Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C043107.128ON20120110401e-146
Kpol_1062.557.128ON1822033617e-43
YIL009C-A (EST3)7.128ON1812013461e-40
Skud_9.1637.128ON1802033208e-37
Smik_9.1857.128ON1822023182e-36
NDAI0E036907.128ON1962113132e-35
KAFR0L004807.128ON1802043042e-34
NCAS0E021507.128ON1852063034e-34
Suva_9.1957.128ON1892092895e-32
Zrou_YGOB_EST37.128ON1681972772e-30
TDEL0H029007.128ON1882042765e-30
Sklu_YGOB_EST37.128ON1962072661e-28
CAGL0C03828g7.128ON1802002373e-24
KNAG0L009607.128ON1852082286e-23
ADL016C7.128ON2022032104e-20
Kwal_YGOB_EST37.128ON1922061947e-18
TBLA0A009607.128ON2151371755e-15
Kthe_YGOB_EST37.128ON1931961605e-13
KLLA0D14289g7.128ON1842081501e-11
Sklu_YGOB_Anc_7.128singletonOFF9894978e-05
ZYRO0C05258gsingletonOFF8793932e-04
Ecym_12143.514ON73697701.5
KLLA0C04191g3.177ON79743673.2
Smik_6.4766.3ON86866664.8
Suva_14.3192.304ON48459647.0
Suva_16.376.3ON87441647.5
NCAS0G031701.430ON33435639.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C04310
         (201 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa...   405   e-146
Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 ...   143   7e-43
YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp...   137   1e-40
Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 b...   127   8e-37
Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 b...   127   2e-36
NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 ...   125   2e-35
KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,...   121   2e-34
NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 ...   121   4e-34
Suva_9.195 Chr9 complement(324112..324381,324353..324373,324377....   115   5e-32
Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [5...   111   2e-30
TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 ...   110   5e-30
Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196...   107   1e-28
CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 a...    96   3e-24
KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558...    92   6e-23
ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, ...    86   4e-20
Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [57...    79   7e-18
TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 ...    72   5e-15
Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026...    66   5e-13
KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} simil...    62   1e-11
Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF} ...    42   8e-05
ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa] {OF...    40   2e-04
Ecym_1214 Chr1 (435623..437833) [2211 bp, 736 aa] {ON} similar t...    32   1.5  
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    30   3.2  
Smik_6.476 Chr6 complement(783396..786002) [2607 bp, 868 aa] {ON...    30   4.8  
Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026...    29   7.0  
Suva_16.37 Chr16 (50802..53426) [2625 bp, 874 aa] {ON} YPL268W (...    29   7.5  
NCAS0G03170 Chr7 (581715..582719) [1005 bp, 334 aa] {ON} Anc_1.4...    29   9.3  

>TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa]
           {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 201

 Score =  405 bits (1040), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 201/201 (100%), Positives = 201/201 (100%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIEDGKKNSIGKIGNLDELLNNTNVKLQLILKYPN 60
           MPKIILPSKVNLSPDSIFLKPWIKEFIEDGKKNSIGKIGNLDELLNNTNVKLQLILKYPN
Sbjct: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIEDGKKNSIGKIGNLDELLNNTNVKLQLILKYPN 60

Query: 61  QLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKNCLFLIGD 120
           QLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKNCLFLIGD
Sbjct: 61  QLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKNCLFLIGD 120

Query: 121 CIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPILQVNQVMI 180
           CIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPILQVNQVMI
Sbjct: 121 CIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPILQVNQVMI 180

Query: 181 FDWDQVVTFENYPFVYSQIPY 201
           FDWDQVVTFENYPFVYSQIPY
Sbjct: 181 FDWDQVVTFENYPFVYSQIPY 201

>Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 aa]
           {ON} (125085..125366,125368..125634) [549 nt, 183 aa]
          Length = 182

