRDVILLPFIQSVLWTEFLIVCKP 73

>Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 96

 Score = 48.5 bits (114), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 46/102 (45%), Gaps = 21/102 (20%)

Query: 19  PQETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWK 78
           P + L +PD+R E+ F  AL +E         +K G                    ++ K
Sbjct: 9   PNKHLNIPDLRFEKVFKKALHRELAPSSSLS-RKAG--------------------VITK 47

Query: 79  VILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYI 120
           V++RD++LMP +Q  + +  LM VK WL  +   GR  G  I
Sbjct: 48  VVVRDVLLMPLLQSFVLSLALMGVKEWLSYIRLKGRTLGDRI 89

>Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)
          Length = 225

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 21/100 (21%)

Query: 18  VPQETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVW 77
            P   L +PD+R E+ F  AL +E                   L    + P+     ++ 
Sbjct: 137 TPNRHLNIPDLRFEKVFKKALHRE-------------------LAPSSSVPSKWA--VIT 175

Query: 78  KVILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFG 117
           KV++RD++LMP +Q  + + +LM VK WLR +   GR  G
Sbjct: 176 KVVVRDVLLMPLLQSFVLSLVLMGVKDWLRFIRLEGRTLG 215

>CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P22204 Saccharomyces cerevisiae
           YGR092w DBF2 ser/thrprotein kinase related to DBF20P or
           uniprot|P32328 Saccharomyces cerevisiae YPR111w DBF20
           cell cycle protein kinase related to DBF2P
          Length = 566

 Score = 32.3 bits (72), Expect = 0.25,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 25  VPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQI 63
           +PD +L + +NN LQKE E  R  +LK +  D   I Q+
Sbjct: 139 IPDEQLNEEWNNYLQKEHEVLRKRRLKPKNKDFEMITQV 177

>Suva_6.114 Chr6 (192307..193113) [807 bp, 268 aa] {ON}  (REAL)
          Length = 268

 Score = 30.4 bits (67), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 45/115 (39%), Gaps = 30/115 (26%)

Query: 11  DSGNGSNVPQ-----ETLKVPDVRLEQSFNNALQKE--AEKQRVAKLKKEGLDDSKILQI 63
           + GN  NVP      + L +PD+R  + F  AL ++      R  KL        +    
Sbjct: 168 NCGNTMNVPSAPTPNKQLNIPDLRFGKVFERALYRDLTPSASRSRKLAVVAKVVVR---- 223

Query: 64  QKNEPATVTKYIVWKVILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGS 118
                              D++LMP +Q  + + +L+ VK WLR +   G   G+
Sbjct: 224 -------------------DVLLMPLVQSIVLSVVLIGVKDWLRYIRLKGFTLGA 259

>SAKL0D06512g Chr4 (531948..537842) [5895 bp, 1964 aa] {ON} similar to
            uniprot|P29539 Saccharomyces cerevisiae YBR275C RIF1
            Protein that binds to the Rap1p C-terminus and acts
            synergistically with Rif2p to help control telomere
            length and establish telomeric silencing deletion results
            in telomere elongation
          Length = 1964

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 1    MAESKLASNIDSGNGSNVPQETLKVPD 27
            +AESK+   + SG  SN PQET   PD
Sbjct: 1549 LAESKVHRRLRSGKVSNAPQETANSPD 1575

>KLTH0B09372g Chr2 complement(767865..770873) [3009 bp, 1002 aa]
           {ON} similar to uniprot|P46677 YGR274C Saccharomyces
           cerevisiae TAF1 TFIID subunit (145 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 1002

 Score = 28.5 bits (62), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 43/102 (42%), Gaps = 6/102 (5%)

Query: 3   ESKLASNIDSGNGSNVPQETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQ 62
           E  +  NID  +G N  ++ LK   +  EQ     LQK  E+++  KL KE   D K+ +
Sbjct: 887 EELMNDNIDLVSGGNTEEKQLKQKKLLEEQLA--KLQKSQERRQARKLAKEKTKDGKVTK 944

Query: 63  IQKNEPATVTKYIVWKVILRDMILMPFIQGALFTGLLMAVKP 104
            +       T  +V  +  R     P   G   TG  +A  P
Sbjct: 945 ARNTNRRCATCGMVGHI--RTNKTCPMYNGG--TGAAIANPP 982

>TBLA0D00320 Chr4 complement(73022..78037) [5016 bp, 1671 aa] {ON}
           Anc_2.125 YNL139C
          Length = 1671

 Score = 28.1 bits (61), Expect = 8.4,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 4   SKLASNIDSGNGSNVPQETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQI 63
           + L  + D  + +N   ++ +  D  +E    N L+ E +K +    +K+ L+D+KIL +
Sbjct: 344 AALTDDDDEESANNNSHKSKENNDKSVELERENELKLENDKMQKLNKEKKFLEDTKILFL 403

Query: 64  QK---NEPATVTKYIV--WKVILRDMILMPFIQGALFTGLL 99
           ++   N     +  I+  WK ++    ++P + G +F  +L
Sbjct: 404 ERLLINGCIVPSMTILGRWKSLIYSKDVLPLLLGRVFDTML 444

>NCAS0A09930 Chr1 (1984926..1986545) [1620 bp, 539 aa] {ON} Anc_3.63
           YNL294C
          Length = 539

 Score = 27.7 bits (60), Expect = 9.5,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 8/48 (16%)

Query: 1   MAESKLASNIDSGNGSNVP--------QETLKVPDVRLEQSFNNALQK 40
           +A ++ + N D G+ +N+         Q T KVP+VR++ + ++ L K
Sbjct: 375 LARNEASDNTDEGSNTNLASSISGEHFQGTSKVPEVRIDHTSSSTLSK 422

>NDAI0K02190 Chr11 complement(495649..499185) [3537 bp, 1178 aa]
           {ON} Anc_2.490 YKL092C
          Length = 1178

 Score = 28.1 bits (61), Expect = 9.7,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 30  LEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYI--VWKVILRDMILM 87
           LE+S    LQK  ++ +  +L    L  +   +I      T+T+YI  +W VI +    +
Sbjct: 644 LEKSIGPVLQKIIKENKACELDPSRLSSNNTDKIINENYETLTRYINEIWNVIYKSSKDL 703

Query: 88  PF 89
           P+
Sbjct: 704 PY 705

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,825,544
Number of extensions: 534763
Number of successful extensions: 2278
Number of sequences better than 10.0: 57
Number of HSP's gapped: 2260
Number of HSP's successfully gapped: 57
Length of query: 135
Length of database: 53,481,399
Length adjustment: 97
Effective length of query: 38
Effective length of database: 42,358,797
Effective search space: 1609634286
Effective search space used: 1609634286
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)