Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C043207.127ON45445423290.0
Kpol_1062.567.127ON45045319250.0
TBLA0A009507.127ON46947018890.0
TDEL0H028907.127ON44245318470.0
ZYRO0C05236g7.127ON44745318360.0
KNAG0L009507.127ON46146418150.0
SAKL0F05346g7.127ON44745618030.0
YPL259C (APM1)7.127ON47547617650.0
Kwal_55.208437.127ON44145117550.0
Smik_6.4667.127ON47647717540.0
KAFR0L004707.127ON46547017520.0
KLLA0D14311g7.127ON44345217490.0
Suva_16.457.127ON47847917520.0
KLTH0F12584g7.127ON44145117330.0
ADL017C7.127ON44345217330.0
Ecym_83507.127ON44545217280.0
Skud_16.197.127ON47647717280.0
NCAS0E021407.127ON48145217240.0
NDAI0E036807.127ON44445317110.0
CAGL0K00539g7.127ON45645816910.0
Ecym_52393.165ON4644755614e-66
SAKL0D13090g2.555ON4995285094e-58
Kwal_33.141823.165ON4674795031e-57
KLTH0F06534g3.165ON4664795003e-57
SAKL0C07414g3.165ON4825004952e-56
Kwal_26.81462.555ON5055414876e-55
CAGL0C05203g3.165ON4754884858e-55
TDEL0D045803.165ON4824964813e-54
KLLA0C03894g3.165ON4754834771e-53
NDAI0G029203.165ON4864984762e-53
NCAS0C035803.165ON4914994752e-53
ADR315W3.165ON4924164744e-53
ABR047W2.555ON4984724632e-51
Kpol_1045.443.165ON4694794603e-51
ZYRO0B04840g3.165ON4764934561e-50
KLTH0D07502g2.555ON5044934465e-49
TBLA0F008403.165ON4814904412e-48
KLLA0F25432g2.555ON5075394361e-47
Ecym_45912.555ON5014894115e-44
Suva_15.1033.165ON4913014071e-43
TPHA0P006603.165ON4734924042e-43
YOL062C (APM4)3.165ON4915004027e-43
Smik_15.963.165ON4913003913e-41
Skud_15.913.165ON4912993852e-40
KNAG0K011503.165ON4744853659e-38
TDEL0B064302.555ON5253343343e-33
ZYRO0E05874g2.555ON5493423327e-33
TPHA0I023902.555ON5593623203e-31
Skud_8.262.555ON5963673195e-31
KAFR0A020602.555ON5403433123e-30
KAFR0C010203.165ON4284813074e-30
NCAS0A126502.555ON5883483124e-30
Kpol_1056.132.555ON5413503081e-29
YHL019C (APM2)2.555ON6053713053e-29
Smik_8.232.555ON6033533045e-29
CAGL0K03223g2.555ON5983733045e-29
Suva_8.332.555ON5963692965e-28
KNAG0C055502.555ON5823532966e-28
TBLA0B067602.555ON6572342248e-19
NDAI0B016102.555ON6722651982e-15
AGL061W2.522ON4114031462e-09
KLLA0E18789g2.522ON4973251437e-09
KLTH0D06556g2.522ON4564391392e-08
KAFR0D035602.522ON4553161373e-08
TDEL0A029702.522ON4963331373e-08
TPHA0C041302.522ON5331491358e-08
SAKL0A09218g2.522ON4732811348e-08
TBLA0I006202.522ON6091531358e-08
Kwal_26.79572.522ON4561361241e-06
ZYRO0B01738g2.522ON4921441161e-05
Kpol_1018.422.522ON5751501099e-05
Suva_4.5482.522ON4841381052e-04
KNAG0D030003.575ON5631251053e-04
Ecym_60073.575ON5371251000.001
NCAS0A048702.522ON489333980.002
KLLA0D11396g3.575ON536140970.003
Skud_2.4192.522ON484138950.004
ZYRO0E09746g3.575ON538130910.013
YBR288C (APM3)2.522ON483140910.013
Smik_2.4302.522ON484135900.016
AFR274C3.575ON532125890.022
NDAI0B063203.575ON540114880.035
CAGL0L02145g2.522ON543103880.036
Smik_7.3713.575ON598114860.060
KLTH0G00528g3.575ON633129860.060
Skud_6.1423.575ON546114850.084
TBLA0E001403.575ON543129840.099
YFR051C (RET2)3.575ON546114830.14
NDAI0K019302.522ON612159820.16
Suva_12.63.575ON546114820.16
Ecym_72662.522ON517136810.24
SAKL0F00594g3.575ON545125800.31
TDEL0D064303.575ON536129790.39
Kwal_26.94485.28ON55191760.89
KNAG0A069702.522ON50544760.93
TPHA0G037003.575ON539129741.5
TBLA0A012601.388ON15659702.2
NDAI0G052101.388ON15675693.4
CAGL0B04983g1.388ON15677674.8
Smik_10.3481.505ON14751674.8
YJR058C (APS2)1.505ON14751674.8
KAFR0J001303.575ON54388697.0
AFR124W1.388ON15679667.2
KLLA0B06545g1.505ON14854667.4
ZYRO0E05236g1.388ON15662668.2
KLTH0H11770g1.388ON15682668.3
SAKL0D08074g1.388ON15678659.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C04320
         (454 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   901   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   746   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   732   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   716   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   711   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   703   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   699   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   684   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   680   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   680   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   679   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   678   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   679   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   672   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   672   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   670   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   670   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   668   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   663   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   655   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   220   4e-66
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   200   4e-58
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   198   1e-57
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   197   3e-57
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   195   2e-56
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   192   6e-55
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   191   8e-55
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   189   3e-54
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   188   1e-53
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   187   2e-53
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   187   2e-53
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   187   4e-53
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   182   2e-51
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   181   3e-51
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   180   1e-50
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   176   5e-49
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   174   2e-48
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   172   1e-47
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   162   5e-44
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   161   1e-43
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   160   2e-43
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   159   7e-43
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   155   3e-41
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   152   2e-40
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   145   9e-38
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   133   3e-33
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   132   7e-33
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   127   3e-31
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   127   5e-31
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   124   3e-30
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   122   4e-30
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   124   4e-30
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   123   1e-29
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   122   3e-29
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   121   5e-29
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   121   5e-29
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   118   5e-28
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   118   6e-28
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    91   8e-19
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    81   2e-15
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    61   2e-09
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    60   7e-09
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    58   2e-08
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    57   3e-08
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    57   3e-08
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    57   8e-08
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    56   8e-08
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    57   8e-08
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    52   1e-06
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    49   1e-05
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    47   9e-05
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    45   2e-04
KNAG0D03000 Chr4 complement(537905..539596) [1692 bp, 563 aa] {O...    45   3e-04
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    43   0.001
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    42   0.002
KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {...    42   0.003
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    41   0.004
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    40   0.013
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    40   0.013
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    39   0.016
AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON} S...    39   0.022
NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa] ...    39   0.035
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    39   0.036
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    38   0.060
KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar ...    38   0.060
Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON...    37   0.084
TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575...    37   0.099
YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}  ...    37   0.14 
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    36   0.16 
Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)     36   0.16 
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    36   0.24 
SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar ...    35   0.31 
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    35   0.39 
Kwal_26.9448 s26 complement(1221754..1223409) [1656 bp, 551 aa] ...    34   0.89 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    34   0.93 
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    33   1.5  
TBLA0A01260 Chr1 (299419..299889) [471 bp, 156 aa] {ON} Anc_1.38...    32   2.2  
NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1....    31   3.4  
CAGL0B04983g Chr2 (484166..484636) [471 bp, 156 aa] {ON} highly ...    30   4.8  
Smik_10.348 Chr10 complement(533694..534137) [444 bp, 147 aa] {O...    30   4.8  
YJR058C Chr10 complement(544732..545175) [444 bp, 147 aa] {ON}  ...    30   4.8  
KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.57...    31   7.0  
AFR124W Chr6 (662389..662859) [471 bp, 156 aa] {ON} Syntenic hom...    30   7.2  
KLLA0B06545g Chr2 (583095..583541) [447 bp, 148 aa] {ON} highly ...    30   7.4  
ZYRO0E05236g Chr5 complement(399318..399788) [471 bp, 156 aa] {O...    30   8.2  
KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highl...    30   8.3  
SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {O...    30   9.1  

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/454 (96%), Positives = 439/454 (96%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           FGIPQITETKMLKKYITQ               NAARPPAELTNSVSWRPEGITYKKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240
           FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240

Query: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300
           SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI
Sbjct: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300

Query: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360
           KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK
Sbjct: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360

Query: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420
           WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV
Sbjct: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420

Query: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIRLNK 454
           RYLKVNEPKLQYKSYPWVRYITQSGEDYTIRLNK
Sbjct: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIRLNK 454

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/453 (80%), Positives = 402/453 (88%), Gaps = 5/453 (1%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           MVSG+YFCD +GKPIL+RRYRDDI ++AID FSQ+LL+ EEE+ V+PPC++++GIHYLFI
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +HSDIYVVALTTSYQTN+AQIFMFLHQLV VL +Y+K V EES+RDNFVIIYELLDEMMD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQITETKMLK+YITQ               NAARPP  LTNSVSWR EGI YKKNEA
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKR--NAARPPVALTNSVSWRQEGIKYKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240
           +LDIIESINML+ QQGQVLRSEI+G V+V+SRLSGMPDLKLGIND+GIFS YLE N  D 
Sbjct: 179 YLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLE-NEEDF 237

Query: 241 SSSSTPIPEG--VEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTT 298
           S     I +      KK  IELEDLKFHQCVRLSKFENEKIITFIPPDGEF+LMNYRLTT
Sbjct: 238 SKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTT 297

Query: 299 PIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGS 358
           PIKPLIWCD+NIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTP F+YSHGS
Sbjct: 298 PIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGS 357

Query: 359 IKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGI 418
           IKWLPEKNAILWKLRSFAGGKEYSM+AQL LPSVDG+EPPKV+RPVQ+KFQIPYFTTSGI
Sbjct: 358 IKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGI 417

Query: 419 QVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451
           QVRYLK+NEPKLQYKS+PWVRYITQSG+DYTIR
Sbjct: 418 QVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/470 (75%), Positives = 396/470 (84%), Gaps = 19/470 (4%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           MVS I FCD+ GK +L+R+YRDDI + AIDNF+ LL++LEEE+ V+PPC+ H GIHYLFI
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+D+Y+VALTTS  TN +Q+F FLH+LVEV+ EY+K V EES+RDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQITETKMLK+YITQ                AARPP  LTNSVSWRPEGI YKKNEA
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRN--AARPPQALTNSVSWRPEGIKYKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEEN---- 236
           FLDI+ESINML+TQQGQVLRSEI+G V+VRSRLSGMPDLKLGIND+GIFS YLE      
Sbjct: 179 FLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNS 238

Query: 237 --------NVDGSSSSTPIP-----EGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFI 283
                    V+ S SSTP P     EG   K   +ELEDLKFHQCVRLSKFENEKIITFI
Sbjct: 239 NSNDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFI 298

Query: 284 PPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPV 343
           PPDG F+LM+YRLTTPIKPLIWCDVNI VHSKSR+EIHCRAKAQIKKKSIANNVEILIPV
Sbjct: 299 PPDGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPV 358

Query: 344 PDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRP 403
           PDDADTP FRYSHGSIKW+PEKNAILWK+RSFAGGKEYSM+AQL LPS+D  E PK++RP
Sbjct: 359 PDDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRP 418

Query: 404 VQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRLN 453
           VQ+KFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSG+DYTIRLN
Sbjct: 419 VQIKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRLN 468

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/453 (75%), Positives = 385/453 (84%), Gaps = 11/453 (2%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           MVSGIYFCD  G+PIL+RRYRDDI ++AID F+ LL  LEEE+ VIPPC+ H+GI YLFI
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H D+YVVAL+TS  TN AQ+F FLH+LVE L +Y+K V EESVRDNFVIIYELLDEMMD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQITETKMLK+YITQ                 ARPP  LTNSVSWR +GITYKKNEA
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKA--TARPPTGLTNSVSWRADGITYKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240
           FLDI+ESINM++ QQGQVLRSEI+G V VRSRLSGMPDLKLGIND+GIF+        D 
Sbjct: 179 FLDIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTR-------DP 231

Query: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300
            +  + +  G   KK   ELEDLKFHQCVRLSKFENEKIITFIPPDGEF+LM+YRLTTP+
Sbjct: 232 ETGESQVTAG--KKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMSYRLTTPV 289

Query: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360
           KPLIWCDVN+QVHSKSRIEIHCRAKAQIKKKS+ANNVEILIPVPDDADTP FRYSHGSIK
Sbjct: 290 KPLIWCDVNVQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIK 349

Query: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420
           W+PEKNAILWK+RSF GGKEYSM+AQ+ LPS++GVE PK +RPVQVKFQIPYFTTSGIQV
Sbjct: 350 WVPEKNAILWKIRSFYGGKEYSMAAQMGLPSINGVEKPKFKRPVQVKFQIPYFTTSGIQV 409

Query: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIRLN 453
           RYLK+NEPKLQYKSYPWVRYITQ+G+DYTIRLN
Sbjct: 410 RYLKINEPKLQYKSYPWVRYITQNGDDYTIRLN 442

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/453 (73%), Positives = 388/453 (85%), Gaps = 7/453 (1%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           MVS +YFCD  G+PIL+RRYRDDI I+AID F+ LLLQLEEE+ VIPPC+ H GI YLFI
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+D+YVVAL TS  TNVAQ+F FLH+L+EVLEEY+K V EESVRDNF+IIYELLDEMMD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQITETKMLK+YITQ                A RPP E+TNSVSWR   I +KKNEA
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKA--APRPPTEVTNSVSWRAPNIVHKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240
           FLDI+ESINML+ QQGQVLRSEI+G ++V+S+LSGMPDLKLGIND+GIFS Y+E    D 
Sbjct: 179 FLDIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEG---DS 235

Query: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300
              +T + EG   KK  IELEDLKFHQCVRLSKFENEKIITFIPPDG F+LMNYRL+ P+
Sbjct: 236 DPVTTAVTEG--KKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPV 293

Query: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360
           KPLIWCDVN+QVHS+SRIEIHCRA+AQIKK+SIAN+VEILIPVPDDADTP F+Y+HGS+K
Sbjct: 294 KPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVK 353

Query: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420
           W+P+KNAILWK+RSF GGKEYSMSAQ+ LPS++ ++ PKV+RPVQ+KFQIPYFTTSGIQV
Sbjct: 354 WVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQV 413

Query: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIRLN 453
           RYLK+ EPKL YKSYPWVRYITQSG+DYTI+LN
Sbjct: 414 RYLKITEPKLLYKSYPWVRYITQSGDDYTIKLN 446

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/464 (71%), Positives = 391/464 (84%), Gaps = 14/464 (3%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S +YFCD+ GKP+L+RRY+DD+ ++AID FS LL  LE+E+ VIPPCI H GI YLFI
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+D+YVVAL TS   N+A++F FLH+L+ VL EY+K V EES+RDNFVIIYEL+DEMMD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQITE +MLKKYITQ               NAARPP+EL NSVSWR EGI YKKNEA
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKR--NAARPPSELNNSVSWRAEGIKYKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNV-- 238
           FLDI+ESINML+TQ+GQVLRSEI+GAV+++SRLSGMPDLKLGINDRGIF+ YLE NN+  
Sbjct: 179 FLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGV 238

Query: 239 ---------DGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEF 289
                     G + S+   +G + +K  IELEDLKFHQCVRLSKFENEKIITFIPPDGEF
Sbjct: 239 NIPDPQEHGSGVAESSITNDG-KKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEF 297

Query: 290 DLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADT 349
           DLMNYRLTT IKPLIWCDV+IQVHSKSRIEI CRAKAQIKKKS+A NV+ILIPVPDDADT
Sbjct: 298 DLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADT 357

Query: 350 PQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQ 409
           P F+YSHGSIK++PE++AILWK++SF GGKEY+M A++ LPS+D  E PKV+RPVQVKF+
Sbjct: 358 PSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFE 417

Query: 410 IPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRLN 453
           IPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSG+DYTIR+N
Sbjct: 418 IPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRVN 461

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/456 (72%), Positives = 384/456 (84%), Gaps = 12/456 (2%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S IYFCD+ GK IL+RRY+DDI  NAID F  LL++ E+E+ VIPPC+ H GI YLF+
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+D+YV+ +T S  TNVAQ+F FL+++VEVL EYVK+V EES+RDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQITETKMLK+YITQ               N  RPP  LTNSVSWRPEGI YKKNEA
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSK--NVIRPPIALTNSVSWRPEGIMYKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLE---ENN 237
           FLD++ESINML+TQQGQVLRSEI+G V+V+S LSGMPDLKLG+ND+GIFSN++    E+ 
Sbjct: 179 FLDVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDE 238

Query: 238 VDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLT 297
            D  S++         KK  IELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LM+YRLT
Sbjct: 239 ADDLSATG-------KKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLT 291

Query: 298 TPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHG 357
           TPIKPLIWCD+ IQVHSKSRIE+HCRAKAQIKKKS ANNVEILIPVP+DAD+P+FRYSHG
Sbjct: 292 TPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHG 351

Query: 358 SIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSG 417
           SIKW PEKNAILWK++SF GGKEYSM+AQL LPSV   E P ++RPVQVKFQIPYFTTSG
Sbjct: 352 SIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSG 411

Query: 418 IQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRLN 453
           IQVRYLK+NEPK+QY+SYPWVRYITQSG+DYTIR+N
Sbjct: 412 IQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRMN 447

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/476 (69%), Positives = 386/476 (81%), Gaps = 26/476 (5%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S +YFCD+ GKP+L+RRYRDDI ++AID F  LL  LEE++ +IPPC+ H G+ YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+D+YVVA+ TS   N A IF FLH+LVEVL +Y+K V EES+RDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQITETKMLK+YITQ               NA RPP  LTNSVSWRPEGIT+KKNEA
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKR--NATRPPVALTNSVSWRPEGITHKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEEN-NVD 239
           FLDI+ESINML+TQ+GQVLRSEI+G V+V S+LSGMPDLKLGIND+GIFS YL+++ N+ 
Sbjct: 179 FLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIP 238

Query: 240 GSSSSTPIPEGVEDKKP-------------QIELEDLKFHQCVRLSKFENEKIITFIPPD 286
            +S++T       DKKP              IELEDLKFHQCVRLSKFENEKIITFIPPD
Sbjct: 239 SASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPD 298

Query: 287 GEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDD 346
           G+FDLMNYRL+T IKPLIWCDVN+QVHS SRIEIHC+AKAQIK+KS A NVEILIPVPDD
Sbjct: 299 GKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDD 358

Query: 347 ADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEP-----PK-- 399
           ADTP F+YSHGS+K++PEK+AILWK+RSF GGKEYSMSA+L LPS+   E      PK  
Sbjct: 359 ADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSN 418

Query: 400 ---VRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452
              ++ PVQ+KFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSG+DYTIRL
Sbjct: 419 AEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/451 (70%), Positives = 377/451 (83%), Gaps = 12/451 (2%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S IYFCDN GK IL+RRYRDD+  +AI+ F  LLL+ E+E+ V+PPC+ H G+ Y+FI
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+DIYV+ ++ S   NVAQ+F FL++LVEVL EY+K V EES+RDNFVIIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQITETKMLK+YITQ               N  RPPA+LT SVSWRPEGITYKKNEA
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSK--NVVRPPAQLTKSVSWRPEGITYKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240
           FLD+ ESINML+T  GQVLRSEI+G V+VRSRLSGMPDLKLG+ND+GIF++    NN +G
Sbjct: 179 FLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTSEEGGNNAEG 238

Query: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300
            S           KK  IELEDL+FHQCVRLSKFENEKII+FIPPDG+FDLMNYRL+TPI
Sbjct: 239 GSG----------KKSNIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPI 288

Query: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360
           KPLIWCD  IQVHS+SRIEIHCRAKAQIKKKS ANNVEILIPVP+DAD+P+FRYSHGS+K
Sbjct: 289 KPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLK 348

Query: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420
           ++PEK+AILW++++F GGKEYS +AQL LPS+  VE PK +RP+QVKFQIPYFTTSGIQV
Sbjct: 349 YVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQV 408

Query: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451
           RYLKV+EPKLQY+SYPWVRYITQSG+DYTIR
Sbjct: 409 RYLKVHEPKLQYQSYPWVRYITQSGDDYTIR 439

