Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C043307.126ON2092099661e-134
Kpol_1062.577.126ON2192215515e-71
NDAI0H013107.126ON2611605512e-70
KNAG0G010207.126ON2072235435e-70
CAGL0C03850g7.126ON2092085383e-69
TBLA0A009407.126ON2881495402e-68
Smik_9.1847.126ON2141755323e-68
TDEL0H028807.126ON3541665382e-67
YIL010W (DOT5)7.126ON2151585263e-67
KAFR0K012007.126ON2021485159e-66
SAKL0F05368g7.126ON2311515152e-65
Suva_9.1947.126ON2151515116e-65
Skud_9.1627.126ON2171515116e-65
NCAS0F008107.126ON2311465117e-65
KLLA0D14333g7.126ON2052105011e-63
ZYRO0C05214g7.126ON2701475034e-63
Ecym_83517.126ON2241604952e-62
KLTH0F12562g7.126ON2931484672e-57
ADL018W7.126ON2441504632e-57
Kwal_55.208397.126ON3051484682e-57
Kwal_47.174694.107ON78163665.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C04330
         (209 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   376   e-134
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   216   5e-71
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   216   2e-70
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   213   5e-70
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   211   3e-69
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   212   2e-68
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   209   3e-68
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   211   2e-67
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   207   3e-67
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   202   9e-66
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   202   2e-65
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   201   6e-65
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   201   6e-65
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   201   7e-65
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   197   1e-63
ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   198   4e-63
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   195   2e-62
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   184   2e-57
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   182   2e-57
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   184   2e-57
Kwal_47.17469 s47 (418896..421241) [2346 bp, 781 aa] {ON} YGL009...    30   5.4  

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  376 bits (966), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 189/209 (90%), Positives = 189/209 (90%)

Query: 1   MTEVRRSSRIANKKIIHQADVKAEHXXXXXXXXXXXXXXXXXXXXIETDLKETQKDDYEE 60
           MTEVRRSSRIANKKIIHQADVKAEH                    IETDLKETQKDDYEE
Sbjct: 1   MTEVRRSSRIANKKIIHQADVKAEHSSKVSKKAKTTVKKTLSVSKIETDLKETQKDDYEE 60

Query: 61  IQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDLK 120
           IQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDLK
Sbjct: 61  IQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDLK 120

Query: 121 KYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKPSGIIRSYFIFVDG 180
           KYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKPSGIIRSYFIFVDG
Sbjct: 121 KYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKPSGIIRSYFIFVDG 180

Query: 181 KLKLKRVKVSPEVSITESKKEILDLVKEL 209
           KLKLKRVKVSPEVSITESKKEILDLVKEL
Sbjct: 181 KLKLKRVKVSPEVSITESKKEILDLVKEL 209

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  216 bits (551), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 112/221 (50%), Positives = 148/221 (66%), Gaps = 16/221 (7%)

Query: 1   MTEVRRSSRIANKKIIHQADVKAEHXXXXXXXXXXXXXXXXXXXXIETDLKETQKDDYE- 59
           M  VRRS+RIAN K   +AD +AE                      E D++ T+ DD E 
Sbjct: 1   MVAVRRSTRIANSKRKLEAD-EAERDVASKSGEETTSSKKLKK---EKDVRVTKVDDKES 56

Query: 60  ----------EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQA 109
                     E+++GDEIPDL LENQ+G ++SLR LA+ N I+  F YPRA TPGCTRQA
Sbjct: 57  KAENKPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQA 116

Query: 110 CGFRDNFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-S 168
           CGFRD +DDLKK++ + GLS DS  +QK F+ K +LPYDLL D +++ I +LG KK P S
Sbjct: 117 CGFRDTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQS 176

Query: 169 GIIRSYFIFVDGKLKLKRVKVSPEVSITESKKEILDLVKEL 209
           GIIRS+FIFVDGKL+ KR+K+SPE+S+ + KKE+L++V+E 
Sbjct: 177 GIIRSHFIFVDGKLRFKRIKISPEISVNDGKKEVLEIVEEF 217

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  216 bits (551), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 132/160 (82%), Gaps = 1/160 (0%)

Query: 51  KETQKDDYEEIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQAC 110
           K    D   E+++GD+IPD+TL NQ G+E+SL+++A+ NKII IF +PRASTPGCTRQAC
Sbjct: 99  KSANNDSIIELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQAC 158