 Score =  143 bits (361), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 117/203 (57%), Gaps = 26/203 (12%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIEDGKKNSIGKIGNLDELLNNTNVK-----LQLI 55
           MPKIILPS  +   DS +L+ WI   I+    N+   I  LDE   N +       + LI
Sbjct: 1   MPKIILPSNKSSCVDSTYLQEWIDLIIDRNYDNTGEVIPILDEYGFNDSQSYMSSVINLI 60

Query: 56  LKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKNCL 115
           +K P    K+TN +N+++Y V+ SIRD K Q+L EFTSNCVS+FER Y  RIT+ T NCL
Sbjct: 61  IKKPYHFAKVTNFFNVVDYSVYASIRDRKFQVLSEFTSNCVSSFERLYNSRITENTINCL 120

Query: 116 FLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPILQV 175
           FLIGDC +K++T+ E+ + +K+D     N                      N LYP+L +
Sbjct: 121 FLIGDCKLKFMTYWEIKELYKLDLSSICNK---------------------NSLYPVLSI 159

Query: 176 NQVMIFDWDQVVTFENYPFVYSQ 198
           NQ  +FDW Q+ +FE + ++Y++
Sbjct: 160 NQARMFDWSQIKSFEKFDWIYNK 182

>YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp,
           181 aa] {ON}  EST3Component of the telomerase
           holoenzyme, involved in telomere replication
          Length = 181

 Score =  137 bits (346), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 107/201 (53%), Gaps = 28/201 (13%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIED-GKKNSIGKIGNLDELLNNTNVKLQ----LI 55
           MPK+IL S    + DS+FL+PWIK  IED  + +     G++   L   ++ L      I
Sbjct: 1   MPKVILESHSKPT-DSVFLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTI 59

Query: 56  LKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKNCL 115
           L  P    K+T  YN+ +Y V+ SIRD+ HQ+LVEF+  CVSNFER +  RIT +T NCL
Sbjct: 60  LTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFSQECVSNFERTHNCRITSETTNCL 119

Query: 116 FLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPILQV 175
            +IGD  + YVT+   + +FKI                       LS      + P+L V
Sbjct: 120 MIIGDADLVYVTNSRAMSHFKI----------------------CLSNISSKEIVPVLNV 157

Query: 176 NQVMIFDWDQVVTFENYPFVY 196
           NQ  IFD DQV +   +PFVY
Sbjct: 158 NQATIFDIDQVGSLSTFPFVY 178

>Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 bp,
           180 aa] {ON} YIL009C-A (REAL)
          Length = 180

 Score =  127 bits (320), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 110/203 (54%), Gaps = 33/203 (16%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIEDGK------KNSIGKIGNLDELLNNTNVKLQL 54
           MP+IIL S    + DSIFL+PWIK  ++D        +  I  +   D L+ + + +   
Sbjct: 1   MPRIILESHSKPA-DSIFLQPWIKALVKDNSDQHRPSERVIPSLTRQDLLVPHMSAQ--- 56

Query: 55  ILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQ-LLVEFTSNCVSNFERNYKIRITDQTKN 113
           IL  P    K+T  Y++ NY V  SIRD+ HQ LLVEF+  CVS+FER++  RIT +T N
Sbjct: 57  ILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETIN 116

Query: 114 CLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPIL 173
           CL +IGD  + YVT ++++  FKI                       +S    N + P+L
Sbjct: 117 CLMIIGDADLIYVTSNQVMARFKIR----------------------VSSISPNEILPVL 154

Query: 174 QVNQVMIFDWDQVVTFENYPFVY 196
           ++NQ  IFD DQV +   +PFVY
Sbjct: 155 KINQTTIFDIDQVGSLSTFPFVY 177

>Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 bp,
           182 aa] {ON} YIL009C-A (REAL)
          Length = 182