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/477 (69%), Positives = 387/477 (81%), Gaps = 27/477 (5%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S +YFCD+ GKP+L+RRYRDD+ ++AID FS LL  LEE++ +IPPC+ H G+ YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+D+Y+VA+ TS   N A IF FLH+LVEVL +Y+K V EES+RDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQITETKMLK+YITQ               NA RPP  LTNSVSWRPEGIT+KKNEA
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKR--NATRPPVALTNSVSWRPEGITHKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLE-ENNVD 239
           FLDI+ESINML+TQ+GQVLRSEI+G V+V S+LSGMPDLKLGIND+GIFS YL+ ++N+ 
Sbjct: 179 FLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIP 238

Query: 240 GSSSSTPIPEGVE-DKKP-------------QIELEDLKFHQCVRLSKFENEKIITFIPP 285
            + S+       + DKKP              IELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 239 SAVSAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 298

Query: 286 DGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPD 345
           DG+FDLMNYRL+T IKPLIWCDVN+QVHS SRIEIHC+AKAQIK+KS A NVEILIPVPD
Sbjct: 299 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 358

Query: 346 DADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSV----DGVEP-PK- 399
           DADTP F+YSHGS+K++PEK+AILWKLRSF GGKEYSMSA+L LPS+    DG    PK 
Sbjct: 359 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKS 418

Query: 400 ----VRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452
               ++ PVQ+KFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSG+DYTIRL
Sbjct: 419 NAKLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/470 (69%), Positives = 382/470 (81%), Gaps = 23/470 (4%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S +YFCD+ GKP+L+R+YRDDI ++AID FS LL   EEE+ ++PPCI H GI Y+FI
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+D+Y+ AL TS Q N++ IF FLH++++VL+ Y+K V EES+RDNF+IIYELLDEMMD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +G+PQITETKMLKKYIT                NAARPP ELTNSVSWRPEGI YKKNEA
Sbjct: 121 YGLPQITETKMLKKYIT--TKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNV-- 238
           FLDIIESINML+TQ+GQVLRSEIVG VRV+SRLSGMPDLKLGINDRGIF+ YLE NN+  
Sbjct: 179 FLDIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNNIGI 238

Query: 239 ----------DGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGE 288
                     D ++ S+ + EG   +K  IELEDLKFHQCVRLSKFENEKII+FIPPDGE
Sbjct: 239 AKNGDDEDADDTNNESSIVSEGSNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDGE 298

Query: 289 FDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDAD 348
           FDLMNYRL+T IKPLIWCDV+IQ +   RIEIHC+AKAQIKKKSIA NVEILIPVP+DAD
Sbjct: 299 FDLMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPEDAD 355

Query: 349 TPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVR------R 402
           +P F+YSHG IK+LPEKN +LWK+ SF GGKEYSM+AQ+ LPS+ G +    R      +
Sbjct: 356 SPIFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKK 415

Query: 403 PVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452
           PVQVKF+IPYFTTSGIQVRYLKVNEPKLQYK+YPWVRYITQSG+DYTIR+
Sbjct: 416 PVQVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIRI 465

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/452 (69%), Positives = 377/452 (83%), Gaps = 9/452 (1%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S + FCD+ GKP+L+RRY+DD+S +A+++F  LLL+ E+E+ V+PPC  H GIHY+++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +++D+YV+ALT S   N   +F F+++L+ V+EEYVK V EES+RDN++IIYELLDEMMD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
            G+PQ+TETKMLK+YITQ               N ARPP ELTNSVSWRPEGI YKKNEA
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQK--NVARPPTELTNSVSWRPEGIKYKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240
           FLD+IESINML+TQQGQVLRSEI+G V+VRSRLSGMPDLKLG+ND+GIF+   +E++ + 
Sbjct: 179 FLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEP 238

Query: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300
             SS       + K   IELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM YRL+TPI
Sbjct: 239 VVSS-------KKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPI 291

Query: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360
           KPLIWCDV +QVHS SRIEIHCRAKAQIKKKS+ANNVEILIP+P+DAD+P F+YS G+IK
Sbjct: 292 KPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIK 351

Query: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420
           W+PEKNAILWK  SF GGKEYSM+AQL LPSV   EPPK++RPVQ+KFQIPYFTTSGIQV
Sbjct: 352 WVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQV 411

Query: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452
           RYLK+ EPKLQY SYPWVRYITQSG+DYTIRL
Sbjct: 412 RYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/479 (69%), Positives = 389/479 (81%), Gaps = 29/479 (6%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S +YFCD+ GKP+L+RRYRDDI ++AID F  LL  LEE++ +IPPC+ H G+ YLFI
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+D+Y+VA+ TS   N A IF FLH+LVEVL +Y+K V EES+RDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQITETKMLK+YITQ               NA RPP  LTNSVSWRPEGI++KKNEA
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKR--NATRPPVALTNSVSWRPEGISHKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEEN-NVD 239
           FLDI+ESINML+TQ+GQVLRSEI+G V+V S+LSGMPDLKLGIND+GIFS YL+++ N+ 
Sbjct: 179 FLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLP 238

Query: 240 GSSSSTPIPEGVE---DKKP-------------QIELEDLKFHQCVRLSKFENEKIITFI 283
            ++S+T      +   DKKP              IELEDLKFHQCVRLSKFENEKIITFI
Sbjct: 239 PAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFI 298

Query: 284 PPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPV 343
           PPDG+FDLMNYRL+T IKPLIWCDVN+QVHS SRIEIHC+AKAQIK+KS A NVEILIPV
Sbjct: 299 PPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPV 358

Query: 344 PDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSV----DGVEP-P 398
           PDDADTP F+YSHGS+K++PEK+AILWKLRSF GGKEYSMSA+L LPS+    DG +  P
Sbjct: 359 PDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIP 418

Query: 399 K-----VRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452
           K     ++ PVQ+KFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSG+DYTIRL
Sbjct: 419 KNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/451 (70%), Positives = 375/451 (83%), Gaps = 12/451 (2%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S IYFCDN GK IL+RRYRDD+  +AI+ F  LLL+ E+E+ ++PPC+ H G+ YLFI
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+DIYV+ ++ S   NVAQ+F FL++LVEVL EYVK V EES+RDNFVIIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQITETKMLK+YITQ               N  RPP++LT SVSWRPEGITYKKNEA
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSK--NVIRPPSQLTKSVSWRPEGITYKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240
           FLD+ ESINML+T  GQVLRSEI+G V VRSRLSGMPDLKLG+ND+GIF++    ++ + 
Sbjct: 179 FLDVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTSVESASSSEA 238

Query: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300
           +          E KK  IELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LMNYRL+TPI
Sbjct: 239 T----------EGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMNYRLSTPI 288

Query: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360
           KPLIWCD  IQVHS+SRIEIHCRAKAQIKKKS ANNVEILIPVP+DAD+P+FRYSHGS+K
Sbjct: 289 KPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLK 348

Query: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420
           ++PEK+AILWK+++F GGKEYS +AQL LPS+   E P+ +RP+QVKFQIPYFTTSGIQV
Sbjct: 349 YVPEKSAILWKIKTFNGGKEYSFAAQLGLPSMTDAEVPRAKRPIQVKFQIPYFTTSGIQV 408

Query: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451
           RYLK+NEPKLQY+SYPWVRYITQSG+DYTIR
Sbjct: 409 RYLKINEPKLQYQSYPWVRYITQSGDDYTIR 439

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/452 (69%), Positives = 381/452 (84%), Gaps = 9/452 (1%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M SGIYFCD+ GK +L+RRY+DDI  NAI+ F  LL++ E+E+ V+PPC    G+ YLFI
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+D+YV+ LT S   NVAQ+F +LH+L+EVLEEY+K+V EES++DNFVIIYELLDEMMD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
            GIPQIT+TKML++YITQ               N  RPPA LTNSVSWRPEGI YKKNEA
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKK--NVVRPPATLTNSVSWRPEGIVYKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240
           FLD++ESINML+TQQGQVLRSEI+G V+V+SRLSGMPDLKLG+ND+GIF+   ++++ +G
Sbjct: 179 FLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQGDDDDDEEG 238

Query: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300
           +S  T        KK  IELEDLKFHQCVRL+KFENEKIITFIPPDG+F+LM+YRL+TPI
Sbjct: 239 ASGGT-------KKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPI 291

Query: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360
           KPLIWCDV +QVHS+SRIEIHCRAKAQIKKKS ANNVEILIPVP+DAD+P+FRYSHG+IK
Sbjct: 292 KPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIK 351

Query: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420
           W+P +NAILWK++SF GGK+YSM+A++ LPSV      K++RPVQ+KFQIPYFTTSGIQV
Sbjct: 352 WVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQV 411

Query: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452
           RYLK+NEPK+QY SYPWVRYITQSG+DYTIR+
Sbjct: 412 RYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/452 (69%), Positives = 376/452 (83%), Gaps = 7/452 (1%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M SGIYFCD  GK +L+RRY+DDI I+AI+ F  LL++ E+E+ VIPPC  H G+ YLFI
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+D+Y++ LT S   NVAQ+F FLH LV+VL+EY+K+V EES++DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
            GIPQIT+TKML++YITQ               N  RPP+ LT +VSWRPEGI YKKNEA
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKK--NVVRPPSSLTTAVSWRPEGIKYKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240
           FLD+IESINM++TQQGQVLRSEI+G V+VRSRLSGMPDLKLG+ND+GIF+   EE   + 
Sbjct: 179 FLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQSNEEEEDEP 238

Query: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300
           SS  +     +  KK  IELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LM+YRL+TPI
Sbjct: 239 SSQPS-----ITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPI 293

Query: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360
           KPLIWCD  IQVHS+SR+E+HCRAKAQIK KS ANNVEILIPVP+DAD+P+FRYSHGSIK
Sbjct: 294 KPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIK 353

Query: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420
           W+PEKNAILWK++SF GGK+YSM+A++ LPSV+ +     +RPVQ+KFQIPYFTTSGIQV
Sbjct: 354 WVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQV 413

Query: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452
           RYLK+NEPKLQY SYPWVRYITQSGEDY IR+
Sbjct: 414 RYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/477 (68%), Positives = 385/477 (80%), Gaps = 27/477 (5%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S +YFCD+ GKP+L+RRYRDDI ++AID F  LL  LEE++ +IPPC+ H G+ YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+D+Y+VA+ TS + N A IF FLH+LVEVL +Y+K V EES+RDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQI ETKMLK+YITQ               NA RPP  LTNSVSWRPEGI +KKNEA
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKR--NATRPPVALTNSVSWRPEGIIHKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240
           FLDI+ESINML+TQ+GQVLRSEI+G V+V S+LSGMPDLKLGIND+GIFS YL++++   
Sbjct: 179 FLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTP 238

Query: 241 SSSSTPIPEGVED--KKP-------------QIELEDLKFHQCVRLSKFENEKIITFIPP 285
             +S    + + D  KKP              IELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 239 PPTSAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 298

Query: 286 DGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPD 345
           DG+FDLMNYRL+T IKPLIWCDVN+QVHS SRIEIHC+AKAQIK+KS A NVEI+IPVPD
Sbjct: 299 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPD 358

Query: 346 DADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSV-DGVEP----PK- 399
           DADTP F+YSHGS+K++PEK+AILWKLRSF GGKEYSMSA+L LPS+ + +E     PK 
Sbjct: 359 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKS 418

Query: 400 ----VRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452
               ++ PVQ+KFQIPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSG+DYTIRL
Sbjct: 419 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/452 (69%), Positives = 377/452 (83%), Gaps = 3/452 (0%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S +YFCD+ G P+LARRYRDDI I+AI+ F  LL  LEEET ++PPC+ + G+ YLFI
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+D+Y+VA+  S   N AQIF FL++LV+VL  Y+K V EES+RDNFVIIYELLDE MD
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQITETKMLK+YITQ                AARPP  LTNSVSWR   I YKKNEA
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRN--AARPPEALTNSVSWRSADIKYKKNEA 209

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240
           FLDIIESINML+TQ+GQ+LRSEI+G V+V+SRLSGMPDLKLGIND+GIFS ++++++++ 
Sbjct: 210 FLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNN 269

Query: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300
             +S       + KK  IELEDLKFHQCVRLSKFE EKIITFIPPDG+F+LMNYRL+T I
Sbjct: 270 EGASVA-SSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSI 328

Query: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360
           KPLIWCD+NIQVHS+SRIEIHCRAKAQIKKKS A NV+I+IPVP+DADTP+F+YSHGSIK
Sbjct: 329 KPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIK 388

Query: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420
           ++PEKN I+WK+RSF GGKEYSMSAQ+ LPS+  +E  K +RPVQ+KFQIPYFTTSGIQV
Sbjct: 389 YVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQV 448

Query: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452
           +YLK+NEPKLQYKSYPWVRYITQSG+DYTIRL
Sbjct: 449 KYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 480

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/453 (69%), Positives = 379/453 (83%), Gaps = 11/453 (2%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S IYFCD  G+P+L+R+YRDDI + AID F+ LL  LEEE+ VIPPC+ +    YLFI
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +HSDIY+VA+T   +TN+A++F FL+++++VL +Y+K V EES+RDN+VIIYELLDE+MD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQITETKMLK+YITQ                AARPP+ LT+SVSWR EGI YKKNEA
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQN--AARPPSALTDSVSWRSEGIKYKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240
           FLDI+ESINML+TQ+GQ+LRSEI+G V+++SRLSGMPDLKLGIND+GIFS  L E++ + 
Sbjct: 179 FLDIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNN 238

Query: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300
           +++S         K+ +IELEDLKFHQCVRLSKFE EKIITFIPPDG+F+LMNYRL+T I
Sbjct: 239 NATSK--------KQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSI 290

Query: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360
           KPLIWCD+N+QVHS SRIEIHCRAKAQIKKKS A NVEILIPVP+DADTP F+YSHGSIK
Sbjct: 291 KPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIK 350

Query: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDG-VEPPKVRRPVQVKFQIPYFTTSGIQ 419
           W+PEK+AILWK+RSF GGKEYSM+A+L LPS     E  + ++PVQVKFQIPYFTTSGIQ
Sbjct: 351 WVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQ 410

Query: 420 VRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452
           VRYLK+NEPKLQYKSYPWVRYITQSG+DYTIRL
Sbjct: 411 VRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/458 (70%), Positives = 375/458 (81%), Gaps = 7/458 (1%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S IYFCDN G+P+L+R+YRDDI  +AID F  LL   EEET +IPPCI H GI +LFI
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           +H+D+Y+VA+ TS   N A IF FLH+++EVL EY+K V EES+RDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELTNSVSWRPEGITYKKNEA 180
           +GIPQITE KMLK+YITQ                AARPP  LTNSVSWRPEGI +KKNEA
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRN--AARPPTSLTNSVSWRPEGIKHKKNEA 178

Query: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLE--ENNV 238
           FLDIIESINML+TQ+GQVLRSEI+G V+V+S+LSGMPDLKLGIND+G+FS YLE  EN V
Sbjct: 179 FLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGV 238

Query: 239 DGSSSSTPIPEGVEDKK--PQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRL 296
             +   + + E    KK    +ELEDLKFHQCVRLSKFENEK ITFIPPDG+F+LM+YRL
Sbjct: 239 PIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRL 298

Query: 297 TTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSH 356
           +T IKPLIWCDVNI+ HSKSRIEI CRAKAQIKKKS A NVEILIPVP+DADTP F+YSH
Sbjct: 299 STAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSH 358

Query: 357 GSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVD-GVEPPKVRRPVQVKFQIPYFTT 415
           GSIK++PEKNAILWK+R+F G KEYSM+A++ LPS + G E  K++RPVQVKFQIPYFTT
Sbjct: 359 GSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTT 418

Query: 416 SGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRLN 453
           SGIQVRYLK+ E  LQYKSYPWVRYIT+SG+DYTIRL+
Sbjct: 419 SGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  220 bits (561), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 149/475 (31%), Positives = 244/475 (51%), Gaps = 36/475 (7%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M+S ++     G  I+++  +D+I +   + F    +Q+     V  P +      +  I
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120
           + +    +   +   T+ A I+ FL+   ++LE Y  I  E+S++ +F++ YE+LD ++D
Sbjct: 58  RSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVLD 116

Query: 121 FGIPQITETKMLKKYITQXXXXXXXXXXXXXXXN-------AARPPAELTNSVS------ 167
            GIP+ TE   +  YI++                        AR  +     ++      
Sbjct: 117 NGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMCL 176

Query: 168 WRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRG 227
           WR EGI YKKNE +LD+ E I++LV + G +L+S + G+V+  + LSGMP  + G ND  
Sbjct: 177 WRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYL 236

Query: 228 IFSNYLEENNVDGSSSSTPIPEGVEDK-KPQIELEDLKFHQCVRLSKFENEKIITFIPPD 286
             S+  + +  DG +      + +++     + LED KFHQCV+L KF+ E++I F+PPD
Sbjct: 237 SPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPD 296

Query: 287 GEFDLMNYR----LTTPIK--PLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEIL 340
           G F+LM Y     L  P K  P++       +  KS +E     K+    K  A +VE+ 
Sbjct: 297 GLFELMKYHVRDNLNLPFKVTPMV-----TTLKGKS-VEYRITLKSLFPSKLCAKDVELY 350

Query: 341 IPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKV 400
           IP P D    +   S G  K++PE+NAI+WK+  + G  E   SA + +P  +G +   +
Sbjct: 351 IPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVI-VPMGNGNDSLNL 409

Query: 401 ----RRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451
               R P+ V+F+I  F+ SG+ VRYLKV E  L Y +  WV+YI++SG  Y +R
Sbjct: 410 EQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSGA-YEVR 463

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  200 bits (509), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 150/528 (28%), Positives = 239/528 (45%), Gaps = 105/528 (19%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQL--LLQLEEETGVIPPCIMHKGIHYL 58
           M S IY  D   +P++ + ++      AI N  +   L Q       + P   +KGIH++
Sbjct: 1   MSSCIYILDETLQPLIYKNFK------AISNGEESIELFQQAHSKHPMVPVFHYKGIHFV 54

Query: 59  FIKHSDIYVV--------ALTTSYQTNVAQIFMFLHQLVEVLEEYV--KIVVEESVRDNF 108
           +I+    Y +        A       NV  I  +L     +L+ Y   + +    + DNF
Sbjct: 55  YIRRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNF 114

Query: 109 VIIYELLDEMMDFGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARP---------- 158
            +IYELLDE +DFG+PQ+T+  +++ YI                 +              
Sbjct: 115 HLIYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESY 174

Query: 159 -----PAELTNSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIV-GAVRVRSR 212
                    T+++SWRP+GI Y KNE FLD+IE I   +      +R   V G +R RS 
Sbjct: 175 MNSFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSY 234

Query: 213 LSGMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLS 272
           LSGMP LK+G++                 +SS P       K+ +  + + KFHQCV L 
Sbjct: 235 LSGMPKLKIGLS---------------KITSSLP-------KEREQFMNNAKFHQCVSLE 272

Query: 273 KFENEKIITFIPPDGEFDLMNYRLTT-----PIKPLIWCDVNIQVHSKSRIEIHCRAKAQ 327
             + + I++FIPPDGEF L  Y+L       P+  L+  DV  +   + +I I       
Sbjct: 273 DLQ-KNIVSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKKRPKILISLTITTD 331

Query: 328 IKKKSIANNVEILIPVP--------DDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGK 379
            K ++  + + I IP+         D A  P+F+   G++ +    + +LW++ S  GG 
Sbjct: 332 FKSQNSTSVLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDDLLLWEVGSIKGGH 391

Query: 380 ---EYSMSAQLHLPS-----------VDGVEPPKVR---------------------RPV 404
              E+SM  +  L              + ++PP +R                     R V
Sbjct: 392 AQTEHSMYCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENENTNRSRLV 451

Query: 405 QVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452
            ++F+IPY+T SG++V+YLK+ E +LQY S+PWVRY T + E+Y  ++
Sbjct: 452 SMEFEIPYYTCSGLKVQYLKIEEDQLQYHSFPWVRYKTVNDEEYAYQI 499

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  198 bits (503), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 143/479 (29%), Positives = 243/479 (50%), Gaps = 41/479 (8%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M++ ++     G+ ++++  +  +  +  + F    +Q+     V  P +      +  I
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57

Query: 61  KHS-DIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMM 119
           K + ++++VA++ S   + A I+ FL++L E+LE +  +  E  +++ F+I YELLD ++
Sbjct: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIVL 115