Query: 111 GFRDNFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SG 169
           GFRDN+D+LKK +++ GLS D+I++QK F+ KQ+LPYDLL D +++LI +LG KK P SG
Sbjct: 159 GFRDNYDELKKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSG 218

Query: 170 IIRSYFIFVDGKLKLKRVKVSPEVSITESKKEILDLVKEL 209
            +RSY+IFV+GKL +KR+KVSPE+S+ ESKKE+++  K+L
Sbjct: 219 TVRSYWIFVEGKLSIKRIKVSPEISVAESKKEVIEFAKKL 258

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  213 bits (543), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 107/223 (47%), Positives = 148/223 (66%), Gaps = 30/223 (13%)

Query: 1   MTEVRRSSRIAN-------------KKIIHQADVKAEHXXXXXXXXXXXXXXXXXXXXIE 47
           M E+R+S+R+AN              KI+ +    A H                    I 
Sbjct: 1   MVELRKSARVANIKKQTTLTTPATSNKIVKKTSNAASHKKVK----------------IV 44

Query: 48  TDLKETQKDDYEEIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTR 107
            + ++    D + +++GDEIPDLTL +QEGE +SL ++A  NKI+ IF YPRASTPGCTR
Sbjct: 45  AETEDKPLVDAKVLEIGDEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCTR 104

Query: 108 QACGFRDNFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP 167
           QACGFRDN+ +LKK++ + GLS D++ +QK F+TKQNLPY+LL D +++ I +LG KK  
Sbjct: 105 QACGFRDNYAELKKHAAVYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKTS 164

Query: 168 -SGIIRSYFIFVDGKLKLKRVKVSPEVSITESKKEILDLVKEL 209
            SGIIRSY+IF +GKL++K++KVSPE S+ ESK E+L+LVKEL
Sbjct: 165 QSGIIRSYWIFFNGKLRIKKIKVSPEASVAESKAEVLELVKEL 207

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  211 bits (538), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 147/208 (70%), Gaps = 5/208 (2%)

Query: 3   EVRRSSRIANKKIIHQADVKAEHXXXXXXXXXXXXXXXXXXXXIETDLKETQKDDYEEI- 61
           E+RRS+R++ K   H  +VK E                      + + KE +    E I 
Sbjct: 2   ELRRSTRLSAK---HGNEVKDEGPIKKKAKSVLKEKVNTKEPVKKPNTKEEKVSSDEAIL 58

Query: 62  QVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDLKK 121
           +VGD+IPD+TL+NQ+G+++SL+ LA++NK+I IF+YP+ASTPGCTRQACGFRDNFDDLK+
Sbjct: 59  EVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGCTRQACGFRDNFDDLKE 118

Query: 122 YSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFIFVDG 180
           + L+LGLS D+  AQ  FK K +LPYDLLCD  ++ I +LG KK P SG IRS+F+F DG
Sbjct: 119 HGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGAKKTPASGSIRSHFVFADG 178

Query: 181 KLKLKRVKVSPEVSITESKKEILDLVKE 208
           KLK KR+K+SPE+S+ + KKE+L+L K+
Sbjct: 179 KLKFKRLKISPEISVADGKKEVLELAKQ 206

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  212 bits (540), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 124/149 (83%), Gaps = 1/149 (0%)

Query: 60  EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDL 119
           E++VGDE+PD  L+NQ  E +SL+ + ++N+I+ IF YP+A+TPGCTRQACG RDN++DL
Sbjct: 126 ELEVGDEVPDFELKNQNNETISLKKVMEENRIVVIFAYPKANTPGCTRQACGMRDNYNDL 185

Query: 120 KKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFIFV 178
           KKY+++ G+S DS++AQK F+ KQNLPYDLL D  ++LI  LGCKK P SGIIRS+FI V
Sbjct: 186 KKYAVVFGISADSVSAQKSFQEKQNLPYDLLSDKNRELIGALGCKKTPTSGIIRSHFIIV 245

Query: 179 DGKLKLKRVKVSPEVSITESKKEILDLVK 207
           +GKLK KRVK+SPEVS+++ KKE+L++ K
Sbjct: 246 NGKLKFKRVKISPEVSVSDCKKEVLEISK 274

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  209 bits (532), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 99/175 (56%), Positives = 138/175 (78%), Gaps = 11/175 (6%)

Query: 46  IETDLK------ETQKDDYE----EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIF 95
           ++TDLK      E Q D+      E+++GD IPDL+L +++ + +SL+ +A++NKI+  F
Sbjct: 38  VKTDLKVKVSETEDQGDNSASTSTELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFF 97