Query: 120 DFGIPQITE-----TKMLKKYITQXXXXXXXXXXXXXXXN---------AARPPA----- 160
           + G+P  TE     +KM  K                   N           RP A     
Sbjct: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175

Query: 161 ---ELTNSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMP 217
              E  +++ WR  GI YKKNE FL++ E I++LV++ G +L+S + G V   + LSGMP
Sbjct: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 218 DLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENE 277
             + G+ND    S    +++    ++   IP+        + LED KFHQCV+L KF++E
Sbjct: 236 VCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAG---SVMLEDCKFHQCVQLDKFQSE 292

Query: 278 KIITFIPPDGEFDLMNYRLTTPIK-PLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANN 336
           + I FI PDG F+LM Y +   +  P     +   V S S I+     K+    K  A +
Sbjct: 293 RTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQITIKSLFPSKLTAKD 351

Query: 337 VEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGV- 395
           V++ IPVP +  +     S+G  K++PE++AI+WK   + G  E S+SA   +P  D   
Sbjct: 352 VQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISAT-AVPMKDSTL 410

Query: 396 ---EPPKVRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451
              + P  R P+ +KF+I  F+ SG+ VR+  V+E    YK   W++Y+++SG  Y +R
Sbjct: 411 NIEQWP--RPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSGA-YEVR 466

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  197 bits (500), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 136/479 (28%), Positives = 236/479 (49%), Gaps = 42/479 (8%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M+S ++     G+ ++++  R  +  +  + F    +Q+     V  P +      +  +
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFR---IQVINNLDVRSPVLTLGSTTFHHV 57

Query: 61  KH-SDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMM 119
           K   ++++VA++ S   + A I+ FL++L  +LE +  +  E  ++++F+  YELLD ++
Sbjct: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAF-GLHSENELKEDFMTCYELLDIVL 115

Query: 120 DFGIPQITE-----TKMLKKYITQXXXXXXXXXXXXXXXNAARPPAELT----------- 163
           + G+P  TE     +KM  K                   N   P A+             
Sbjct: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLHD 175

Query: 164 ------NSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMP 217
                 +++ WR  GI YKKNE FL++ E I++LV++ G +L+S + G V   + LSGMP
Sbjct: 176 SHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 218 DLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENE 277
             + G+ND    S    +N    +++   IP+        + LED KFHQCV+L KF++E
Sbjct: 236 VCRFGLNDSLSVSTPFGDNE-SPTTNKKAIPKAAAG---SVMLEDCKFHQCVQLDKFQSE 291

Query: 278 KIITFIPPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNV 337
           + I FIPPDG F+LM Y +   +         + +   + I+     K+    K  A +V
Sbjct: 292 RTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKDV 351

Query: 338 EILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQL-----HLPSV 392
           ++ IPVP +        S+G  K++PE++AI+WK   + G  E S+SA          ++
Sbjct: 352 QLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDSALNI 411

Query: 393 DGVEPPKVRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451
           D    P    P+ +KF+I  F+ SG+ VR+  V+E    YK   W++Y+++SG  Y +R
Sbjct: 412 DQWSKP----PMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSGA-YEVR 465

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  195 bits (495), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 148/500 (29%), Positives = 243/500 (48%), Gaps = 68/500 (13%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M++ ++     G+ ++++  RD I  +  + F    +Q+     V  P +      +  I
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57

Query: 61  KHS-DIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMM 119
           + S ++++VA+T S   + A I+ FL++   +LE Y  +  EES+++ F+  YELLD ++
Sbjct: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115

Query: 120 DFGIPQITE-----TKMLKKYITQXXXXXXXXXXXXXXXN----AARPPAELTNSVS--- 167
           + G+P  TE     +KM ++ +                        R P  L        
Sbjct: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSS 175

Query: 168 ------------------WRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRV 209
                             WR  GI YKKNE FLD+ E IN+LV++ G +L+S + G+V +
Sbjct: 176 SVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235

Query: 210 RSRLSGMPDLKLGINDR-----GIFS---NYLEENNVDGSSSSTPIPEGVEDKKPQIELE 261
            + LSG P  + G+ND      G  S   +++ E  V    +   IP+        ++LE
Sbjct: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKA---IPKAAAG---SVQLE 289

Query: 262 DLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYR----LTTPIK--PLIWCDVNIQVHSK 315
           D KFHQCV+L++F  ++II F+PPDG F+LM Y     L  P K  P+     N      
Sbjct: 290 DCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSN-----N 344

Query: 316 SRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSF 375
             +E     K+    K  A +V + IPVP      +   S+G  +++PE+NA+LWK   +
Sbjct: 345 GAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKY 404

Query: 376 AGGKEYSMSAQLHLPSVDGVEPPKV----RRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQ 431
            G  E ++SA L +P +D      +    R P+ + F+I  F+ SG+ VR+ KV+E    
Sbjct: 405 QGLTENTLSA-LTVP-MDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHS 462

Query: 432 YKSYPWVRYITQSGEDYTIR 451
           Y +  WV+YI++SG  Y +R
Sbjct: 463 YHTVKWVKYISRSGA-YEVR 481

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  192 bits (487), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 145/541 (26%), Positives = 248/541 (45%), Gaps = 125/541 (23%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S I+  D    P++ + ++   S+   + F+    ++ + + V  P I HKGI ++ I
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFK---SVQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  KHSDIYVVALTT-SYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVR--DNFVIIYELLDE 117
               +Y V+++  S ++++    ++L+    +L++Y+++   +  R  DNF +IYELLDE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 118 MMDFGIPQITETKMLKKYI---------------------TQXXXXXXXXXXXXXXXNAA 156
            +DFGIPQ+T+  +++  I                     ++               +  
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 157 RPPAELTNS---------VSWRPEGITYKKNEAFLDIIESINMLVT-QQGQVLRSEIVGA 206
           +   E  NS         +SWRP+GI Y KNE F+D+IES   ++  +  QV ++ I G 
Sbjct: 176 QDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGR 235

Query: 207 VRVRSRLSGMPDLKLGIN----DRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELED 262
           +  RS LSGMP +K+ IN    DR  F                              L  
Sbjct: 236 IICRSYLSGMPVVKICINKMLKDRDQF------------------------------LSS 265

Query: 263 LKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLT-----TPIKPLIWCDVNIQVHSKSR 317
            KFHQCV L    ++  I FIPPDG+F L  Y++      +P+  LI   V ++   K +
Sbjct: 266 AKFHQCVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKV-VEKPKKHK 324

Query: 318 IEIHCRAKAQIKKKSIANNVEILIPVPDDADT--------PQFRYSHGSIKWLPEKNAIL 369
           ++I  + +   K ++ A  ++I +P+ D  +T        P+F+   GSI +      +L
Sbjct: 325 LQISMKIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLL 384

Query: 370 WKLRSFAGGKE---YSMSAQLHLPSVDG-----------VEPPKVRRPVQV--------- 406
           WK     GG     +SM  +  L   +            ++PP +R  V++         
Sbjct: 385 WKANGMKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHE 444

Query: 407 ---------------KFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451
                          +F++PYFT+SG++V YLK+ E +LQY+S+PWVRY T +  +Y  +
Sbjct: 445 EKGQINNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRYKTINDTEYAFQ 504

Query: 452 L 452
           +
Sbjct: 505 M 505

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  191 bits (485), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 138/488 (28%), Positives = 243/488 (49%), Gaps = 51/488 (10%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M+S +    + G+ I+++ +++++  +  D F    +Q+     V  P +      +  I
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFR---IQVINNLDVRSPILTLGSTTFQHI 57

Query: 61  KHS----DIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLD 116
           + +    D+++V++T S   N   ++ FL++   +LE Y  +  EE +++ F++ YELLD
Sbjct: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELLD 115

Query: 117 EMM-DFGIPQITE--TKMLKKYITQXXXXXXXXXXXXXXXNAARPP-------------A 160
            M+ + G P  T+  T + K  +                 N+  P               
Sbjct: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175

Query: 161 ELTNSVS----------WRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVR 210
           E +N+ S          WRP+GI++KKNE FL + E I++LV+++G +L+S + G + + 
Sbjct: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235

Query: 211 SRLSGMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVR 270
           + LSG P  + G+ND     N    ++ D   +   IP+        + LED KFHQCV 
Sbjct: 236 THLSGTPVCQFGLNDSLSVKNDDYGDSFDYIKNKKAIPKAAAG---SVLLEDCKFHQCVS 292

Query: 271 LSKFENEKIITFIPPDGEFDLMNYRLTTPIK-PLIWCDVNIQVHSKSRIEIHCRAKAQIK 329
           L KF+ ++II F+PPDG  +LM Y + + I  P     +     S + +E     K+   
Sbjct: 293 LEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFP 352

Query: 330 KKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHL 389
            K  A NV + IPVP +    +   S+GS K+ PE+ A+LW    + G  E ++SA    
Sbjct: 353 SKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAV--- 409

Query: 390 PSVDGVEPPKV------RRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQ 443
            ++   + P++      + P+ + F+I  F+ SG+ VRY  + E + +YK+  W+RY+++
Sbjct: 410 -TITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSK 467

Query: 444 SGEDYTIR 451
           SG  Y IR
Sbjct: 468 SGS-YEIR 474

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  189 bits (481), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 144/496 (29%), Positives = 253/496 (51%), Gaps = 60/496 (12%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFS-QLLLQLEEETGVIPPCIMHKGIHYLF 59
           M+S I    + G+ I+A+  +  +  +  D F  Q++  L+  + ++   +     H++ 
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPIL--TLGSTTFHHIR 58

Query: 60  IKHSD-IYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEM 118
              SD +++VA++ S   N   I+ FL++L  +++ Y  +  E ++++NF+  YE+LD +
Sbjct: 59  SDGSDSLWLVAVSRS-NANSGAIWEFLYKLNVIMDVY-GLTKEGTLKENFMNCYEILDTV 116

Query: 119 MD-FGIPQITE-----TKMLKKYITQXXXXXXXX--XXXXXXXNAARP---------PAE 161
           ++  GIP  TE     +KM  K   Q                 N + P         P  
Sbjct: 117 LEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPKF 176

Query: 162 LT---------------NSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGA 206
           LT               +++SWRP GI YKKNE  L++ E I++LV++ G +L+S + G 
Sbjct: 177 LTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGT 236

Query: 207 VRVRSRLSGMPDLKLGINDRGIFSNYLEE--NNVDGSSSSTPIPEGVEDKKPQIELEDLK 264
           + + + LSGMP  + G+ND  +   + ++  + V+  ++   IP+    +   + LED K
Sbjct: 237 IDLTTHLSGMPICQFGLND-SLSVEFGDDSISEVEDFANKKAIPKAAAGR---VMLEDCK 292

Query: 265 FHQCVRLSKFENEKIITFIPPDGEFDLMNY----RLTTPIK--PLIWCDVNIQVHSKSRI 318
           FHQCV L KF  +++I F+PPDG  +LM Y     L  P K  P++       +   + I
Sbjct: 293 FHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIV-----TSIGRGNTI 347

Query: 319 EIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGG 378
           +     K+    K  A +V + IPVP      +   S+G  K++PE++A++WK   + G 
Sbjct: 348 DYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGL 407

Query: 379 KEYSMSAQLHLPSVDGVEPPKV---RRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSY 435
            E ++SA + +PS D  +       R P+ + F+I  F+ SG+ VRY KV++   +Y++ 
Sbjct: 408 TENTLSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTA 466

Query: 436 PWVRYITQSGEDYTIR 451
            W++YI++SG  Y IR
Sbjct: 467 KWIKYISKSGS-YEIR 481

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  188 bits (477), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 134/483 (27%), Positives = 232/483 (48%), Gaps = 41/483 (8%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIM--HKGIHYL 58
           M+S I+  +  G  ++++  +D +  +  D F     Q+  +  V  P +        ++
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRT---QVINDPHVRSPILTLGSTTFQHV 57

Query: 59  FIKHSD---IYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELL 115
             + SD   +++VA++ S   + + I+ +LH+L +++E +  I  E+ ++D F+++YE+L
Sbjct: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEIL 115

Query: 116 DEMMDFGIPQITETKMLKKYITQXXXXXXXXXXX------XXXXNAARPP---------- 159
           +  ++ GIPQ T+   +   +++                     N  + P          
Sbjct: 116 ELTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSSSI 175

Query: 160 -AELTNSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPD 218
                +   WRP G+ YKKNE +LDI E I +LV + G +++S + G+V   S LSGMP 
Sbjct: 176 ALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPL 235

Query: 219 LKLGINDR-GIFSNYLEENNVDGSSS------STPIPEGVEDKKPQIELEDLKFHQCVRL 271
            +LG+ND   I  N   E ++    S         IP         + LED KFHQCV+L
Sbjct: 236 CQLGLNDTYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAG---SVILEDCKFHQCVQL 292

Query: 272 SKFENEKIITFIPPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKK 331
           +K+E   +I F+PPDG F LM YR+   I         +++   S +      ++     
Sbjct: 293 NKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSN 352

Query: 332 SIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPS 391
             A +V + IPVP       F  S G  K+   +  ++WK   + G  E ++S ++ +P+
Sbjct: 353 VSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPA 412

Query: 392 VDGVEPPKVRR---PVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDY 448
                   +R    P+ + F+I  F+ SG+ VR+LK  EP+L Y+   W++YI+ SG  Y
Sbjct: 413 TSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSGA-Y 471

Query: 449 TIR 451
            IR
Sbjct: 472 EIR 474

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  187 bits (476), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 142/498 (28%), Positives = 246/498 (49%), Gaps = 58/498 (11%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M++GI      G+ I+++ ++  +  +  D F    +Q+     V  P +      +  I
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  KHS----DIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLD 116
           + S    ++++VA T +   N A I+ FL++L  +L EY  +  EE +++ F+I++ELLD
Sbjct: 58  RSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLD 115

Query: 117 EMM-DFGIPQITE-TKMLKKYITQXXXXXXXXXXXXXXXN-AARPPAELT---------- 163
            M+   GIP  TE +K++ K   +               +  ++   E++          
Sbjct: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDS 175

Query: 164 ----------NSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRL 213
                     N  SWRP+ I +KKNE  L + E IN+LV + G +L++ + G++ +++RL
Sbjct: 176 SQSHDSNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235

Query: 214 SGMPDLKLGINDRGIF----SNYLEENNVDGSSSSTPIPEGVEDK------KPQIELEDL 263
           SG P  + G+ND        S Y   N   G++ S+ +   + +K         + LED 
Sbjct: 236 SGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC 295

Query: 264 KFHQCVRLSKFENEKIITFIPPDGEFDLMNYR----LTTPIK--PLIWCDVNIQVHSKSR 317
           KFHQCV L KF+ E+II F+PPDG  +LM Y     L  P K  P++   V     +   
Sbjct: 296 KFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSV-----TGDA 350

Query: 318 IEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAG 377
           ++     K+    +  A  V + IPVP          S+G+ K++P +NA++WK   + G
Sbjct: 351 LDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNG 410

Query: 378 GKEYSMSAQLHLPSVDGVEPPK---VRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKS 434
             E ++SA + +PS +  +       R P+ + F+I  F+ SG+ VRY  ++E    YK+
Sbjct: 411 LTENTLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKA 469

Query: 435 YPWVRYITQSGEDYTIRL 452
             W++Y+++SG  Y +R 
Sbjct: 470 VKWIKYVSKSGS-YEVRF 486

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  187 bits (475), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 138/499 (27%), Positives = 246/499 (49%), Gaps = 57/499 (11%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M++ +      G+ ++++ ++  +  +  D F    +Q+     V  P +      +  I
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  KHS---DIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDE 117
           K +   ++++VA++ +   + A I+ FL++L  +L+ Y  +  EE +++ F+I++ELLD 
Sbjct: 58  KSTRGDNLWIVAVSRN-NVDSAAIWEFLYKLDSLLDSY-GLNHEEYLKEEFMIVHELLDV 115

Query: 118 MM--DFGIPQITETKML--------KKYITQXXXXXXXXXXXXXXXNAARPP-------- 159
           MM    GIP +TE  ++         K I +               N    P        
Sbjct: 116 MMCGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPK 175

Query: 160 ------AELTNSVS------WRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAV 207
                 A L+  +S      WRP+GI +KKNE  L + E IN+LV++ G VL++ + G++
Sbjct: 176 LLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSI 235

Query: 208 RVRSRLSGMPDLKLGIND----RGIFSNYLEENNVDGSSSSTPIPEGVEDKK-------P 256
            + + LSG P  + G+ND     G+ S+    +N +         +   DKK        
Sbjct: 236 DLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDK--TDKKQLSMASVG 293

Query: 257 QIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPIK-PLIWCDVNIQVHSK 315
            + LED KFHQCV L KF+ ++II F+PPDG  +LM Y +   +  P     +     + 
Sbjct: 294 SVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTNTRNG 353

Query: 316 SRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSF 375
           + +E     K+    +  A NV + IPVP +    +   ++GS K++PE++A++W+   F
Sbjct: 354 TALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRFNKF 413

Query: 376 AGGKEYSMSAQLHLPSVDGVEPPK---VRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQY 432
            G  E ++SA + +P+ D  +       + P+ + F+I  F+ SG+ VRY  + E   +Y
Sbjct: 414 NGLTENTLSA-VTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITERDQKY 472

Query: 433 KSYPWVRYITQSGEDYTIR 451
           K+  W++YI++SG  Y IR
Sbjct: 473 KAVKWIKYISRSGS-YEIR 490

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  187 bits (474), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 129/416 (31%), Positives = 210/416 (50%), Gaps = 32/416 (7%)

Query: 24  ISINAIDNFSQLL-LQLEEETGVIPPCIMHKGIHYLFIKHSDIYVVALTTSYQTNVAQIF 82
           IS  A ++ S++  LQ+     +  P +      +  I+ S    + +      + A I+
Sbjct: 20  ISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAAIW 79

Query: 83  MFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFGIPQITETKMLKKYITQXXXX 142
            FL+ + ++L+ Y  I  EE++ D+F++ YELLD ++D G+PQ TE   +   +++    
Sbjct: 80  EFLYHMNKLLDAYA-INTEEALLDDFMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPAT 138

Query: 143 XXXXXXXXXXXNAARPPAELTNSVS-------------WRPEGITYKKNEAFLDIIESIN 189
                      N+AR     T +VS             WR EGI YKKNE +LD+IE ++
Sbjct: 139 GESASGDDFL-NSARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLS 197

Query: 190 MLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPE 249
           +LV + G +L++ + G V+  + LSGMP    G ND    S  L + +        P   
Sbjct: 198 LLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFND----SQSLRQRS--PRRQYAPRVF 251

Query: 250 GVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPIKPLIWCDVN 309
           G  D++  + LED KFHQCV+L+KF+ E++I F+PPDGEF+LM Y +   ++P       
Sbjct: 252 GT-DERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPV 310

Query: 310 IQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAIL 369
           +   ++  IE     ++    K  A +VE+ IP P    + +   S G  K++PE+NAI+
Sbjct: 311 VSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAII 370

Query: 370 WKLRSFAGGKEYSMSA------QLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQ 419
           WK+  F G  E ++SA      Q H   V    P   R P+ +K +I  F+T+ + 
Sbjct: 371 WKIHKFHGLTENTLSAVTIADEQGHYAQVLDQWP---RPPISMKLEIMMFSTAALS 423

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  182 bits (463), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 124/472 (26%), Positives = 219/472 (46%), Gaps = 105/472 (22%)

Query: 48  PCIMHKGIHYLFIKHSDIYVVALTTSYQTNV-AQIFMFLHQLVEVLEEYV-KIVVEESVR 105
           P + H+G  Y++I+   +Y ++L+   +T V   +F +L QL ++ ++Y+ + +  + + 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNFVIIYELLDEMMDFGIPQITETKMLKKYI-TQXXXXXXXXXXXXXXXNAARPPA---- 160
           DNF ++YEL+DE +D GIPQ+T+  +++ Y+  Q                A R  A    
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 161 -------------------ELTNSVSWRPEGITYKKNEAFLDIIESINMLVT-QQGQVLR 200
                                T+++SWRP GI Y KNE FLD++E +  L+  ++ QV  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 201 SEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIEL 260
           +++ GA+  RS LSGMP L +G+N        +   + D +S                  
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLNK-------MVAQDRDFTSQ----------------- 256

Query: 261 EDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLT-----TPIKPLIWCDVNIQVHSK 315
             + FHQCV L +   ++ ITF+PPDGEF L +Y+L       P+  L  C   ++   +
Sbjct: 257 --VHFHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLIKLEECRAAVKPRRR 314

Query: 316 ----SRIEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPQFRYSHGSIKWLP 363
                R+ +        K +   + +++ +P+         D +  P+F+   G + +  
Sbjct: 315 PADADRLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPRFKCDAGCVMFNI 374

Query: 364 EKNAILW---KLRSFAGGKEYSMSAQLH--------------------LPSVDGVE---- 396
             + +LW   K +   G + ++M +Q H                    LP+  G +    
Sbjct: 375 TDDYLLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQLEAL 434

Query: 397 --------PPKVRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRY 440
                   P      ++V F++PY T SG++V +LK+ EP+LQY+S+PW+RY
Sbjct: 435 YNQTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRY 486

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  181 bits (460), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 139/479 (29%), Positives = 238/479 (49%), Gaps = 39/479 (8%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFS-QLLLQLEEETGVIPPCIMHKGIHYLF 59
           M++G+      G+ I+++  + +   +  D F  Q++  L+  + ++   +     H++ 
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPIL--TLGSTTFHHIR 58

Query: 60  IKHSD-IYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEM 118
               D +++VA+T S   N   I+ FL++   +L  +  +  E ++++ F+  YELLD M
Sbjct: 59  SNSRDHLWLVAVTRS-NANSGAIWEFLYKFDSLLNAF-GLDNETTLKEEFMTCYELLDLM 116

Query: 119 MDF-GIPQITE-----TKMLKKYI---------TQXXXXXXXXXXXXXXXNAARPPAELT 163
           ++  G+P  TE      KM  K +         +                N      +  
Sbjct: 117 LNVDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDTM 176

Query: 164 NS----VSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDL 219
           N+      WRP GI YKKNE FL+I E I++LV++   +L++ + G V + S LSG P  
Sbjct: 177 NTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTPTC 236

Query: 220 KLGINDRGIFS--NYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENE 277
           + G+ND       NY   ++ +G  +   IP         + LED KFH+CV L KF  +
Sbjct: 237 QFGLNDSLSVDEPNYYNSDD-NGFRNQQNIPRATAG---TVVLEDCKFHECVSLDKFNRD 292

Query: 278 KIITFIPPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCR--AKAQIKKKSIAN 335
           +II F+PPDG  +LM Y +   I        N+ ++S+SR  +  R   K+    K  AN
Sbjct: 293 RIIKFVPPDGHIELMKYHVRDNINLPFKVTPNV-INSRSRTGLDYRITLKSLFPSKLSAN 351

Query: 336 NVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGV 395
           +V + IPVP      +   S+G  +++PE++ I+WK   + G  E  +SA + + S D  
Sbjct: 352 DVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSA-VTVSSNDTT 410

Query: 396 E---PPKVRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451
           +       R P+ + F+I  F+ SG+ VRYLK+ E   +Y++  W++YI++SG  Y +R
Sbjct: 411 QLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSGS-YEVR 468

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  180 bits (456), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 134/493 (27%), Positives = 231/493 (46%), Gaps = 60/493 (12%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFS-QLLLQLEEETGVIPPCIMHKGIHYLF 59
           M++ I+     G+ I+++ + + +  +  D F  Q++  L+  + ++   +     H++ 
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPIL--TLGSTTFHHIR 58

Query: 60  IKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMM 119
              SD   +   +    N   I+ FL++   +L+ Y  +  EE ++++F+I YE+LD ++
Sbjct: 59  SNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDVVI 117

Query: 120 DFG-IPQITETKMLKKYITQXXXXXXXXXXXXXXXNAAR-PPAELTNS------------ 165
             G IP  TE   +   I+                  A  P + L+ S            
Sbjct: 118 GAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTRNN 177

Query: 166 --------------VSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRS 211
                           WRP GI YKKNE FL + E IN+LV++ G +L++ + G + + +
Sbjct: 178 RSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTT 237

Query: 212 RLSGMPDLKLGINDRGIF----SNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQ 267
            LSG P  + G+ND        S +L+        +   +P+        + LED KFHQ
Sbjct: 238 HLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKA---VPKAAAG---SVMLEDCKFHQ 291

Query: 268 CVRLSKFENEKIITFIPPDGEFDLMNY----RLTTPIK--PLIWCDVNIQVHSKSRIEIH 321
           CV L KF  E+II F+PPDG  +LM Y     L  P K  P++           S +E  
Sbjct: 292 CVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTVEYR 344

Query: 322 CRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEY 381
              K+    K  A +V + IPVP      +   S+G  K+  E+NA++W+   + G  E 
Sbjct: 345 ITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTEN 404

Query: 382 SMSAQLHLPSVDGVE---PPKVRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWV 438
           ++SA + +P+ D  +       R P+ + F+I  F+ SG+ VRY +V++   +Y+   W+
Sbjct: 405 TLSA-VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWI 463

Query: 439 RYITQSGEDYTIR 451
           +YI++SG  Y +R
Sbjct: 464 KYISKSGS-YEVR 475

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  176 bits (446), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 135/493 (27%), Positives = 217/493 (44%), Gaps = 119/493 (24%)

Query: 48  PCIMHKGIHYLFIKHSDIYVVALTTS-YQTNVAQIFMFLHQLVEVLEEYVKI--VVEESV 104
           P I  KGI Y++I    +Y V+++    + N+  I  +L+    +L +Y+K+  V    +
Sbjct: 43  PVIYSKGIIYIYILRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGI 102

Query: 105 RDNFVIIYELLDEMMDFGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAEL-- 162
            DNF +IYEL DE +D+GIPQ+T+  +++  I                 +    P  L  
Sbjct: 103 IDNFNLIYELFDESLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQS 162

Query: 163 ---------------------------TNSVSWRPEGITYKKNEAFLDIIESINMLVT-Q 194
                                      T ++SWRP+GI Y KNE F+DIIE  + L+  +
Sbjct: 163 KENKDKADIHGFRDDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFK 222

Query: 195 QGQVLRSEIVGAVRVRSRLSGMPDLKLGIN----DRGIFSNYLEENNVDGSSSSTPIPEG 250
             QV ++ + G +  RS LSGMP +++ IN    D+ +F          GSS        
Sbjct: 223 NSQVRQTFVYGKINCRSYLSGMPIVRVCINKMLKDKDLFL---------GSS-------- 265

Query: 251 VEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLT-----TPIKPLIW 305
                        KFHQCV L    ++  I FIPPDG+F L  Y+L      +PI  LI 
Sbjct: 266 -------------KFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLID 312

Query: 306 CDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPQFRYSHG 357
             +N +   K R+ +    +   K ++ A  ++I IP          D    P+F+  HG
Sbjct: 313 YKIN-ERQKKHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHG 371

Query: 358 SIKWLPEKNAILWKLRSFAGGK---EYSMSAQLHLPSVD-----------GVEPPKVRR- 402
           S+ +      +LW  +   GG     YSM  +  L   +            ++PP +R  
Sbjct: 372 SVFFNLSDELLLWDAQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREG 431

Query: 403 -----------------------PVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVR 439
                                   +  +F++PY+T+SG++V YLK++E  L+Y+S+ WVR
Sbjct: 432 AHLEELYAQVKSNKEGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVR 491

Query: 440 YITQSGEDYTIRL 452
           Y T +  +Y  ++
Sbjct: 492 YKTINDTEYAYQV 504

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  174 bits (441), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 130/490 (26%), Positives = 229/490 (46%), Gaps = 49/490 (10%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M++ +      G+ ++ + ++  +     D F    +Q+     +  P +      + FI
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFR---VQVINNDNIRSPILTLGSTTFHFI 57

Query: 61  K---HSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDE 117
           +    S +++VA+T S   +   I+ +L++L  ++E Y  +  E+ ++D F++ +ELLD 
Sbjct: 58  RTTAGSKLWLVAVTRS-NADSGAIWEYLYKLNSLMEVY-GLTHEDILKDEFIVCHELLDI 115

Query: 118 MMDF-GIPQITE-----TKMLKK---YITQXXXXXXXXXXXXXXXNAARPPAELT----- 163
            +   G+P  TE      KM  K    +T                     P  +      
Sbjct: 116 TLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSR 175

Query: 164 ----------------NSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAV 207
                           +++ WR   I YKKNE  +++IE IN+LV +   +LR+ + G +
Sbjct: 176 NSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTI 235

Query: 208 RVRSRLSGMPDLKLGINDRGIFSN--YLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKF 265
            + + LSGMP  ++G+ND             N D +S+   +P+   D+   + LE  KF
Sbjct: 236 DITAHLSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNRDAMPDVSGDR---VILEGSKF 292

Query: 266 HQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPIK-PL-IWCDVNIQVHSKSRIEIHCR 323
           HQCV L K+  + +I FIPPDG+F+LM Y ++  +  P  I   V +  H  + +    +
Sbjct: 293 HQCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTA-LSYAIK 351

Query: 324 AKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSM 383
            K+   +K  A NV + IPVP      +   S G  K++PE+N ++W    F G  E  +
Sbjct: 352 LKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHL 411

Query: 384 SAQLHLPSVDGVEPPK--VRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYI 441
           +AQ         +  K   R P+ + F++  F+ +G+ VRYLKV E  + Y +  W++YI
Sbjct: 412 NAQTVPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWIKYI 471

Query: 442 TQSGEDYTIR 451
           + +G  Y +R
Sbjct: 472 SAAGS-YEVR 480

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  172 bits (436), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 140/539 (25%), Positives = 234/539 (43%), Gaps = 129/539 (23%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDN-FSQLLLQLEEETGVIPPCIMHKGIHYLF 59
           M S     D   +P++ R  R    I+ +D+   QL   L+   G   P     G HY  
Sbjct: 1   MSSCFLLLDETYEPLIRRALR---PIHFLDDAILQLQNNLKHHKGCTKPIFEGNGWHYAV 57

Query: 60  IKHSDIYVVALTTSYQTNVA--QIFMFLHQLVEVLEEYVKIVVEE-SVRDNFVIIYELLD 116
           I   ++Y  A+      +V+   +  +L ++ ++  +++ + + + +VRDNF +I+E+++
Sbjct: 58  ITRDNLYF-AMIMQVNNSVSPISVLHYLDEIYQLCRKFMGMKLNKLNVRDNFHLIFEVIE 116

Query: 117 EMMDFGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAE-------------LT 163
           E  D+GI Q+T   ++  +I                     PP +             +T
Sbjct: 117 ESSDYGIIQVTNYNIIHDFIKVEVIKPDDDSENTASEKHELPPGDQDETFINSYILRTMT 176

Query: 164 NSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIV-GAVRVRSRLSGMPDLKLG 222
           ++VSWRP+GI Y KNE FLD+IE +  ++  +  V+R+ ++ G +  RS LSGMP L +G
Sbjct: 177 SAVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIG 236

Query: 223 INDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKF--ENEKII 280
           +N        L + NV                     ++ LKFH+CV L     E   +I
Sbjct: 237 LNK-------LMQKNVHF-------------------MKRLKFHECVDLHTLIKEESPVI 270

Query: 281 TFIPPDGEFDLMNYRLTTPI---------------KPLIWCDVNIQVHSKSRIEIHCRAK 325
            FIPPDGEF+L NY+L  P+               KP    +   ++  K+ I  H +A+
Sbjct: 271 KFIPPDGEFELCNYKLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLLKAAITTHFKAQ 330

Query: 326 AQIKKKSIANNVEILIPVP----------DDADTPQFRYSHGSIKWLPEKNAILWKLRSF 375
              K        E+LI +P          D    P F+   G + +     +I+WK+ + 
Sbjct: 331 DSAK--------ELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKINNL 382

Query: 376 AGG---KEYSMSA-------QLH----LPSVDGVEPPKVRRP------------------ 403
            GG   K Y +         Q+H    +   + ++PP +R                    
Sbjct: 383 KGGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTTEYD 442

Query: 404 --------------VQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDY 448
                         + + F+IPY+  SG++V Y K+ EP+L Y+S+PWVRY T +  +Y
Sbjct: 443 GNENQKEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRYKTVNDNEY 501

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  162 bits (411), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 130/489 (26%), Positives = 219/489 (44%), Gaps = 112/489 (22%)

Query: 48  PCIMHKGIHYLFIKHSDIYVVALTTSYQ-TNV--AQIFMFLHQLVEVLEEYVKIVVEES- 103
           P + +    Y+FI+   +Y ++L  SYQ TNV    +F +L+QL  + ++Y+   + +  
Sbjct: 41  PILQNMDYDYIFIQRDGLYFLSL--SYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVL 98

Query: 104 VRDNFVIIYELLDEMMDFGIPQITETKMLKKYI------------TQXXXXXXXXXXXXX 151
           +  NF +I+EL+DE +  G PQ+T+  +++ YI            T+             
Sbjct: 99  ITGNFHLIHELIDESIFMGTPQLTDYNIIRDYIKVQVVKDSPEPATREATVTNTKKNKKK 158

Query: 152 XXNAARPPAELTN--------------SVSWRPEGITYKKNEAFLDIIESINMLVTQQGQ 197
                    E T+              ++SWRP+GI Y KNE +LD+IE +  LV  Q  
Sbjct: 159 DSKKKEEDTEATDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCM 218

Query: 198 VLRSEIV-GAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKP 256
            ++S  V G ++ RS LSGMP L +G+N     + Y                        
Sbjct: 219 NIKSNTVYGYIQCRSYLSGMPMLTIGLNKLNSENEYF----------------------- 255

Query: 257 QIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTT-----PIKPLIWCDVNIQ 311
              +    FHQCV L +   +K+I+F PPDGEF L NY+LT      P+  L  C V ++
Sbjct: 256 ---MRRANFHQCVNLDQLTTDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLK 312

Query: 312 VHSK----SRIEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPQFRYSHGSI 359
                    R+ +        K +   + + I +P+         D +  P+F+   G +
Sbjct: 313 PRKTKDGLDRLILAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKV 372

Query: 360 KWLPEKNAILWKLRSFAGG---KEYSMSAQLHLPS-----------VDGVEPPKVRRP-- 403
            +    + +LW++    GG   K   M ++ HL +            + ++P  +RR   
Sbjct: 373 MFNITDDYLLWEVGKVKGGHGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPH 432

Query: 404 --------------------VQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQ 443
                               ++V+F+IPY+T SG++V +LK+ E +LQ++S+PWVRY T 
Sbjct: 433 LEKLYQQTHELNSPTSEAALLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRYKTI 492

Query: 444 SGEDYTIRL 452
           + + Y  +L
Sbjct: 493 NHDIYAYQL 501

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  161 bits (407), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/301 (32%), Positives = 167/301 (55%), Gaps = 19/301 (6%)

Query: 164 NSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGI 223
           N ++WRP+GI +KK+E FL + E +N+LV++ G +L+S + G + + + LSG P  + G+
Sbjct: 196 NKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPVCRFGL 255

Query: 224 NDR-GIFS----NYL---EENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFE 275
           ND  G+ S    N+L   ++++ +G  +    P+        + LED KFH+CV + KF 
Sbjct: 256 NDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAAAG---SVLLEDCKFHECVSIDKFN 312

Query: 276 NEKIITFIPPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCR--AKAQIKKKSI 333
              II F+PPDG  +LM Y +   I  L +    I  HS    E+  R   K+    K  
Sbjct: 313 KNHIIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVAHSARDNEVDYRITLKSLFPGKLS 371

Query: 334 ANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVD 393
           A +V + IPVP      +   S+G+ K++PE+NA++W+   F G  E ++SA + + + D
Sbjct: 372 AKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNKFNGLTENTLSA-VTVSTSD 430

Query: 394 GVE---PPKVRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTI 450
             +       R P+ + F++  F+ SG+ VRY  ++    ++++  W++YI++SG  Y +
Sbjct: 431 TTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDSKHRAVKWIKYISKSGS-YEV 489

Query: 451 R 451
           R
Sbjct: 490 R 490

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 74/132 (56%), Gaps = 9/132 (6%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFS-QLLLQLEEETGVIP--PCIMHKGIHY 57
           M+SG+    + G+ IL + +++ +  +  D F  Q++  L+  + V+       H   H 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFH---HI 57

Query: 58  LFIKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDE 117
             ++  ++++V +T S   N A I+ FL++L  V+  Y ++  EE++++ F+I++E+LD 
Sbjct: 58  RSMRGDNLWLVTITRS-NANSAAIWEFLYKLDSVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MMDF-GIPQITE 128
           M+   GIP  TE
Sbjct: 116 MLGGNGIPIDTE 127

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  160 bits (404), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 131/492 (26%), Positives = 221/492 (44%), Gaps = 61/492 (12%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFS-QLLLQLEEETGVIP--PCIMHKGIHY 57
           M++G+    + G  I+    +  +     D F  Q++  LE ++ ++       H   H 
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKSPILTLGSTTFH---HI 57

Query: 58  LFIKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDE 117
                S +++VA+T S   N   I+ FL++L  +L  Y  +  EE + + F++ YE++D 
Sbjct: 58  RSSSESKLWIVAITRS-NANSGVIWEFLYKLDSMLTAY-DLNNEEKLMEKFMVYYEMIDV 115

Query: 118 MM-DFGIPQITETKMLKKYIT-------------QXXXXXXXXXXXXXXXNAARPPAELT 163
           M+    +P  TE   +   I+             +               N+     E +
Sbjct: 116 MLTSNAMPINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFS 175

Query: 164 N----SVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDL 219
           N     + WRP GI YKKNE FL + E IN+LV++   +L++ + G++ + S LSG P  
Sbjct: 176 NITQSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPIC 235

Query: 220 KLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKP---------QIELEDLKFHQCVR 270
           + G+ND      YL     + S+          D +           +++ED  FHQCV 
Sbjct: 236 QFGLND------YLSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIEDCTFHQCVS 289

Query: 271 LSKFENEKIITFIPPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEI---HCRAKAQ 327
           L KF +E++I F+PPDG F+LM Y +          D+NI      R+ I    C  + +
Sbjct: 290 LDKFNDERLINFVPPDGSFELMRYHVRD--------DLNIPFKVTPRVSISSSRCSMRYK 341

Query: 328 IKKKSI------ANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEY 381
           I  KS+      A +  + IP+P      +   S G   +    N  +WK   + G  E 
Sbjct: 342 IILKSLFPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTEN 401

Query: 382 SMSAQLHLPSVDGVEPPK--VRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVR 439
            +  +    S   +   +   R P+ + F+I  F+ SG+ V+YLKV E   +Y+   W++
Sbjct: 402 ELILETVPSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIK 461

Query: 440 YITQSGEDYTIR 451
           Y+++SG  Y IR
Sbjct: 462 YVSKSGS-YEIR 472

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  159 bits (402), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 137/500 (27%), Positives = 244/500 (48%), Gaps = 59/500 (11%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFS-QLLLQLEEETGVIPPCIMHKGIHYLF 59
           M+SG+    + G+ +L + +++ +  +  D F  Q++  L+  + V+   +     H++ 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IKHSD-IYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEM 118
            +H D +++V +T S   N A I+ FL++L  V+  Y ++  EE++++ F+I++E+LD M
Sbjct: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDIM 116

Query: 119 MDF-GIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAA--------------RPPAELT 163
           +   GIP  TE   +   ++                N                  P  LT
Sbjct: 117 LGGNGIPIDTELNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFPKFLT 176

Query: 164 N-SVSWRPEG-----------ITYK-------KNEAFLDIIESINMLVTQQGQVLRSEIV 204
             S S+  +G           IT++       K+E FL + E IN+LV++ G +L+S + 
Sbjct: 177 KRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYVD 236

Query: 205 GAVRVRSRLSGMPDLKLGINDR-GIFSN-----YLEENNVDGS--SSSTPIPEGVEDKKP 256
           G + + + LSG P  + G+ND  G+ S        ++    GS   +   IP+       
Sbjct: 237 GTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAAG--- 293

Query: 257 QIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKS 316
            + LED KFH+CV L KF    II F+PPDG  +LM Y +   I  L +    I  HS  
Sbjct: 294 SVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNIN-LPFKVTPIVTHSTR 352

Query: 317 RIEIHCR--AKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRS 374
             EI  R   K+    K  A +V + IPVP      +   S+G  K++PE+NA++W+   
Sbjct: 353 DNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNK 412

Query: 375 FAGGKEYSMSAQLHLPSVDGVE---PPKVRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQ 431
           + G  E ++SA + + + D  +       R P+ ++F++  F+ SG+ VRY  ++    +
Sbjct: 413 YNGLTENTLSA-VTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDSK 471