Query: 96  VYPRASTPGCTRQACGFRDNFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEK 155
           VYP+ASTPGCTRQACGFRDN+DDLKK+S + GLS DS+T+QK F+TKQNLPY LL D ++
Sbjct: 98  VYPKASTPGCTRQACGFRDNYDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKR 157

Query: 156 KLITILGCKKKP-SGIIRSYFIFVDGKLKLKRVKVSPEVSITESKKEILDLVKEL 209
           + I +LG KK P SG IRS+F+FVDGKL+ KRVK+SPEVS+ ++KKEIL+L +++
Sbjct: 158 EFIGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVNDAKKEILELAEKV 212

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  211 bits (538), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 99/166 (59%), Positives = 133/166 (80%), Gaps = 3/166 (1%)

Query: 47  ETDLKET--QKDDYEEIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPG 104
           ETD+ E   Q     E+ +GDEIPD+TL+NQ+G+++SLRD+A+++KII IF YP+ASTPG
Sbjct: 186 ETDVAEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPG 245

Query: 105 CTRQACGFRDNFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCK 164
           CTRQACG+RDN+D+LK+++ + GLSGD+ +AQK F+TKQ+LP+DLLCD  + LI  LG K
Sbjct: 246 CTRQACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAK 305

Query: 165 KKP-SGIIRSYFIFVDGKLKLKRVKVSPEVSITESKKEILDLVKEL 209
           K   SG +RS+++F DGKLK KRVKVSPEVSI + KKE+L+L   L
Sbjct: 306 KTAQSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELAASL 351

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  207 bits (526), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 126/158 (79%), Gaps = 1/158 (0%)

Query: 53  TQKDDYEEIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGF 112
            +  D  E+++GD IPDL+L N++ + +SL+ + + N+++  FVYPRASTPGCTRQACGF
Sbjct: 55  NRSSDVNELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGF 114

Query: 113 RDNFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGII 171
           RDN+ +LKKY+ + GLS DS+T+QK F++KQNLPY LL D +++ I +LG KK P SG I
Sbjct: 115 RDNYQELKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSI 174

Query: 172 RSYFIFVDGKLKLKRVKVSPEVSITESKKEILDLVKEL 209
           RS+FIFVDGKLK KRVK+SPEVS+ ++KKE+L++ ++ 
Sbjct: 175 RSHFIFVDGKLKFKRVKISPEVSVNDAKKEVLEVAEKF 212

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  202 bits (515), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 126/148 (85%), Gaps = 1/148 (0%)

Query: 60  EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDL 119
           E+Q+GD +PD+TL NQ+ +++SL+++A+ NKI+ +F YP+ASTPGCTRQACGFRDN+D++
Sbjct: 50  ELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYDEI 109

Query: 120 KKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFIFV 178
           KK++ + GLS DS+ +QK F+ KQNLP++LL D +++LI ILG KK P SGIIRS+++F+
Sbjct: 110 KKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWVFL 169

Query: 179 DGKLKLKRVKVSPEVSITESKKEILDLV 206
           DGKL+ + +KVSPE SI+ESKKE+++L 
Sbjct: 170 DGKLRFRNIKVSPERSISESKKEVMELA 197

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  202 bits (515), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 86/151 (56%), Positives = 127/151 (84%), Gaps = 1/151 (0%)

Query: 60  EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDL 119
           E++VGD+IPDL L+NQ+ +++SL++LA+KN+I+  F YP+ASTPGCTRQ CG+RDN++DL
Sbjct: 73  ELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVCGYRDNYEDL 132

Query: 120 KKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFIFV 178
           K+++ + GLS D+  AQK+F+TKQ+LPYDLL D +++ I +LG KK P SG+IRS+++F 
Sbjct: 133 KEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSGVIRSHWVFS 192

Query: 179 DGKLKLKRVKVSPEVSITESKKEILDLVKEL 209
           +GKL+ KRVK+SPE S+ + KKE+L+L K+L
Sbjct: 193 EGKLRFKRVKISPETSVADGKKEVLELAKDL 223

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  201 bits (511), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 87/151 (57%), Positives = 127/151 (84%), Gaps = 1/151 (0%)

Query: 60  EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDL 119
           E++VGD+IPDL+L N++ + +SL+++A++NKI+  FVYP+ASTPGCTRQACGFRDN++DL
Sbjct: 62  ELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121