Query: 432 YKSYPWVRYITQSGEDYTIR 451
           +++  W++YI+++G  Y +R
Sbjct: 472 HRAVKWIKYISKAGS-YEVR 490

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  155 bits (391), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/300 (32%), Positives = 163/300 (54%), Gaps = 17/300 (5%)

Query: 164 NSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGI 223
           N ++WRP+GIT+KK+E FL + E +N+LV++ G +L+S + G + + + LSG P  + G+
Sbjct: 196 NKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDITTHLSGTPICRFGL 255

Query: 224 NDR-GIFS----NYL--EENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFEN 276
           ND  G+ S     +L  ++++  G+  S       +     + LED KFH+CV L KF  
Sbjct: 256 NDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIH--KAAAGSVLLEDCKFHECVSLDKFNK 313

Query: 277 EKIITFIPPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCR--AKAQIKKKSIA 334
              I F+PPDG  +LM Y +   I  L +    I  HS    EI  R   K+    K  A
Sbjct: 314 NHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHSTRDNEIDYRITLKSLFPGKLSA 372

Query: 335 NNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDG 394
            +V + IPVP      +   S+G  K++PE+NA++W+   + G  E ++SA + + + D 
Sbjct: 373 KDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENTLSA-VTVSTSDT 431

Query: 395 VE---PPKVRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451
            +       R P+ + F++  F+ SG+ VRY  +     ++++  W++YI++SG  Y +R
Sbjct: 432 TQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDSKHRAVKWIKYISRSGS-YEVR 490

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 76/131 (58%), Gaps = 7/131 (5%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFS-QLLLQLEEETGVIPPCIMHKGIHYLF 59
           M+SG+    + G+ +L + +++ +  +  D F  Q++  L+  + V+   +     H++ 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IKHSD-IYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEM 118
            +H D +++V +T S   N A I+ FL++L  V+  Y ++  EE++++ F+I++E+LD M
Sbjct: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIM 116

Query: 119 MDF-GIPQITE 128
           +   GIP  TE
Sbjct: 117 LGGNGIPIDTE 127

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  152 bits (385), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 160/299 (53%), Gaps = 13/299 (4%)

Query: 163 TNSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLG 222
           +N ++WR  GI +KK+E FL + E +N+LV++ G +L+S + G + + + L+G P  + G
Sbjct: 195 SNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTIDIVTHLNGTPVCRFG 254

Query: 223 INDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQ-----IELEDLKFHQCVRLSKFENE 277
           +ND     +  E+N +      +    G ++  P+     + LED KFH+CV + KF   
Sbjct: 255 LNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAAGSVLLEDCKFHECVSIEKFNKN 314

Query: 278 KIITFIPPDGEFDLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCR--AKAQIKKKSIAN 335
            II FIPPDG  +LM Y +   I  L +    I  HS    EI  R   K+    K  A 
Sbjct: 315 HIIEFIPPDGSMELMKYHVRDNIN-LPFKITPIVSHSTRDNEIDYRITLKSLFPGKLSAK 373

Query: 336 NVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGV 395
           +V + IPVP      +   S+G  K++PE+NA++W+   + G  E ++SA   + + D  
Sbjct: 374 DVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENTLSAAT-VSTSDTT 432

Query: 396 E---PPKVRRPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451
           +       R P+ + F++  F+ SG+ VRY  ++    ++++  W++YI++SG  Y +R
Sbjct: 433 QLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDSKHRAVKWIKYISKSGS-YEVR 490

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 76/131 (58%), Gaps = 7/131 (5%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFS-QLLLQLEEETGVIPPCIMHKGIHYLF 59
           M+SG+    + G+ IL + +++ +  +  D F  Q++  L+  + V+   +     H++ 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IKHSD-IYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEM 118
            KH D +++V +T S   N A I+ FL++L  V+  Y ++  EE++++ F+I++E+LD M
Sbjct: 59  SKHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDIM 116

Query: 119 MDF-GIPQITE 128
           +   GIP  TE
Sbjct: 117 LGGNGIPIDTE 127

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  145 bits (365), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 122/485 (25%), Positives = 231/485 (47%), Gaps = 46/485 (9%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFS-QLLLQLEEETGVIPPCIMHKGIHYLF 59
           M++ +      G+ I+++ ++  +  +  D F  Q++  L+  + ++   +     HY+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPIL--TLGSTTFHYVR 58

Query: 60  IKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMM 119
                ++VV+++ + + N A  + FL++   +L  Y ++  EE +++ F++ +ELLD M+
Sbjct: 59  TPGEGLWVVSVSRNNE-NSAATWEFLYKFATMLAAY-RLDSEEVLKEEFMLAWELLDTMV 116

Query: 120 DFG-IP------QITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPA--ELTNSVSWRP 170
           + G IP      +I     +K  ++                  A   A  +L +  S  P
Sbjct: 117 EGGGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRAS-NP 175

Query: 171 EGIT-----------YKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDL 219
            GI+            K+NE  + + ESI++LV++ G +L++ + G + + ++L G    
Sbjct: 176 GGISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAAVC 235

Query: 220 KLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIE---LEDLKFHQCVRLSKFEN 276
           + G+ND  + ++    +  D   S       +E K   +    L D KFHQCV L +F+ 
Sbjct: 236 QFGLND-SLSTDNSSNSKWDPLRSKETQGTNLEMKNAHVGTVLLRDCKFHQCVSLERFDR 294

Query: 277 EKIITFIPPDGEFDLMNYR----LTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKS 332
           ++II F PP+G  +LM Y     L  P K            +  R+ I    K+    K 
Sbjct: 295 DRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTI----KSLFPGKL 350

Query: 333 IANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSV 392
            A NV + IPVP      +   S+G+ K+LPE+NA++WK   + G  E  +SA + +P+ 
Sbjct: 351 SAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-ITVPTR 409

Query: 393 DGVEPPK---VRRPVQVKFQIPYFTTSGIQVRYLKV---NEPKLQYKSYPWVRYITQSGE 446
           D  +       R P+ + F+I  ++ +G+ VRY  V   +    ++K+  W++Y++ SG 
Sbjct: 410 DTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVSHSGS 469

Query: 447 DYTIR 451
            Y +R
Sbjct: 470 -YEVR 473

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  133 bits (334), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 95/334 (28%), Positives = 152/334 (45%), Gaps = 79/334 (23%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIV-GAVRVRSRLSGMPDLKLGIN 224
           VSWR +GI Y +NE FLD++E +  L+     +++  ++ G +  +S LSGMP LK+  N
Sbjct: 216 VSWRAKGIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN 275

Query: 225 DRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIP 284
                                        +K +  +   KFHQCV      NEK I FIP
Sbjct: 276 KLS--------------------------QKDEQFISHSKFHQCVTWPS-SNEKEIEFIP 308

Query: 285 PDGEFDLMNYRLT-----TPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEI 339
           PDG+F L  Y L       P+  L+   V  ++  K +I++ C  +   K ++  + + +
Sbjct: 309 PDGDFVLCQYELKRHVKDQPMLKLVSFGVKPKL-KKYKIQMSCTIETHFKARNSTSTLNL 367

Query: 340 LIPVP--------DDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGK---EYSMSAQLH 388
            IP+         D     +F+   G + +    + +LW +    GG    + SM+A+  
Sbjct: 368 KIPLARLFQEYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFS 427

Query: 389 LPSV-----------DGVEPPKVR-----------------------RPVQVKFQIPYFT 414
           L +            + + PP +R                       R + +KF+IPY T
Sbjct: 428 LFNKKEFEEEQEELKNSMNPPPLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYST 487

Query: 415 TSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDY 448
            SG+QV YLK++E +LQY+S+PWVRY T + E+Y
Sbjct: 488 CSGLQVEYLKIDEEQLQYQSFPWVRYKTVNDEEY 521

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 73/141 (51%), Gaps = 11/141 (7%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEE-ETGVIPPCIMHKGIHYLF 59
           M S I+  D   +P++++      +I AI N   +L   +   T    P I     H++ 
Sbjct: 1   MSSCIFITDENLEPLISK------NIKAIPNLQGILRLFKSVYTPESQPVISASSFHFVH 54

Query: 60  IKHSDIYVVALTTSY--QTNVAQIFMFLHQLVEVLEEYVKIVV--EESVRDNFVIIYELL 115
           IK S +  V++  +Y    NV  I  FL Q   +L++Y+ +    +  V DN ++I EL+
Sbjct: 55  IKRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELI 114

Query: 116 DEMMDFGIPQITETKMLKKYI 136
           DE +DFG+ QIT+  +++ YI
Sbjct: 115 DESIDFGVIQITDASIMRDYI 135

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  132 bits (332), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 101/342 (29%), Positives = 154/342 (45%), Gaps = 83/342 (24%)

Query: 163 TNSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIV-GAVRVRSRLSGMPDLKL 221
           T  VSWR +GI Y KNE FLD++E +  L   + +V+R  ++ G +  +S LSGMP LK+
Sbjct: 233 TMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKI 292

Query: 222 GINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIIT 281
            +N        L + +    S S                   KFHQCV L    NEK + 
Sbjct: 293 ALNK-------LLQRDAQFMSHS-------------------KFHQCVALETL-NEKELE 325

Query: 282 FIPPDGEFDLMNYRLT-----TPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANN 336
           FIPPDGEF L  Y L      TPI  +   ++  Q+  K ++ I    +   K ++  + 
Sbjct: 326 FIPPDGEFILCEYELKRHVNDTPILKITSFEIKPQL-KKFKLRILLTIETHFKTRNSTSI 384

Query: 337 VEILIPVP--------DDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGK---EYSMSA 385
           + + IP+         D +   +F+ + G + +    + +LW++    GG    ++SM A
Sbjct: 385 LNVKIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVA 444

Query: 386 QLHL-----------PSVDGVEPPKVRRP---------------------------VQVK 407
           +  L                + PP +R                             V + 
Sbjct: 445 EFSLFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMD 504

Query: 408 FQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYT 449
           F+IPY T SG++V YLK+ E +LQY+S+PWVRY T S E+Y 
Sbjct: 505 FEIPYTTCSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEYA 546

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 69/141 (48%), Gaps = 11/141 (7%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEE-ETGVIPPCIMHKGIHYLF 59
           M S +Y  D   +P++++      +I +I N + L+   +E  +   PP + ++  +++ 
Sbjct: 1   MSSCLYILDENLEPLISK------NIKSIPNLNTLVEVFQEVYSSNAPPIVFNRNWYFIH 54

Query: 60  IKH-SDIYVVAL-TTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDE 117
            K  S I++ A+  T    N   I +++ Q   +L++Y+ +   +       ++  L   
Sbjct: 55  TKRDSLIFLSAIHGTDDSANAMMITVYMDQFYLLLKKYLGVAQLDRNLVLDNVLLVLELL 114

Query: 118 MM--DFGIPQITETKMLKKYI 136
               +FG+PQ+TE  ++K YI
Sbjct: 115 EESSEFGVPQMTEPSVMKDYI 135

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  127 bits (320), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 101/362 (27%), Positives = 168/362 (46%), Gaps = 100/362 (27%)

Query: 163 TNSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIV-GAVRVRSRLSGMPDLKL 221
           T +VSWR +GI Y KNE FLD++ES+  L+  + +V+R  ++ G ++ +S LSGMP L++
Sbjct: 222 TMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRI 281

Query: 222 GINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLS--------- 272
            +N                        + ++D K    L   KFHQCV L+         
Sbjct: 282 ALN------------------------KILQDDKQF--LGHAKFHQCVSLNSINIKDLEK 315

Query: 273 -----------KFENEKIITFIPPDGEFDLMNYRLTTPIK--PLI-WCDVNIQVH-SKSR 317
                       F N+K I FIPPDGEF L  Y L   +K  P+I     +I+ +  K R
Sbjct: 316 DLEGPNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNFKKFR 375

Query: 318 IEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPQFRYSHGSIKWLPEKNAIL 369
           ++I  + +   K+++  + + I IP+         D +  P+F+   G + +   ++ ++
Sbjct: 376 VQISLKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLI 435

Query: 370 WKLRSFAGG---KEYSMSAQLHLPSVD-----------GVEPPKVR-------------- 401
           W++ +  GG    E  M A+  L + +            + PP +R              
Sbjct: 436 WEIDALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMHE 495

Query: 402 -------------RPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDY 448
                        + V ++F+IPY T SG++V YLK+ E  L+Y+S+PWVRY T + ++Y
Sbjct: 496 NEDAEDTALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRYKTLNDDEY 555

Query: 449 TI 450
             
Sbjct: 556 AF 557

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 72/142 (50%), Gaps = 12/142 (8%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEE-TGVIPPCIMHKGIHYLF 59
           M S ++  D   +P++++  +       + N   ++   +E  T   PP I     HY++
Sbjct: 1   MSSCLFILDELLEPLISKNTK------PVRNLPDIIKSFKESWTPTSPPIITVSNWHYVY 54

Query: 60  IKHSDIYVVALTTSYQ---TNVAQIFMFLHQLVEVLEEYVK--IVVEESVRDNFVIIYEL 114
           +K   ++ VA          N+  I  +L QL  +L+ Y K  ++ +  + DN +++ EL
Sbjct: 55  VKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALLVTEL 114

Query: 115 LDEMMDFGIPQITETKMLKKYI 136
           +DE +DFGI Q+T+  +++ YI
Sbjct: 115 MDESIDFGIIQMTDPSIIRDYI 136

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  127 bits (319), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 101/367 (27%), Positives = 161/367 (43%), Gaps = 109/367 (29%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIV-GAVRVRSRLSGMPDLKLGIN 224
           +SWR +GI Y KNE FLD+IE +  L+  +  ++R  ++ G +  RS LSGMP LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 225 DRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFE--------- 275
                                     + ++ PQ  + +  FHQCV L             
Sbjct: 313 -------------------------KILNRDPQF-MSNSNFHQCVSLDSINTIEKGQEKE 346

Query: 276 ----------NEKIITFIPPDGEFDLMNYRLTTPIK--PLIWC-DVNIQVH-SKSRIEIH 321
                     + + I F+PPDGEF L  Y L   +K  P+I   D  I+    KS+I+I 
Sbjct: 347 QNTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQIL 406

Query: 322 CRAKAQIKKKSIANNVEILIPVP--------DDADTPQFRYSHGSIKWLPEKNAILWKLR 373
            + +   K  +  + + + IP+         D +   +F+ ++G + +    + +LW+++
Sbjct: 407 TKIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEIQ 466

Query: 374 SFAGGKE----------------YSMSAQLHLPSVD-----------GVEPPKVR----- 401
           +  G +E                 SM A+  L + +            + PP +R     
Sbjct: 467 TMKGHRERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPKL 526

Query: 402 -------------------RPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYIT 442
                              R V + F+IPY T SG++V YLKV EP+LQY+S+PWVRY T
Sbjct: 527 EELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKT 586

Query: 443 QSGEDYT 449
            + E+Y 
Sbjct: 587 VNDEEYA 593

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 77/143 (53%), Gaps = 14/143 (9%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEE--ETGVIPPCIMHKGIHYL 58
           M S ++  D   +P++++  R      A+ N S +L   ++    G  PP +      ++
Sbjct: 1   MSSSLFILDEDLEPVVSKNIR------ALPNLSSVLSSFKQCYHDGS-PPILFQNDWFFI 53

Query: 59  FIKHSDIYVVAL---TTSYQTNVAQIFMFLHQLVEVLEEY--VKIVVEESVRDNFVIIYE 113
            +K   +++V++   T     ++  I  FL Q   +L++Y  +K++ ++ + DN +++ E
Sbjct: 54  HLKRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSKDLILDNVLLVLE 113

Query: 114 LLDEMMDFGIPQITETKMLKKYI 136
           L+DE +DFGI Q+T+  ++K YI
Sbjct: 114 LMDECIDFGIVQVTDPSIIKDYI 136

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  124 bits (312), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 94/343 (27%), Positives = 154/343 (44%), Gaps = 85/343 (24%)

Query: 165 SVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIV-GAVRVRSRLSGMPDLKLGI 223
           SVSWR +GI Y KNE FLD+IE +   +     +++  ++ G +  +S LSGMP LK+ +
Sbjct: 222 SVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSL 281

Query: 224 NDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFI 283
           N + I+                      +DK+    L   KFHQCV     +  K++ F+
Sbjct: 282 N-KIIY----------------------QDKQF---LSSCKFHQCVMPDSVDEGKVLEFV 315

Query: 284 PPDGEFDLMNYRLT-----TPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVE 338
           PPDG+F L  Y L       P+  LI  +V  ++  K ++++    ++  KK +    + 
Sbjct: 316 PPDGDFVLCKYELKRHVNDLPLLKLISYEVKPKL-DKYKLKLFVTIESTFKKTNSTTKLN 374

Query: 339 ILIPVP--------DDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGK-EYSMSAQLHL 389
           I IP+         D +   + R   G I +    + +LW++ +  GG  +  M A   L
Sbjct: 375 IKIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFAL 434

Query: 390 PSVD-----------GVEPPKVRRP--------------------------------VQV 406
            + +            + PP +R                                  +++
Sbjct: 435 FNEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGNLIKM 494

Query: 407 KFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYT 449
            F+IPY T+SG++V YLK+ EP LQY+++PWVRY T S + Y 
Sbjct: 495 DFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYA 537

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  122 bits (307), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 118/481 (24%), Positives = 220/481 (45%), Gaps = 82/481 (17%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDI--SINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYL 58
           M+S I      G+ I+++ YR++I  SI+ I       +Q+     V  P +      + 
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEI-----FRIQVINNFNVRSPILTLGSTTFH 55

Query: 59  FIKHS-------DIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVII 111
            I+ +       ++++V +  +   N A I+ FL +L  +L++Y  I  E  ++D F+ +
Sbjct: 56  HIRSTANDPTDDELWLVCVNRN-NANSAAIWEFLQKLNLILQQY-GITSESKLKDEFMTV 113

Query: 112 YELLDEMM-DFGIPQITE-----TKMLKKYITQXXXXXXXXXXXXXXXNA--ARPPAELT 163
           +E+LD M+   GI Q T+      KM  K I++               N     P A  +
Sbjct: 114 HEILDNMLLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANFS 173

Query: 164 NSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGI 223
              + R +   +KKNE F  + ES+N+LV++ G +L++ + G + ++S L+G P  +   
Sbjct: 174 LIPTNRHDA--HKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQF-- 229

Query: 224 NDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFI 283
                                    E V+D   Q ++ D KF QC+   +    + +   
Sbjct: 230 -------------------------ELVDD---QTKITDFKFDQCIEKVQ---SRTVRVA 258

Query: 284 PPDGEFDLMNY-----RLTTPIK--PLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANN 336
             DGE +++NY     ++  P K  P++          K  ++     K+   K   A +
Sbjct: 259 ATDGELEIVNYHVRDDKINIPFKITPIVST-------VKDTVDYRISLKSLFPKNLSATD 311

Query: 337 VEILIPVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVE 396
           V + IPVP +    +   S+G  K+  E+NA++W    F G  E ++SA   +   DG +
Sbjct: 312 VVLTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSA---ITIADGRQ 368

Query: 397 PPKV----RRPVQVKFQIPYFTTSGIQVRYLKV-NEPKLQYKSYPWVRYITQSGEDYTIR 451
              +    R  +Q+ F+I  ++ SG+ +R L + ++ K +YK+  W++YI+++G  Y +R
Sbjct: 369 IMNLESWTRPSIQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAGS-YEMR 427

Query: 452 L 452
            
Sbjct: 428 F 428

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  124 bits (312), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 99/348 (28%), Positives = 158/348 (45%), Gaps = 74/348 (21%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIV-GAVRVRSRLSGMPDLKLGIN 224
           +SWR +GI Y KNE FLD+IE +   +  +  V+R  ++ G +  RS LSGMP LK+ IN
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 225 -----DRGIFSN--YLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENE 277
                D    SN  + +  ++D   + +  P   ED K + E  D             N+
Sbjct: 310 KILKQDVQFLSNVKFHQCVSLDSIRARSNPPAVEEDGKKKNEEAD----------TLGNK 359

Query: 278 KIITFIPPDGEFDLMNYRLTTPIK--PLIWC---DVNIQVHSKSRIEIHCRAKAQIKKKS 332
             I FIPPDGEF L  Y L   +K  P+I     ++  ++H K +I+IH   +   K  +
Sbjct: 360 GEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLH-KFKIKIHVIIETHFKTTN 418

Query: 333 IANNVEILIPVP--------DDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGG---KEY 381
             + + + IP+         D +  P+F+   G++ +      +LW++ +  GG      
Sbjct: 419 STSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKFLLWEVGTMNGGHGENTL 478

Query: 382 SMSAQLHL-----------PSVDGVEPPKVRRP--------------------------- 403
           SM A+  L                + PP +R                             
Sbjct: 479 SMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHEEGDSDEVSTRKKNES 538

Query: 404 -VQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTI 450
            + + F++PY T SG+++ YLK+ E +LQY+S+PWVRY T S ++Y  
Sbjct: 539 LLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRYKTISDDEYAF 586

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEE---ETGVIP-PCIMHKGIH 56
           M S I+  D   +PI+ +  R      A+ N   L+ + +E     GV P P +      
Sbjct: 1   MSSSIFILDETLEPIICKNIR------ALPNLPSLVTKFQELYRSNGVSPLPILNDIDWQ 54

Query: 57  YLFIKH-SDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEY--VKIVVEESVRDNFVIIYE 113
           +L IK  S +++  +  + + N+  +F +L +  ++L++Y  V I+    + DNF+++ E
Sbjct: 55  FLHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIE 114

Query: 114 LLDEMMDFGIPQITETKMLKKYI 136
           L+DE +DFG+ Q T++ ++K Y+
Sbjct: 115 LIDESLDFGVVQFTDSSLIKDYV 137

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  123 bits (308), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 98/350 (28%), Positives = 161/350 (46%), Gaps = 93/350 (26%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVT-QQGQVLRSEIVGAVRVRSRLSGMPDLKLGIN 224
           VSWR +GI Y KNE FLD+IE +  L+    G++ ++ I G ++ +  LSGMP LK+ +N
Sbjct: 216 VSWRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN 275

Query: 225 DRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFE--------- 275
                   L +N+    S+S                   KFHQCV ++  +         
Sbjct: 276 K-------LIKNDEQFISNS-------------------KFHQCVSINSLKREINNEEEE 309

Query: 276 ---NEKIITFIPPDGEFDLMNYRLTTPIK--PLIWCDVNIQVH---SKSRIEIHCRAKAQ 327
              + K I FIPPDGEF L  Y L   ++  P+I    NI++     K +I+IH   +  
Sbjct: 310 NTYHGKEIEFIPPDGEFVLCKYELKRHVRDVPVIKLS-NIEIKPKLKKYKIQIHVTIETH 368

Query: 328 IKKKSIANNVEILIPVP--------DDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGK 379
            KK++  + + I IP+         D    P+F+   G + +    + ++W++ S  GG 
Sbjct: 369 FKKQNSTSVLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGN 428

Query: 380 EYS---MSAQLHLPSVD-----------GVEPPKVR------------------------ 401
             S   M A+  + + +            + PP +R                        
Sbjct: 429 GESKNNMVAEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGI 488

Query: 402 --RPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYT 449
             + + +KF++PY T SG++V YLK+ E ++ Y+S+PWVRY T + ++Y 
Sbjct: 489 SQQLLTMKFEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRYKTINDDEYA 538

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 72/141 (51%), Gaps = 10/141 (7%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S ++  D + +P++++  +   ++  I  F +L  +   E G  PP       HY+FI
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEFFKLNYK---ENG--PPVFTVLEWHYVFI 55

Query: 61  KHSDIYVVAL---TTSYQTNVAQIFMFLHQLVEVLEEYVK--IVVEESVRDNFVIIYELL 115
           K   ++ +     T    TN+  +  +L QL  +L+ Y     +    V DN ++I EL+
Sbjct: 56  KRDSLWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELI 115

Query: 116 DEMMDFGIPQITETKMLKKYI 136
           DE MDFGI Q+T+  ++K YI
Sbjct: 116 DESMDFGIVQLTDPSIIKDYI 136

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  122 bits (305), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 100/371 (26%), Positives = 158/371 (42%), Gaps = 113/371 (30%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIV-GAVRVRSRLSGMPDLKLGIN 224
           +SWR +GI Y KNE FLD+IE +  L+  +  V+R  ++ G +  R  LSGMP LK+ IN
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 225 DRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFE--------- 275
                                     + ++ PQ  + +  FHQCV L             
Sbjct: 318 -------------------------KILNRDPQF-MSNSSFHQCVSLDSINTIEKDEEKN 351

Query: 276 -----------NEKIITFIPPDGEFDLMNYRLTTPIK--PLIWC-DVNIQVH-SKSRIEI 320
                      + + I FIPPDGEF L  Y L   +K  P++   D  I+    K +I+I
Sbjct: 352 SDDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKIQI 411

Query: 321 HCRAKAQIKKKSIANNVEILIPVP--------DDADTPQFRYSHGSIKWLPEKNAILWKL 372
             + +   K  +  + + + IP+         D +   +F+ + G + +    + +LW++
Sbjct: 412 VTKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEI 471

Query: 373 RSFAGGKEYSM--SAQLHLPSVD----------------------------GVEPPKVR- 401
           ++  G +E+S   S+Q +    D                             + PP +R 
Sbjct: 472 QTMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLRT 531

Query: 402 -----------------------RPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWV 438
                                  + V + F+IPY T SG++V YLKV EP+LQY+S+PWV
Sbjct: 532 GPRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWV 591

Query: 439 RYITQSGEDYT 449
           RY T S E+Y 
Sbjct: 592 RYKTVSDEEYA 602

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 75/143 (52%), Gaps = 14/143 (9%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEE--ETGVIPPCIMHKGIHYL 58
           M S ++  D   +P++++  R      A+ N S +L   ++    G  PP +      ++
Sbjct: 1   MSSSLFILDENLEPLVSKNIR------ALPNLSSVLSSFKQCYHDGS-PPILSQNDWFFI 53

Query: 59  FIKHSDIYVVAL---TTSYQTNVAQIFMFLHQLVEVLEEY--VKIVVEESVRDNFVIIYE 113
            +K   ++ V++   T     ++  I  FL Q   +L++Y  ++++ +  + DN +++ E
Sbjct: 54  HLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVLE 113

Query: 114 LLDEMMDFGIPQITETKMLKKYI 136
           L+DE +DFGI Q+T+  ++K YI
Sbjct: 114 LIDECIDFGIVQVTDPSIIKDYI 136

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  121 bits (304), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 99/353 (28%), Positives = 157/353 (44%), Gaps = 81/353 (22%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIV-GAVRVRSRLSGMPDLKLGIN 224
           +SWR +GI Y KNE FLD+IE +  L+  +  ++R  ++ G +  R  LSGMP LK+ IN
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 225 -----DRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKI 279
                D    SN      V   S  T            IE  + K      L    + K 
Sbjct: 320 KILNRDAQFLSNSSFHQCVSLDSIKT------------IEKREEKEDDDTGLQAAADAKE 367

Query: 280 ITFIPPDGEFDLMNYRLTTPIK--PLIWC-DVNIQVH-SKSRIEIHCRAKAQIKKKSIAN 335
           + F+PPDGEF L  Y L   +K  P+I   D  I+    K +I+I  + +   K  +  +
Sbjct: 368 LEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIETKIQTNFKPTNSTS 427

Query: 336 NVEILIPVP--------DDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEY------ 381
            + + IP+         D +   +F+ + G + +    + +LW++++  G +E+      
Sbjct: 428 KLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQAMKGHREHNTNKTS 487

Query: 382 ----------SMSAQLHLPSVD-----------GVEPPKVR------------------- 401
                     SM A+  L + +            + PP +R                   
Sbjct: 488 QDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLEELYRQVHDQQIAH 547

Query: 402 -----RPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYT 449
                + V + F+IPY T SG+++ YLKV EP+LQY+S+PWVRY T S ++Y 
Sbjct: 548 VTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTTSDDEYA 600

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 55/95 (57%), Gaps = 5/95 (5%)

Query: 47  PPCIMHKGIHYLFIKHSDIYVVAL---TTSYQTNVAQIFMFLHQLVEVLEEY--VKIVVE 101
           PP +      ++ +K   ++ V++   T     ++  I  FL Q   +L+EY  +K++ +
Sbjct: 42  PPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTK 101

Query: 102 ESVRDNFVIIYELLDEMMDFGIPQITETKMLKKYI 136
           + + DN +++ EL+DE +DFGI Q+T+  ++K YI
Sbjct: 102 DVILDNVLLVLELMDECIDFGIVQVTDPSIIKDYI 136

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  121 bits (304), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 104/373 (27%), Positives = 159/373 (42%), Gaps = 115/373 (30%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVT-QQGQVLRSEIVGAVRVRSRLSGMPDLKLGIN 224
           VSWR +GI Y KNE FLD+IE +  LV  + G V RS I G +  RS LSGMP LK+ +N
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 225 DRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFEN-------- 276
                   L +N+    S                    ++FHQCV L   E         
Sbjct: 309 K-------LLQNDKQFISQ-------------------VQFHQCVSLDSIEKVIKYAEEH 342

Query: 277 --------------EKIITFIPPDGEFDLMNYRLTTPIK--PLI-WCDVNIQVH-SKSRI 318
                         E  I FIPPDG+F L +Y L   I+  P++  C   I     K ++
Sbjct: 343 SDELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKWKKYKL 402

Query: 319 EIHCRAKAQIKKKSIANNVEILIPVPD-------DADTP-QFRYSHGSIKWLPEKNAILW 370
           +I    +   K  +  + +++ IP+         D   P +F+ S+G + +    + +LW
Sbjct: 403 KISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDDFLLW 462

Query: 371 KLRSFAGGKEY-------------SMSAQLHL-----------PSVDGVEPPKVR----- 401
           ++    GGK +             +M+A+  L                + PP +R     
Sbjct: 463 EIGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERETSMNPPPLRTGPKL 522

Query: 402 -------------------RP------VQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYP 436
                              +P      + + F+IPY T SG++V YLK++E +LQY+S+P
Sbjct: 523 EDIYKETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQLQYQSFP 582

Query: 437 WVRYITQSGEDYT 449
           WVRY T + ++Y 
Sbjct: 583 WVRYKTINDDEYA 595

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 74/141 (52%), Gaps = 10/141 (7%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60
           M S IY  D   +P++++  +   ++N + +  +  ++  +      P I      +++I
Sbjct: 1   MSSSIYIFDETLEPLVSKSVKGLPNVNELGDLFRYHVRQSQN-----PIIDVYNWRFVYI 55

Query: 61  KHSDIYVVALTTSYQTNVAQ---IFMFLHQLVEVLEEYV--KIVVEESVRDNFVIIYELL 115
           K   +Y VA+  +    +A    I  +L QL ++  +YV  K++    V DN +++ EL+
Sbjct: 56  KRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNTLLVMELI 115

Query: 116 DEMMDFGIPQITETKMLKKYI 136
           DE +D+GI Q+TE  ++K YI
Sbjct: 116 DETLDYGIVQLTEPSIMKDYI 136

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  118 bits (296), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 100/369 (27%), Positives = 157/369 (42%), Gaps = 112/369 (30%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIV-GAVRVRSRLSGMPDLKLGIN 224
           +SWR +GI Y KNE FLD+IE +  L+  +  ++R  ++ G +  R  LSGMP LK+ IN
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 225 DRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFE--------- 275
                                     + ++ PQ  + + KFHQCV L             
Sbjct: 312 -------------------------KLLNRDPQF-MSNSKFHQCVSLDSINIIEEEGRDT 345

Query: 276 ---------NEKIITFIPPDGEFDLMNYRLTTPIK--PLIWCDVNIQVH---SKSRIEIH 321
                    + K I FIPPDGEF L  Y L   +K  P+I      ++     K +I+I 
Sbjct: 346 DDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQ-GFEIKPKLKKFKIQII 404

Query: 322 CRAKAQIKKKSIANNVEILIPVP--------DDADTPQFRYSHGSIKWLPEKNAILWKLR 373
            + +   K  +  + + + IP+         D +   +F+ + G + +    + +LW++ 
Sbjct: 405 TKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLWEIG 464

Query: 374 SFAGGKE---------------YSMSAQLHLPSVD-----------GVEPPKVR------ 401
           +  G +E                SM A+  L + +            + PP +R      
Sbjct: 465 TMKGHRERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRTGPKLE 524

Query: 402 ---------------------RPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRY 440
                                + V V F+IPY T SG++V YLKV EP+LQY+S+PWVRY
Sbjct: 525 ELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRY 584

Query: 441 ITQSGEDYT 449
            T S ++Y 
Sbjct: 585 KTISDDEYA 593

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEE-ETGVIPPCIMHKGIHYLF 59
           M S ++  D   +P++++  R      AI N S +L   ++      PP +   G  ++ 
Sbjct: 1   MSSSLFILDEDLEPLVSKNIR------AIPNLSSILSSFKQCYHRDSPPILSQNGWFFIH 54

Query: 60  IKHSDIYVVAL---TTSYQTNVAQIFMFLHQLVEVLEEYVKIVV--EESVRDNFVIIYEL 114
           +K   ++ +++   T     ++  I  FL Q   +L++Y +I V  +  + DN +++ EL
Sbjct: 55  LKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLEL 114

Query: 115 LDEMMDFGIPQITETKMLKKYI 136
           +DE +DFGI Q+T+  ++K YI
Sbjct: 115 VDECIDFGIVQVTDPSIIKDYI 136

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  118 bits (296), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 95/353 (26%), Positives = 156/353 (44%), Gaps = 96/353 (27%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIV-GAVRVRSRLSGMPDLKLGIN 224
           +SWR +GI Y KNE FL++IE +   +     V++  ++ G +R +  LSGMP+LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 225 DRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFE--NEKIITF 282
              I +                     EDK+    L + KFHQCV L+  E  + K + F
Sbjct: 313 K--IVN---------------------EDKQF---LANCKFHQCVSLASLESSDHKDVEF 346

Query: 283 IPPDGEFDLMNYRLTTPIK--PLIWCDVNIQVH---------SKSRIEIHCRAKAQIKKK 331
           +PPDGEF L  Y L   ++  P++   VN +V              IE H +      K 
Sbjct: 347 VPPDGEFTLCRYELKRHVRDEPMVKL-VNFEVKPKLKKFKLKLLLTIETHFKTTNATSKL 405

Query: 332 SIANNVEILIPV--PDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGK---EYSMSAQ 386
           ++   ++ L      D +   + +   G+I +    + +LW++ S +GG    + SM  +
Sbjct: 406 ALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGHGETQLSMGVE 465

Query: 387 LHLPSVD-----------GVEPPKVR---------------------------------- 401
             L + +            + PP +R                                  
Sbjct: 466 FALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPVAEHRLQPR 525

Query: 402 -----RPVQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYT 449
                + + + F++PY T+SG++V YLK+ EP+L+Y+S+PWVRY T S  +Y 
Sbjct: 526 TREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDAEYA 578

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 72/140 (51%), Gaps = 10/140 (7%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGV-IPPCI-MHKGIHYL 58
           M S +Y  D   + ++++      +I A+ +    + Q ++  G   PP I  H    + 
Sbjct: 1   MSSVLYILDENLETLISK------NIKAVPSLEYPIAQFKKLYGSNAPPVIDYHDLFTFT 54

Query: 59  FIKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEY--VKIVVEESVRDNFVIIYELLD 116
           +I+   +  V++     T + +  ++L    EVL+ Y  VK++ +  V DN V+I EL++
Sbjct: 55  YIQRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVLDKNIVTDNSVLISELIE 114

Query: 117 EMMDFGIPQITETKMLKKYI 136
           E +DFG  Q+T++ +L  YI
Sbjct: 115 ETIDFGAIQVTDSGLLADYI 134

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 90.9 bits (224), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 112/234 (47%), Gaps = 42/234 (17%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIV-GAVRVRSRLSGMPDLKLGIN 224
           +SWR +GI Y KNE FLD++E    ++  +  ++R  ++ G +  R  LSGMP LK+ +N
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 225 DRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIP 284
                                        +K Q  L  L+FHQCV L   +N++I  FIP
Sbjct: 347 KLL--------------------------QKDQQFLSQLRFHQCVSLETIQNKEI-EFIP 379

Query: 285 PDGEFDLMNYRLTTPIK-----PLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEI 339
           PDGEF L  Y L   +K      LI  ++  ++  K +I+I+       K ++  + + +
Sbjct: 380 PDGEFILCEYELKRHVKDPPNIKLISFEIKPKL-KKFKIQINLSITTFFKVQNSTSILNL 438

Query: 340 LIPVP--------DDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSA 385
            IP+         D   +P+F+ + G +K+    + +LW++ S  GG   ++ A
Sbjct: 439 KIPLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENIKA 492

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 34/45 (75%)

Query: 404 VQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDY 448
           + V F+IPY+  SG++V YLK+ E +L Y+S+PWVRY T + +DY
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRYKTTNDKDY 653

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 75/143 (52%), Gaps = 13/143 (9%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQL--LLQLEEETGVIP-PCIMHKGIHY 57
           M+S I+  D   +P++++  R      AI NF  +  L +    T     P +     ++
Sbjct: 1   MLSCIFILDENLEPLISKNIR------AIPNFKSIVELFRKHRSTNTTELPIVSINDWNF 54

Query: 58  LFIKH-SDIYVVALT-TSYQTNVAQIFMFLHQLVEVLEEYVKI--VVEESVRDNFVIIYE 113
           + IK  S I++ A+    Y +++  + ++L +   +L+ ++K   +    + DN ++I E
Sbjct: 55  IQIKRDSLIFLGAININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLNRNIILDNILLIME 114

Query: 114 LLDEMMDFGIPQITETKMLKKYI 136
           L+DE +DFGI Q+T+  ++K Y+
Sbjct: 115 LIDESIDFGIIQMTDPNIIKDYV 137

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/265 (27%), Positives = 111/265 (41%), Gaps = 67/265 (25%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVT-QQGQVLRSEIVGAVRVRSRLSGMPDLKLGIN 224
           +SWR +GI Y KNE FLD+IE +   +  ++G + ++ I G +  +  LSGMP LK+ IN
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 225 DRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKF---------- 274
              I  N                         Q  L +  FHQCV L             
Sbjct: 355 K--ILQN-----------------------DSQF-LSNAHFHQCVSLDSLHLQSAEDDDG 388

Query: 275 -------ENE--------KIITFIPPDGEFDLMNYRLTT-----PIKPLIWCDVNIQVHS 314
                  ENE        K I FIPPDG+F L  Y L       P+  L   D+  ++ S
Sbjct: 389 DDNANVNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL-S 447

Query: 315 KSRIEIHCRAKAQIKKKSIANNVEILIPVP--------DDADTPQFRYSHGSIKWLPEKN 366
           K +++IH   +   K  +  + + + IP+         D +   +F+   G + +    N
Sbjct: 448 KYKLKIHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDN 507

Query: 367 AILWKLRSFAGGK-EYSMSAQLHLP 390
            ++W++ S  GG  E +MS     P
Sbjct: 508 FLIWEIGSMKGGHGEVTMSMMAEFP 532

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 41/53 (77%), Gaps = 2/53 (3%)

Query: 399 KVRRP--VQVKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYT 449
           + R P  +++ F+IPY+T SG+++ YLK+ EP+LQY+S+PWVRY T S E+Y 
Sbjct: 617 RTRSPNLLKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 79/166 (47%), Gaps = 36/166 (21%)

Query: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEE-------------ETGVIP 47
           M S I+  D   +PIL +  R      +I N  +LLL+ +E             ++ V+P
Sbjct: 1   MSSCIFILDENLEPILNKNIR------SIGNNFELLLKFQEIYRKQQNEIHNNDDSKVLP 54

Query: 48  PCIMHK--------------GIHYLFIKH-SDIYVVALTTSYQTNVAQIFMFLHQLVEVL 92
               +               G  +L IK  S I+V  +  +   ++  IF +L +  ++L
Sbjct: 55  ILNTNDYGMSNSTNGGGGNCGWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLL 114

Query: 93  EEYVKIVVEES--VRDNFVIIYELLDEMMDFGIPQITETKMLKKYI 136
           + Y+ +   +   + DNF+++ ELLDE +DFGI Q T++ ++K YI
Sbjct: 115 KSYLNVTKLDKGLLIDNFLLVMELLDESLDFGIVQFTDSSLIKDYI 160

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 85/403 (21%), Positives = 154/403 (38%), Gaps = 66/403 (16%)

Query: 83  MFLHQLVEVLEEYV--KIVVEESVRDNFVIIYELLDEMMDFGIPQITETKMLKKYI---- 136
           MFL Q  +VL EY   + +  + + +N   +  LL  M+D G   +T++  L++ +    
Sbjct: 40  MFLAQYHQVLIEYFDKEALTVKKLVNNADRLALLLHAMLDAGEVAVTDSNRLRQLVPLRN 99