Query: 120 KKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFIFV 178
           K+++ + GLS DS+ +QK F+TKQ LPY LL D +++ I +LG KK P SG IRS+F+FV
Sbjct: 122 KEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVFV 181

Query: 179 DGKLKLKRVKVSPEVSITESKKEILDLVKEL 209
           DGKL+ KRVK+SPEVS+ ++KKE+++L ++ 
Sbjct: 182 DGKLRFKRVKISPEVSVGDAKKEVMELAEKF 212

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  201 bits (511), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 84/151 (55%), Positives = 128/151 (84%), Gaps = 1/151 (0%)

Query: 60  EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDL 119
           E+++GD IPDL+L +++ + +SL+++A++NKI+  FVYP+ASTPGCTRQACGFRDN++DL
Sbjct: 62  ELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121

Query: 120 KKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFIFV 178
           KK++ + GLS D +T+QK F+TKQNLPY L+ D +++ I +LG KK P SG IRS+F+FV
Sbjct: 122 KKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVFV 181

Query: 179 DGKLKLKRVKVSPEVSITESKKEILDLVKEL 209
           +GKL+ KR+K+SPEVS++++KKE+L++ + +
Sbjct: 182 NGKLRFKRIKISPEVSVSDAKKEVLEIAERV 212

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  201 bits (511), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 86/146 (58%), Positives = 122/146 (83%), Gaps = 1/146 (0%)

Query: 58  YEEIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFD 117
           Y+E+Q+GD+IPD+ L ++EG  +SL+ + ++NKI+  F +P+A+TPGCTRQACGFRDN+ 
Sbjct: 80  YKELQIGDDIPDIILPDEEGVSVSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYK 139

Query: 118 DLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFI 176
           +LK+++ + G+S D +TAQK FKTKQNLPY LL D+++  I +LG KK P SG+IRSYFI
Sbjct: 140 ELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFI 199

Query: 177 FVDGKLKLKRVKVSPEVSITESKKEI 202
           FVDGKLK+KRVK+SPE+S+ E++KE+
Sbjct: 200 FVDGKLKVKRVKISPELSVEEARKEV 225

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  197 bits (501), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 98/210 (46%), Positives = 141/210 (67%), Gaps = 6/210 (2%)

Query: 1   MTEVRRSSRIANKKIIHQADVKAEHXXXXXXXXXXXXXXXXXXXXIETDLKETQKDDYEE 60
           M E+RRS+RI+ KK     D ++                      ++    E   +   E
Sbjct: 1   MVELRRSNRISAKK--EPLDSESAEPIKVKAKTESKVTKPNGKKEVKN---EDSANKLAE 55

Query: 61  IQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDLK 120
           +Q+GD+IPDLTL NQ+ E +SL+++A KNK++  F YP+ASTPGCTRQACG+RDN+ +LK
Sbjct: 56  LQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELK 115

Query: 121 KYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFIFVD 179
           +++ + GLS D+  +QK F+TKQ LP+DLL D +++ I  LG KK   SG++RS++IF +
Sbjct: 116 EHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKN 175

Query: 180 GKLKLKRVKVSPEVSITESKKEILDLVKEL 209
           GKL++KRV+VSPEVSI E KKE+L+L K L
Sbjct: 176 GKLEVKRVQVSPEVSIEEGKKEVLELAKSL 205

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  198 bits (503), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 88/147 (59%), Positives = 122/147 (82%), Gaps = 1/147 (0%)

Query: 64  GDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDLKKYS 123
           GD IPD+ L+NQ+G+E+SL+ ++ ++KI+ IF YP+ASTPGCTRQACGFRDN++D+K+++
Sbjct: 95  GDPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHA 154

Query: 124 LILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFIFVDGKL 182
            + GLS D++ AQK F+ KQ+LP+DLL D E+ L+ +LG KK P SGIIRS+++F DG L
Sbjct: 155 AVFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVL 214

Query: 183 KLKRVKVSPEVSITESKKEILDLVKEL 209
           K KRVK+SPEVSI E KKE+L+LVK+ 
Sbjct: 215 KHKRVKISPEVSIEEGKKEVLELVKQF 241

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  195 bits (495), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 86/160 (53%), Positives = 132/160 (82%), Gaps = 1/160 (0%)