Query: 137 ---------TQXXXXXXXXXXXXXXXNA--ARPPAELTNSVSWRPEGITYKKNEAFLDII 185
                    T+                A  A    E   +V WR     Y  NE ++D++
Sbjct: 100 DLSTILNSATKTLANTVKYADSKQLFGAPVATGKVEAGQTVPWRTADCRYVNNEIYVDLV 159

Query: 186 ESINMLVTQQGQVL---RSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDGSS 242
           E++N  + Q+G  L      + G + V+  LSG P ++L +   G               
Sbjct: 160 ETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQLKLRTSG--------------- 204

Query: 243 SSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLT-TPIK 301
                        P   L++   H+CV L +      + F+PPDG F L  Y +  + I 
Sbjct: 205 ------------HP---LDNSALHRCVELGE-AGVATMNFVPPDGRFTLAEYAIDLSAIS 248

Query: 302 PLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANN---------VEILIPVPDDADTPQ- 351
                  N+ + + S      + + + + K I  N         + I +  PD +D  + 
Sbjct: 249 QAARRLTNLGLVTVSLASGLGQHRDEFEIKVIIGNSTQVAAIEDLRITVYFPDISDAAKI 308

Query: 352 --FRYSHGSIKWLPEKNAILWKL-RSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKF 408
              R +HG  +    +   +W   +  A G    +   +  P      PP     + V +
Sbjct: 309 KILRTTHGGWESDLSRVRGVWAFDKQTAVGSVPVLRGCVENPESTPHAPPVFPSHLAVSY 368

Query: 409 QIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIR 451
                  SGI+V  + +++     K +  V+Y +++G DY +R
Sbjct: 369 SHVGQLPSGIRVDTIALSDLPPGSKPFKGVKYTSRAG-DYIVR 410

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 80/325 (24%), Positives = 133/325 (40%), Gaps = 83/325 (25%)

Query: 164 NSVSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMP--DLKL 221
           + V WR  GI Y  NE F+D+ E IN +V ++G++L   I G + + + LSG P  ++KL
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 222 GINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFE--NEKI 279
           G+ D                               ++   +  FH+C+   K    N+ I
Sbjct: 267 GLLDH------------------------------KLSHLNTTFHRCILEDKANSINDLI 296

Query: 280 ------ITFIPPDGEFDLMNYRLTTPI----KPLIWCDVNIQVHSKSRI---EIHCRAKA 326
                 +TF+PPDG   L  Y  T P+      L   DVN+Q     R+   E+      
Sbjct: 297 AGKFTKLTFVPPDGRTRLCQY--TLPLVKRDSNLGIIDVNLQSSLGKRLDEFEVRVTVGM 354

Query: 327 QIKKKSIAN---------NVEILIPVPDDADTP-QFRYSHGSIKWLPEKNAILWK---LR 373
               K I N         N + ++ V  +     +   + G + W  +KN +      LR
Sbjct: 355 STTVKEIENMSMTIRMNRNFKGIVRVMRNTHGGVETNMTRGEVNWHLDKNMVCGSMAVLR 414

Query: 374 SFA--------GGKEYSMSAQLHLPS---VDGVEPPKVRRPVQVKFQIPYFTTSGIQVRY 422
             A          +  S S+ +  PS      ++P  ++   + K Q+P    SGI+++ 
Sbjct: 415 CIAELEPELASNDQTSSRSSVVQPPSSHLTSLLQPSFIKCYYEHKSQLP----SGIKLQS 470

Query: 423 LKV--NEPKLQYKSYPWVRYITQSG 445
           + V    PK   K +  V+Y+T++G
Sbjct: 471 IDVVNGGPK---KPFKGVKYLTKTG 492

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 91/439 (20%), Positives = 163/439 (37%), Gaps = 85/439 (19%)

Query: 57  YLFIKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYV---KIVVEESVRDNFVIIYE 113
           Y F   ++  +     ++Q+N  +  +FL      L +Y    ++ + + V +N   I  
Sbjct: 59  YRFKSKANKLIYWCLATHQSNPLEPAVFLEGFDNTLLQYFDKDQLTISKMV-NNQDRIAL 117

Query: 114 LLDEMMDFGIPQITETKMLKKYITQXXXXXXXXXXXXXXX----------------NAAR 157
           LL+ M+D   P +T+   L+  +                                 + A+
Sbjct: 118 LLNCMVDANEPAVTDFNHLRDMVPSREDLSKVINSTASSLSNRISQRNTSQVLNIGDPAK 177

Query: 158 PPAELTNSVSWRPEGITYKKNEAFLDIIESINMLV-----TQQGQVLRSEIVGAVRVRSR 212
            PA     V WR  G+ Y  NE ++D++E++++++     T +   +R  + G V  RS 
Sbjct: 178 GPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSH 237

Query: 213 LSGMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLS 272
           LSG P + L +  RG                               +L     HQC   S
Sbjct: 238 LSGNPVIALNLRLRGH------------------------------DLGMPALHQCCLDS 267

Query: 273 KFENEKIITFIPPDGEFDLMNYRL---TTPIKPLIWCDVNIQVHSKSRIEI-----HCRA 324
                  + F+PPDG+F LM+Y +   +   K  ++ ++ + V    R E+         
Sbjct: 268 YQGRPDQLRFVPPDGKFQLMHYSIDLDSLQSKSKLFSNIGL-VSPDYRTELGDLGDEFEV 326

Query: 325 KAQIKKKSIANNVEILI------PVPDDADTPQFRYSHGSIKWLPEKNAILWKLRSFAGG 378
              I     A  V+ L+      P+P +      R +HG  +     N   W        
Sbjct: 327 NLNIAGSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVF-----D 381

Query: 379 KEYSMSAQLHLPSVDGVEPPKVRRPVQ-VKFQIPYFTT----SGIQVRYLKV-NEPKLQY 432
           KE        LP + G      R  V+ ++  + Y       SGI+V  + + +      
Sbjct: 382 KETPTGT---LPVLRGCLENATREQVRALQLSVSYTNRGELPSGIKVDSVDILSGLSKNI 438

Query: 433 KSYPWVRYITQSGEDYTIR 451
           K +  V+YI ++G D+ +R
Sbjct: 439 KPFKGVKYIAKTG-DFHLR 456

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 75/316 (23%), Positives = 129/316 (40%), Gaps = 64/316 (20%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQQG------QVLRSEIVGAVRVRSRLSGMPDL 219
           V WR + I   +NE ++D+ E++ + + +        ++L   I G+V V S + G+P L
Sbjct: 173 VPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPML 232

Query: 220 KLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKF--ENE 277
           ++                  G      IP               KFH CV +++F   + 
Sbjct: 233 EVSFG---------------GCDFKDIIP---------------KFHDCVEVNEFLTNDG 262

Query: 278 KIITFIPPDGEFDLMNYR--LTTPIKPLIWCD-VNIQVHSKSRIEIHCRAKAQIKKKSIA 334
            II FIPPDG+F LM Y   L++    LI C+  N   +S    EI        K   I 
Sbjct: 263 NIIKFIPPDGKFQLMEYSMALSSFNDNLISCNFTNGLGNSNDEFEITLNINKSNKVPKI- 321

Query: 335 NNVEILIPVPDDADTPQF--------RYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQ 386
           NN+++ +   +     +         R+ +G   W+ +   +   L    G  E     +
Sbjct: 322 NNLQVCLNFENREGQSKVKILRNTHGRFEYGKNTWIFDSELLTGTLPVLRGCVEEETKNE 381

Query: 387 LHLPSVDGVE-------PPKVRRPV---QVKFQIPYFT-TSGIQVRYLKVNEPKLQYKSY 435
                +DG          P++R  +   Q + Q+P  T  S I +R    + P+ Q + +
Sbjct: 382 -EDGGIDGEGRRILSKLRPELRSVIMSFQYEGQLPSGTRVSSINIRNDSTSNPQRQ-QLF 439

Query: 436 PWVRYITQSGEDYTIR 451
             V+Y+T++  +Y IR
Sbjct: 440 KGVKYVTKT-SNYEIR 454

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 81/333 (24%), Positives = 131/333 (39%), Gaps = 95/333 (28%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQQGQVLR----------SEIVGAVRVRSRLSG 215
           V WR  G+ Y  NE ++D+ ESI+++  + G+  R            I G   V+  LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 216 MPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFE 275
            P + L                +D + +   +P                FH+CV L   +
Sbjct: 271 NPTVDL---------------QLDLAGNDLGVP---------------AFHECVELDNHQ 300

Query: 276 NEK--IITFIPPDGEFDLMNYR--LTTP----------IKPLIWCDVNIQVHSKS-RIEI 320
           N     + FIPPDG F+LM Y   L TP             L+  D   Q+ +K+   EI
Sbjct: 301 NPSNCDLRFIPPDGRFNLMQYSIDLDTPRIQQTRRFNHTVGLVTIDFADQLGNKTDEFEI 360

Query: 321 -----HCRAKAQIKKKSIANNVEILIPVPDDADT----PQFRYSHGSI---------KWL 362
                + R  A I+   I  +V++     +D++T       R +HG            W+
Sbjct: 361 TVNISNSREVANIEDLRI--DVQLQSNTDEDSETDFKIKVLRNTHGRFDNSVVPGQGSWI 418

Query: 363 PEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVR-RPVQVKFQIPYFTTSGIQVR 421
            +K+     L    G              V+  EP  +R + V   + +     SGI+V+
Sbjct: 419 FDKDTPTGTLPVLRG-------------CVESTEPRLLRVQRVTASYSLSGQLASGIRVK 465

Query: 422 YLKVNEPKLQYKS---YPWVRYITQSGEDYTIR 451
            + + +  L  KS   +  V+Y T++G D+ IR
Sbjct: 466 AINIGQ--LTTKSNRPFKGVKYATKTG-DFEIR 495

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 67/149 (44%), Gaps = 46/149 (30%)

Query: 165 SVSWRPEGITYKKNEAFLDIIESINMLVTQQG----------QVLRSEIVGAVRVRSRLS 214
           +V WR   + +  NE +LD++ESI++++  +           +++   I+G   V+S L+
Sbjct: 201 AVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSVLN 260

Query: 215 GMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLS-- 272
           G P +++ I+  G                               +LE +  H+CV+    
Sbjct: 261 GNPIVEMKIDMAGN------------------------------DLESIFLHECVKSKDV 290

Query: 273 ----KFENEKIITFIPPDGEFDLMNYRLT 297
               +FEN K+I F+PPDG F L +Y + 
Sbjct: 291 DKDQEFENTKLIKFLPPDGSFKLFDYNIN 319

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 107/281 (38%), Gaps = 68/281 (24%)

Query: 49  CIMHK---GIHYLFIKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYV-KIVVEES- 103
           C  H    G+ Y  ++ ++I           N  + F+FL  +  +L +Y  K V++ S 
Sbjct: 65  CSYHSPADGLRYWCLQRTEI-----GEGSTPNPVEPFVFLQTVDTILNQYFGKDVLKASK 119

Query: 104 VRDNFVIIYELLDEMMDFGIPQITETKMLKKYITQXXXXXXXXXXXXXXXNAARPPAE-- 161
           +  N+  +  L + M+D G P IT+   LK+ +                       AE  
Sbjct: 120 ITKNYDRVTLLFNSMVDAGEPDITDLNRLKEIVPLKNNFARVINSTASSIGKTISNAEGN 179

Query: 162 -----------LTNSVS---------WRPEGITYKKNEAFLDIIESINMLVTQQGQV--- 198
                      + +SVS         WR  G+ Y  NE ++D+ E++N+++ +       
Sbjct: 180 QMFSKHSSNSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSL 239

Query: 199 --LRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKP 256
             +   I G V  +  LS  P ++L +N  G                   IP        
Sbjct: 240 VPISGSIDGEVGFKCYLSENPLVELDLNTNG---------------HDLGIP-------- 276

Query: 257 QIELEDLKFHQCVRLSKFE-NEKIITFIPPDGEFDLMNYRL 296
                   FH+CVR    + +   + FIPPDG+F LM Y +
Sbjct: 277 -------AFHRCVRTEGSDFHPGTLRFIPPDGDFCLMEYNI 310

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 71/153 (46%), Gaps = 36/153 (23%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQQG------------------QVLRSEIVGAV 207
           V WR   + Y  NE ++D+IE I+++  ++                   +++R++I+G +
Sbjct: 256 VPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGEL 315

Query: 208 RVRSRLSGMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQ 267
            VRS LS  P +++ + DR    NY        S   T   E   D   Q+ L    FH 
Sbjct: 316 NVRSYLSDNPMVEVTLVDR----NY--------SDQKTGWSE--NDLFKQLNLGLPMFHD 361

Query: 268 CVRLS--KFENEKI--ITFIPPDGEFDLMNYRL 296
           CV +   K  N+    I FIPPDG+F LM Y +
Sbjct: 362 CVEIDYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 60/136 (44%), Gaps = 35/136 (25%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQ---QGQVL--RSEIVGAVRVRSRLSGMPDLK 220
           V WR  G+ Y  NE ++D++E+I++++ +    GQ++  R  I G V  RS L+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 221 LGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKII 280
           L +N             + G     P                   H C +     + + +
Sbjct: 246 LKLN-------------LHGHDLGVP-----------------ALHPCCQAQYTGSPENL 275

Query: 281 TFIPPDGEFDLMNYRL 296
            F+PPDG+F LM Y +
Sbjct: 276 QFVPPDGKFRLMQYTI 291

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 63/144 (43%), Gaps = 36/144 (25%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQQG-----QVLRSEIVGAVRVRSRLSGMPDLK 220
           V WR   + Y  +E ++DIIE+++++          Q++   I G V V+S LSG P ++
Sbjct: 192 VPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVE 251

Query: 221 LGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKII 280
           + +             ++ G+    P                   HQCV + +  +   +
Sbjct: 252 MDM-------------DLAGNEMYAP-----------------SMHQCVEMPQ-GSPSSL 280

Query: 281 TFIPPDGEFDLMNYRLTTPIKPLI 304
            FIPPDG  +L+NY +   + P +
Sbjct: 281 CFIPPDGNCNLLNYTIDLDMNPKV 304

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 69/150 (46%), Gaps = 50/150 (33%)

Query: 168 WRPEGITYKKNEAFLDIIESINML----VTQQGQVLRSE----------IVGAVRVRSRL 213
           WR + + +  NE ++D++ES++++    + +  ++ RS+          + G   V+S L
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 214 SGMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSK 273
           +G P ++L +         L  N++   S                      FH+CV + +
Sbjct: 263 NGNPLVELQLE--------LSGNDIGHPS----------------------FHECVDIDE 292

Query: 274 F----ENEKI--ITFIPPDGEFDLMNYRLT 297
           +    +N  I  + FIPPDG+F LM+Y +T
Sbjct: 293 YLKNIDNSSISSLKFIPPDGKFTLMDYTIT 322

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 64/138 (46%), Gaps = 38/138 (27%)

Query: 166 VSWRPEGIT-YKKNEAFLDIIESINMLVTQQGQVLR---SEIVGAVRVRSRLSGMPDLKL 221
           V WR    + ++ NE ++D++E+ ++++ ++   LR    +I GAV VRS L+  P + +
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLVSV 258

Query: 222 GINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENE---K 278
            +N  G               +   IP                 H+CV ++  + E    
Sbjct: 259 KLNTMG---------------NEIGIPS---------------LHECVEIND-DGEFTPS 287

Query: 279 IITFIPPDGEFDLMNYRL 296
            ITFIPPDG+F L+ Y +
Sbjct: 288 NITFIPPDGKFRLLEYSI 305

>KNAG0D03000 Chr4 complement(537905..539596) [1692 bp, 563 aa] {ON}
           Anc_3.575 YFR051C
          Length = 563

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 63/125 (50%), Gaps = 8/125 (6%)

Query: 11  AGKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFIKHSDIYV 67
            GK +L+R+++D   D  +  + NFS L L     +G     +  + + +++    D Y+
Sbjct: 12  GGKALLSRQFKDLSRDRVLELLSNFSNLALA---SSGTDHTYVEDEHVRFVYKPLDDYYI 68

Query: 68  VALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFG-IPQI 126
           V L T+ Q+N+ +    L+   E +  YV  V E+ V DN   I    DE++  G   Q+
Sbjct: 69  V-LVTNRQSNIIRDLATLNLFAETVGVYVSGVPEDGVFDNAFEILSAFDEIVVMGHKEQL 127

Query: 127 TETKM 131
           ++T++
Sbjct: 128 SQTQV 132

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
           Ashbya gossypii AFR274C
          Length = 537

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 1   MVSGIYFCDNAGKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHY 57
           +V  +     +GKP+L+R++RD   D  +  + NF  L+     E   +      + + Y
Sbjct: 2   VVLAVSITTKSGKPLLSRQFRDITKDRVMELLSNFQNLVASSSREHTFVE----EEHVRY 57

Query: 58  LFIKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDE 117
           ++I   D Y++ L T+ Q+N+ Q    L+   + +   +K   EE + ++   I    DE
Sbjct: 58  IYIPFDDYYII-LITNRQSNIIQDMDTLNLFSQTVNSNLKGFSEEDMLNSAFDILGSFDE 116

Query: 118 MMDFG 122
           ++  G
Sbjct: 117 IISLG 121

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/333 (20%), Positives = 117/333 (35%), Gaps = 95/333 (28%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQQG---------------QVLRSEIVGAVRVR 210
           V WR  GI   K E ++D+ E + +   +                 +++   I G + VR
Sbjct: 189 VPWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVR 248

Query: 211 SRLSGMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVR 270
             L+G P + L  +  G               +   IP                FH CV 
Sbjct: 249 CYLNGNPTVSLMFDTMG---------------NDLGIPS---------------FHACVE 278

Query: 271 LS-------------KFENEKIITFIPPDGEFDLMNYRLT----TPIKPLIWCDVNIQVH 313
                           F+ ++++ F+PPDG+F L  Y +       +   +  D  IQV 
Sbjct: 279 QEDQVQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQYVIDLDGQGGMSRRMDRDGLIQVS 338

Query: 314 -------SKSRIEIHCRAKAQIKKKSIANNVEILIPV-----PDDADTPQFRYSHGSIKW 361
                  +K   E+    +  I   ++ + VE L+        +D++    R +HG+   
Sbjct: 339 FEDGLGLNKDEFEVRLHVRESI---AVVDPVEDLVVTLQFSNGNDSNVKMLRATHGTFVG 395

Query: 362 LPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGV---------EPPKVRRPVQVKFQIPY 412
             E     W+  S     E S      LP + G          +       V V++  P 
Sbjct: 396 QDEDRQCSWRFDS----DEISAGT---LPVLRGCIDDSKHVQQKKRSCLTSVAVRYGYPG 448

Query: 413 FTTSGIQVRYLKVN--EPKLQYKSYPWVRYITQ 443
              SG +V  L V+   P+++ K +  VR +T+
Sbjct: 449 ELASGCRVTRLDVDVASPRVRGKVFKGVRCVTR 481

>KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 536

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 65/140 (46%), Gaps = 8/140 (5%)

Query: 1   MVSGIYFCDNAGKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHY 57
           +V  +      GKP+L+R++RD   D  +  + NF  L+    ++   +      + + Y
Sbjct: 2   VVLAVSITTRKGKPLLSRQFRDITKDRVMELLSNFQTLVANSSKQHTFVE----DEHVRY 57

Query: 58  LFIKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDE 117
           ++    D Y++ L T+  +N+ Q    L+  V+ ++  +K + EE V D+   I    DE
Sbjct: 58  VYKPFDDYYII-LITNLHSNIIQDMDTLNIFVQTVDSTLKGLSEEDVFDSAFDILNSFDE 116

Query: 118 MMDFGIPQITETKMLKKYIT 137
           ++  G  +      +K ++ 
Sbjct: 117 IITMGYKENLSLTQIKTFLA 136

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 61/138 (44%), Gaps = 38/138 (27%)

Query: 166 VSWRPEGIT-YKKNEAFLDIIESINMLVTQQGQVLR---SEIVGAVRVRSRLSGMPDLKL 221
           V WR    + ++ NE ++D++E+ +++   +   LR     I G V VRS L+  P + +
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 222 GINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKI-- 279
            +N  G               +   +P                 H+CV + K + E +  
Sbjct: 259 KLNTMG---------------NDIGVP---------------TLHECVEI-KDDGEFLPS 287

Query: 280 -ITFIPPDGEFDLMNYRL 296
            ITFIPPDG+F L+ Y +
Sbjct: 288 NITFIPPDGKFRLLEYSV 305

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 60/130 (46%), Gaps = 8/130 (6%)

Query: 11  AGKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFIKHSDIYV 67
           +GKP+L+R++R+   D  +  + NF  L+  L  E   +        + Y++    D Y+
Sbjct: 12  SGKPLLSRQFRELTKDRVLELLSNFQSLVTNLSSEHTFVE----GNHVRYVYRPFDDYYI 67

Query: 68  VALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFGIPQIT 127
           + L T+ Q+N+ +    L+ L + +   +    E  + D+   I    DE++  G  +  
Sbjct: 68  I-LITNRQSNIIEDLSTLNLLSQTVNNCLSSYDENEIYDSAFEILTAFDEVVIMGYKENL 126

Query: 128 ETKMLKKYIT 137
            +  +  Y+T
Sbjct: 127 SSTQVTTYLT 136

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 60/140 (42%), Gaps = 43/140 (30%)

Query: 166 VSWRPEGIT-YKKNEAFLDIIESINMLVTQQGQVLR---SEIVGAVRVRSRLSGMPDLKL 221
           V WR    + ++ NE ++D++E+ +++  ++   LR     I G V VRS L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAV 258

Query: 222 GINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKI-- 279
            +N  G               +   IP                 H CV +    N+ +  
Sbjct: 259 KLNTMG---------------NDIGIPS---------------LHDCVEI----NDGVFS 284

Query: 280 ---ITFIPPDGEFDLMNYRL 296
              ITFIPPDG+F L+ Y +
Sbjct: 285 PSNITFIPPDGKFRLLEYSV 304

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 59/135 (43%), Gaps = 36/135 (26%)

Query: 166 VSWRPEGIT-YKKNEAFLDIIESINMLVTQQGQVLR---SEIVGAVRVRSRLSGMPDLKL 221
           V WR    + ++ NE +LD++E+ +++  ++   +R     I G + VRS L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 222 GINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFE--NEKI 279
            +N  G               +   IP                 H+CV ++     +   
Sbjct: 259 KLNTMG---------------NDIGIPS---------------LHECVEINDGGVFSPSN 288

Query: 280 ITFIPPDGEFDLMNY 294
           ITFIPPDG+F L+ Y
Sbjct: 289 ITFIPPDGKFRLLEY 303

>AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR051C
           (RET2)
          Length = 532

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 1   MVSGIYFCDNAGKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHY 57
           +V  +     +GKP+++R+++D   D  +  + NF  L+     +   +      + + Y
Sbjct: 2   VVLAVSITTRSGKPLVSRQFKDISRDRIMELLSNFQGLVANSSRQHTFVE----EEHVRY 57

Query: 58  LFIKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDE 117
           ++    D Y++ L T+ Q+N+ Q    L+   + +  ++K   E+ + DN   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIIQDMDTLNLFSQTVNSHLKGFSEDEILDNAFDILGSFDE 116

Query: 118 MMDFG 122
           ++  G
Sbjct: 117 IISLG 121

>NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa]
           {ON} Anc_3.575 YFR051C
          Length = 540

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 53/114 (46%), Gaps = 8/114 (7%)

Query: 12  GKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFIKHSDIYVV 68
           GKP+L+R++RD   D  +  + NF  L+  +  +   +      + + Y++    D Y++
Sbjct: 13  GKPLLSRQFRDLTKDRVMELLSNFQGLVANISSDHTFVE----DEHVRYVYKPFDDYYII 68

Query: 69  ALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFG 122
            L T+ Q+N+ Q    L+   + +   +    E  + DN   I    DE++  G
Sbjct: 69  -LITNRQSNIVQDLSTLNLFSQTVNSSLSNFDENEIYDNAFEILSSFDEIVVMG 121

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 33/103 (32%)

Query: 197 QVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKP 256
           + +R  I G+V +R  L+G P +++ +   G+                  IP        
Sbjct: 276 EYVRGNISGSVDMRCFLTGNPLVEIALKQGGL---------------DIGIP-------- 312

Query: 257 QIELEDLKFHQCV-RLSKFENEKI--ITFIPPDGEFDLMNYRL 296
                   FH CV + S  + EKI  ++FIPPDG F LM Y +
Sbjct: 313 -------GFHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQYNI 348

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 25/114 (21%), Positives = 55/114 (48%), Gaps = 8/114 (7%)

Query: 12  GKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFIKHSDIYVV 68
           GKP+L+R+++D   D  +  + NF  L+ ++  +   +      K + Y++ +  D Y +
Sbjct: 66  GKPLLSRQFKDLSKDRVLELLSNFQNLVTEISSDHTFVE----DKHVRYVY-RPFDNYYI 120

Query: 69  ALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFG 122
            L T+ Q+N+ +    L+   + +  Y+    ++ +  N   I    DE++  G
Sbjct: 121 ILITNRQSNIIKDLSTLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 174

>KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 633

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 57/129 (44%), Gaps = 8/129 (6%)

Query: 12  GKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFIKHSDIYVV 68
           GKP+L+R++RD   D     + NF  L+ +   +   +      + + Y++    D Y++
Sbjct: 109 GKPLLSRQFRDISKDRVTELLSNFQGLVAKSSSQHTFVED----EHVRYVYKPFDDYYII 164

Query: 69  ALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFGIPQITE 128
            L T+ Q+N+ Q    L    + +  Y+    E  + +N   I    DE++  G  +   
Sbjct: 165 -LITNRQSNIIQDLDTLKLFSQSMNTYLSSFDENEIFENAFEILSSFDEVITMGYKENLS 223

Query: 129 TKMLKKYIT 137
              +  Y++
Sbjct: 224 ISQINTYLS 232

>Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON}
           YFR051C (REAL)
          Length = 546

 Score = 37.4 bits (85), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 25/114 (21%), Positives = 55/114 (48%), Gaps = 8/114 (7%)

Query: 12  GKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFIKHSDIYVV 68
           GKP+L+R+++D   D  +  + NF  L+ ++  +   +      K + Y++ +  D Y +
Sbjct: 13  GKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVE----DKHVRYVY-RPFDNYYI 67

Query: 69  ALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFG 122
            L T+ Q+N+ +    L+   + +  Y+    ++ +  N   I    DE++  G
Sbjct: 68  ILITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 121

>TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 37.0 bits (84), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 58/129 (44%), Gaps = 8/129 (6%)

Query: 12  GKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFIKHSDIYVV 68
           GKP+L+R++ D   D  +  + NF  L+ +   E   +      + + YL+    D Y++
Sbjct: 13  GKPLLSRQFTDVTKDRVMELLSNFQGLVAKGSSEHTYVED----EHVRYLYKPFDDYYLI 68

Query: 69  ALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFGIPQITE 128
            + T+ Q+N+ Q    L    + +  Y+    E  + +N   I    DE++  G  +   
Sbjct: 69  -IITNRQSNIIQDLSTLSLFSQTMNTYLASFDETDIFENAFEILSSFDEIIVMGYKENLT 127

Query: 129 TKMLKKYIT 137
              ++ Y+T
Sbjct: 128 MAQVETYLT 136

>YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}
           RET2Delta subunit of the coatomer complex (COPI), which
           coats Golgi-derived transport vesicles; involved in
           retrograde transport between Golgi and ER
          Length = 546

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/114 (21%), Positives = 55/114 (48%), Gaps = 8/114 (7%)

Query: 12  GKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFIKHSDIYVV 68
           GKP+L+R+++D   D  +  + NF  L+ ++  +   +      K + Y++ +  D Y +
Sbjct: 13  GKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRYVY-RPFDNYYI 67

Query: 69  ALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFG 122
            L T+ Q+N+ +    L+   + +  Y+    ++ +  N   I    DE++  G
Sbjct: 68  ILITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 121

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 60/159 (37%), Gaps = 60/159 (37%)

Query: 166 VSWRPEGITYKKNEAFLDIIESI-----NMLVTQQG-------------------QVLRS 201
           V WR   I   KNE ++D+ E I     N +  ++G                   +++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 202 EIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELE 261
            I G + VRS L+G P +++ +N               G+   TP               
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLN-------------TCGNDMGTP--------------- 350

Query: 262 DLKFHQCVRLS---KFENEKI---ITFIPPDGEFDLMNY 294
               H CV L      +++K+   + FIPPDG+F L  Y
Sbjct: 351 --SLHPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARY 387

>Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)
          Length = 546

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/114 (21%), Positives = 55/114 (48%), Gaps = 8/114 (7%)

Query: 12  GKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFIKHSDIYVV 68
           GKP+L+R+++D   D  +  + NF  L+ ++  +   +      K + Y++ +  D Y +
Sbjct: 13  GKPLLSRQFKDLSKDRVLELLANFQNLVAEISSDHTFVED----KHVRYVY-RPFDNYYI 67

Query: 69  ALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFG 122
            L T+ Q+N+ +    L+   + +  Y+    ++ +  N   I    DE++  G
Sbjct: 68  ILITNRQSNIIKDLATLNLFSQTINSYLSSFHDQEIFHNAFEILSSFDEIVSMG 121

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 54/136 (39%), Gaps = 35/136 (25%)

Query: 166 VSWRPEGITYKKNEAFLDIIESINMLVTQQG----QVLRSEIVGAVRVRSRLSGMPDLKL 221
           V WR   ++   NE ++D++E++ + + Q       V    I G + ++  L G P +++
Sbjct: 195 VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQI 254

Query: 222 GINDRGIFSNYLEENNVDGSSSSTPIPEGVEDKKPQIELEDLKFHQCVR-LSKFENEKII 280
            ++  G                           KP         H+C+   S   +   +
Sbjct: 255 NLHSAG------------------------HAFKPS------ALHRCLDPSSSSFDSSSL 284

Query: 281 TFIPPDGEFDLMNYRL 296
            FIPPDG+F L+ Y +
Sbjct: 285 RFIPPDGKFTLLEYTI 300

>SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 545

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 27/125 (21%), Positives = 56/125 (44%), Gaps = 8/125 (6%)

Query: 1   MVSGIYFCDNAGKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHY 57
           +V  +     +GKP+L+R++RD   D     + NF  L+     +       +  + + Y
Sbjct: 2   VVLAVSITTRSGKPLLSRQFRDISKDRVTELLSNFQGLVANSSSQH----TFVEDEHVRY 57

Query: 58  LFIKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDE 117
           ++    D Y++ L T+ Q+N+ Q    L+   + +   ++   E  + +N   I    DE
Sbjct: 58  VYKPFDDYYII-LITNRQSNIIQDLDTLNLFSQTVNSSLRSFDENEIFENAFEILGSFDE 116

Query: 118 MMDFG 122
           ++  G
Sbjct: 117 IIAMG 121

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 26/129 (20%), Positives = 58/129 (44%), Gaps = 8/129 (6%)

Query: 12  GKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFIKHSDIYVV 68
           GKP+L+R++R+   D  +  + NF  L+  +  +   +      + + Y++    D Y++
Sbjct: 13  GKPLLSRQFREITKDRVLELLSNFQSLVTNISSDHTFVE----DEHVRYVYRPFDDYYII 68

Query: 69  ALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFGIPQITE 128
            L T+ Q+N+      L+   + +  Y+    E  + +N   I    DE++  G  +   
Sbjct: 69  -LITNRQSNIIMDLSTLNLFSQTVNSYLSSYDEAEIFENAFEILSSFDEIVVMGYKENLS 127

Query: 129 TKMLKKYIT 137
              +  Y++
Sbjct: 128 ITQVNTYLS 136

>Kwal_26.9448 s26 complement(1221754..1223409) [1656 bp, 551 aa]
           {ON} YMR296C (LCB1) - Probable component of serine
           palmitoyltransferase, which catalyzes the first step in
           biosynthesis of long-chain sphingolipids [contig 73]
           FULL
          Length = 551

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 14/91 (15%)

Query: 59  FIKHSDIYV------VALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDN----- 107
           F K  D+ V      VAL  + Q + + ++ F H  +E LEE +  + E  V+DN     
Sbjct: 221 FTKRGDVIVADNRITVALQNALQLSRSTVYYFNHNDMESLEELLDQLQEREVKDNLPTIP 280

Query: 108 --FVIIYELLDEMMDF-GIPQITETKMLKKY 135
             F++   L   + D   +P++ E K   KY
Sbjct: 281 RKFIVTEGLFHSLGDIPNLPKLVELKRKYKY 311

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 33.9 bits (76), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 4/44 (9%)

Query: 258 IELEDLKFHQCVRLSKF----ENEKIITFIPPDGEFDLMNYRLT 297
            +L     H CV L        +   + FIPPDG+F LM Y +T
Sbjct: 280 CDLGTPALHDCVELDGVPEGPADHTTLKFIPPDGKFRLMEYSVT 323

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/129 (20%), Positives = 59/129 (45%), Gaps = 8/129 (6%)

Query: 12  GKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFIKHSDIYVV 68
           GKP+L+R++ +   D  +  + NF  L+  +  +       +  + + Y++    D Y++
Sbjct: 13  GKPLLSRQFVEMSKDRVMELLSNFQGLVANISSD----HTYVEDEHVRYVYKPFDDYYLI 68

Query: 69  ALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFGIPQITE 128
            L T+ Q+N+ Q    L+   + +  Y+    E  + +N   I    DE++  G  +   
Sbjct: 69  -LMTNRQSNIIQDLSTLNLFSQTVNYYLNSFDENEIFENAFEILSSFDEIIVMGHKENLT 127

Query: 129 TKMLKKYIT 137
            + +  YI+
Sbjct: 128 IQQVNNYIS 136

>TBLA0A01260 Chr1 (299419..299889) [471 bp, 156 aa] {ON} Anc_1.388
           YLR170C
          Length = 156

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%)

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMM 119
           +++ +Y +   T+   N   I   +H+ VE ++ Y   V E  +  NF   Y++LDEM+
Sbjct: 63  RYASLYFICGITAEVDNELLILEVIHRYVEAMDSYFGNVCELDIIFNFSKAYDILDEMI 121

>NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1.388
          Length = 156

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 2/75 (2%)

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMM- 119
           +++ +Y +   T    N       +H+ VE +++Y   V E  +  NF   Y++L+EM+ 
Sbjct: 63  RYASLYFICGITPDVDNELLTLEIIHKYVETMDQYFGNVCELDIIYNFTKAYDILNEMIM 122

Query: 120 -DFGIPQITETKMLK 133
            D  + + ++T +LK
Sbjct: 123 CDGSLAETSKTVVLK 137

>CAGL0B04983g Chr2 (484166..484636) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170c APS1 Clathrin coat assembly protein AP19
          Length = 156

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 2/77 (2%)

Query: 58  LFIKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDE 117
           +F +++ +Y +   T    N       +H+ VE ++ Y + V E  +  NF   Y++LDE
Sbjct: 60  VFRRYASLYFICGITIGHDNELLTLELIHRYVETMDTYFENVCELDIIFNFHKAYDILDE 119

Query: 118 --MMDFGIPQITETKML 132
             M D  I + ++ ++L
Sbjct: 120 LVMCDGAIAESSKKEVL 136

>Smik_10.348 Chr10 complement(533694..534137) [444 bp, 147 aa] {ON}
           YJR058C (REAL)
          Length = 147

 Score = 30.4 bits (67), Expect = 4.8,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 85  LHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFG-IPQITETKMLKK 134
           +H  VEVL+ +   V E  +  NF  +Y ++DEM   G I +I++  +L++
Sbjct: 89  IHLFVEVLDAFFGNVCELDIVFNFYKVYMIMDEMFIGGEIQEISKDMLLER 139

>YJR058C Chr10 complement(544732..545175) [444 bp, 147 aa] {ON}
           APS2Small subunit of the clathrin-associated adaptor
           complex AP-2, which is involved in protein sorting at
           the plasma membrane; related to the sigma subunit of the
           mammalian plasma membrane clathrin-associated protein
           (AP-2) complex
          Length = 147

 Score = 30.4 bits (67), Expect = 4.8,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 85  LHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFG-IPQITETKMLKK 134
           +H  VEVL+ +   V E  +  NF  +Y ++DEM   G I +I++  +L++
Sbjct: 89  IHLFVEVLDAFFGNVCELDIVFNFYKVYMIMDEMFIGGEIQEISKDMLLER 139

>KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.575
          YFR051C
          Length = 543

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 45/88 (51%), Gaps = 7/88 (7%)

Query: 12 GKPILARRYRD---DISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFIKHSDIYVV 68
          GKP+L+R+++D   D  +  + NF Q L+ L+  +      +    + Y++    D Y++
Sbjct: 13 GKPLLSRQFKDLSRDRVLELLSNF-QNLVSLKHSSN--HTFVEDDHVRYVYKPFDDFYII 69

Query: 69 ALTTSYQTNVAQIFMFLHQLVEVLEEYV 96
           L T+ Q+N+ Q    L+   + +  ++
Sbjct: 70 -LITNRQSNIVQDLSTLNLFSQTINAFL 96

>AFR124W Chr6 (662389..662859) [471 bp, 156 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR170C (APS1)
          Length = 156

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 2/79 (2%)

Query: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDE--M 118
           +++ ++ V   +  + N       +H+ VE ++ Y   V E  +  NF   Y +LDE  M
Sbjct: 63  RYASLFFVCGISPEEDNELLTLEIIHRFVETMDRYFGNVCELDIIFNFTRAYNILDELIM 122

Query: 119 MDFGIPQITETKMLKKYIT 137
            D    + ++T +LK   T
Sbjct: 123 CDGSFVESSKTDVLKNMAT 141

>KLLA0B06545g Chr2 (583095..583541) [447 bp, 148 aa] {ON} highly
           similar to uniprot|Q00381 Saccharomyces cerevisiae
           YJR058C APS2 Small subunit of the clathrin- associated
           adaptor complex AP-2 which is involved in protein
           sorting at the plasma membrane related to the sigma
           subunit of the mammalian plasma membrane clathrin-
           associated protein (AP-2) complex
          Length = 148

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%)

Query: 85  LHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFGIPQITETKMLKKYITQ 138
           +H  VEVL+ +   V E  +  NF   Y ++DEM   G  Q T  K L + I Q
Sbjct: 90  IHLFVEVLDSFFGNVCELDILFNFYKTYLVMDEMFIAGEIQTTSKKELLERIGQ 143

>ZYRO0E05236g Chr5 complement(399318..399788) [471 bp, 156 aa] {ON}
           highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 30/62 (48%)

Query: 58  LFIKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDE 117
           ++ +++ +Y +   T    N       +H+ VE ++ Y   V E  +  NF   Y +LDE
Sbjct: 60  VYRRYASLYFICGITPEADNELLTLEIIHRYVETMDTYFGNVCELDIIFNFGKAYAILDE 119

Query: 118 MM 119
           M+
Sbjct: 120 ML 121

>KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170C APS1 Small subunit of the clathrin- associated
           adaptor complex AP-1 which is involved in protein
           sorting at the trans-Golgi network homolog of the sigma
           subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 42/82 (51%), Gaps = 2/82 (2%)

Query: 58  LFIKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDE 117
           ++ +++ +Y +   +S   N       +H+ VE ++ Y   V E  +  NF   YE+L+E
Sbjct: 60  VYKRYASLYFICGISSDSDNELLTLEVIHRYVEAMDSYFNNVCELDIIFNFTKAYEILNE 119

Query: 118 MM--DFGIPQITETKMLKKYIT 137
           ++  D  + + ++  +L+  +T
Sbjct: 120 VLVCDGSMTETSKQAILRSVMT 141

>SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {ON}
           highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 29.6 bits (65), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 58  LFIKHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDE 117
           ++ +++ +Y V   +  + N       +H+ VE ++ Y   V E  +  NF   Y +LDE
Sbjct: 60  VYKRYASLYFVCGVSPDKDNELLTLEIIHRFVETMDRYFGNVCELDIIFNFNKAYSILDE 119

Query: 118 MM--DFGIPQITETKMLK 133
           ++  D  I + ++ ++LK
Sbjct: 120 VLICDGSITETSKKEVLK 137

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,734,404
Number of extensions: 2072881
Number of successful extensions: 5829
Number of sequences better than 10.0: 124
Number of HSP's gapped: 5791
Number of HSP's successfully gapped: 175
Length of query: 454
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 341
Effective length of database: 40,524,141
Effective search space: 13818732081
Effective search space used: 13818732081
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)