Query: 50  LKETQKDDYEEIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQA 109
           LK  +    +E++VGD +P++ L+NQ+ +E++L+D+A+KNKI+ IF YP+A+TPGCTRQA
Sbjct: 60  LKSEKVGGPKELEVGDNVPEIALKNQDDKEVNLKDVAKKNKIVLIFAYPKANTPGCTRQA 119

Query: 110 CGFRDNFDDLKKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-S 168
           CGFRDN+++L+K+++I G+S DS+ +QK F++KQ+LP+DLL D +++LI +LG KK   +
Sbjct: 120 CGFRDNYEELQKHAVIFGISSDSVKSQKAFQSKQHLPFDLLSDPDRELIGMLGAKKTAQA 179

Query: 169 GIIRSYFIFVDGKLKLKRVKVSPEVSITESKKEILDLVKE 208
           G+IRS++IF +GKLK KRVKVSPE SI+E  +E+L L+K+
Sbjct: 180 GVIRSHWIFCNGKLKYKRVKVSPETSISEGLEEVLGLIKK 219

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  184 bits (467), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 117/148 (79%)

Query: 60  EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDL 119
           E++ GDE+PD+ L+NQEGEE+SL+ + Q+NK++ +F YP+ASTPGCT+QACGFRDN+++L
Sbjct: 43  ELEEGDEVPDVVLKNQEGEEVSLKSVVQQNKVVVVFAYPKASTPGCTKQACGFRDNYEEL 102

Query: 120 KKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKPSGIIRSYFIFVD 179
           KK + + GLS D+  AQ+ FK K +LP+DLL D ++KLI  LG  K PSG  RSY++FV 
Sbjct: 103 KKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSPSGTKRSYWVFVQ 162

Query: 180 GKLKLKRVKVSPEVSITESKKEILDLVK 207
           GKL+ KR+ VSPE S++E+KKE ++  +
Sbjct: 163 GKLRTKRISVSPEASVSEAKKEAIEAAQ 190

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  182 bits (463), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 118/150 (78%), Gaps = 1/150 (0%)

Query: 60  EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDL 119
           E+QVGD +P++TL+NQ+  ++ L D+ +KNKI+ +F YP+ASTPGCTRQACGFRDN+ +L
Sbjct: 86  ELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQEL 145

Query: 120 KKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFIFV 178
           +K++++ G+S DS+ +QK F+ KQ LP+DLL D +++LI  LG +K   +G+IRS+++FV
Sbjct: 146 QKHAVVFGISADSVKSQKSFQQKQKLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFV 205

Query: 179 DGKLKLKRVKVSPEVSITESKKEILDLVKE 208
           DGKL  KR+K+SPE+SI +   E+L   K+
Sbjct: 206 DGKLGSKRIKISPEMSIADGLSEVLLFAKK 235

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  184 bits (468), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 114/148 (77%)

Query: 60  EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDL 119
           E++VGDE+PD+ L+NQ+ EE+SL+ +AQ+NK++ IF YP+ASTPGCT QACGFRDN++DL
Sbjct: 46  ELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFRDNYEDL 105

Query: 120 KKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKPSGIIRSYFIFVD 179
           K+   + GLS D+  AQ+ F+   +LP+DLL D +++LI +LG KK PSG  RS+++F +
Sbjct: 106 KEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSPSGTKRSHWVFAN 165

Query: 180 GKLKLKRVKVSPEVSITESKKEILDLVK 207
           GKL  KR+ VSPEVSI ++K E  +  K
Sbjct: 166 GKLINKRIAVSPEVSIRDAKTEAHEAAK 193

>Kwal_47.17469 s47 (418896..421241) [2346 bp, 781 aa] {ON} YGL009C
           (LEU1) - isopropylmalate isomerase [contig 207] FULL
          Length = 781

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 114 DNFD--DLKKYSLILGLSGDSITAQKH-----FKTKQNLPYDLLCDTEKKLITILGCKKK 166
           ++FD  D +K+ L+ GL    IT QK      ++ ++ + +  L    K +  ++G KK 
Sbjct: 713 EHFDVEDFRKHCLVNGLDDIGITLQKEDFIRSYEARRKVEFSFLEGGSKNIKPVVGAKKS 772

Query: 167 PSG 169
           P G
Sbjct: 773 PYG 775

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,932,301
Number of extensions: 820531
Number of successful extensions: 2446
Number of sequences better than 10.0: 31
Number of HSP's gapped: 2463
Number of HSP's successfully gapped: 31
Length of query: 209
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 104
Effective length of database: 41,441,469
Effective search space: 4309912776
Effective search space used: 4309912776
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)