 Score =  127 bits (318), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 107/202 (52%), Gaps = 29/202 (14%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIED-GKKNSIGKIGNLDELLNNTNVKL----QLI 55
           MP+++L S    + DSIFL+PWIK  +ED  + +      ++  +L   ++KL      I
Sbjct: 1   MPRVVLESHSKPT-DSIFLQPWIKALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMSAKI 59

Query: 56  LKYPNQLVKLTNIYNILNYCVFGSIRDNKHQ-LLVEFTSNCVSNFERNYKIRITDQTKNC 114
           L  P    K+T  YN+ +Y V  SIRD+ HQ LLVEF+  CVSNFER +  RIT +T NC
Sbjct: 60  LTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVNC 119

Query: 115 LFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPILQ 174
           L +IGD  +   T   +  +FKI                       LS    N L P+LQ
Sbjct: 120 LMIIGDASLINATSSRVKSHFKIR----------------------LSSISSNDLVPVLQ 157

Query: 175 VNQVMIFDWDQVVTFENYPFVY 196
           +NQV IFD DQV +   +PFVY
Sbjct: 158 INQVTIFDIDQVGSLSAFPFVY 179

>NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 bp,
           196 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 196

 Score =  125 bits (313), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 118/211 (55%), Gaps = 27/211 (12%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWI----------KEFIEDGKKNSIGKIGNLDELLNNTNV 50
           MP++IL SK  +S DS+FL+PWI          K ++   ++ SI ++   D  ++   +
Sbjct: 1   MPRVILSSKQTVS-DSVFLQPWIANIIRKEIQAKTYLPGNQRLSIARLSRRD--MDAPEI 57

Query: 51  KLQLILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQ 110
             + IL   +   K+T  +++ NY +F SIRD+ +Q+LVEFT  CV  FER Y+ RIT +
Sbjct: 58  S-ETILNNYSHFAKVTKFFSVNNYKIFASIRDSTYQILVEFTPQCVLEFERVYRSRITSE 116

Query: 111 TKNCLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLY 170
           T NCLF+IGDC + Y T  ++  +F    LQ      +    +  K G+         L+
Sbjct: 117 TVNCLFVIGDCTVIYKTRSQIRSSFPKFDLQ-----SLAGEKNSNKNGF--------GLF 163

Query: 171 PILQVNQVMIFDWDQVVTFENYPFVYSQIPY 201
           P+LQ+NQ  +FD DQV     +PF+Y+++ +
Sbjct: 164 PVLQINQASLFDSDQVQLLFEFPFIYNKLHF 194

>KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,
           180 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 180

 Score =  121 bits (304), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 102/204 (50%), Gaps = 33/204 (16%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIEDGKKNSIGKIGNLDELLNNTNVK-------LQ 53
           MP + L S+ +  PDSIF+  WIK  +++  +  +  I      +NNTNV+         
Sbjct: 1   MPTVKLTSQ-HTRPDSIFIHDWIKPLLDENCQGLLRPIYRAIPPINNTNVRNPLSSRPSL 59

Query: 54  LILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKN 113
           L  K      K+   Y + N+ +F SIRD + Q+LVEFT +CVS FER  + R+T  T N
Sbjct: 60  LTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDTTN 119

Query: 114 CLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPIL 173
           C  LIGDC I+Y +  E+ +N++   L F N                       RL P+L
Sbjct: 120 CTLLIGDCSIEYKSSHEISQNYR---LNFPN----------------------KRLLPVL 154

Query: 174 QVNQVMIFDWDQVVTFENYPFVYS 197
            +NQ  I D DQ    E +PFVYS
Sbjct: 155 TINQASILDRDQATLLEQFPFVYS 178

>NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 bp,
           185 aa] {ON} Anc_7.128 YIL009C-A
          Length = 185

 Score =  121 bits (303), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 76/206 (36%), Positives = 111/206 (53%), Gaps = 28/206 (13%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIEDGKKNSIGKIGNLDE---LLNNTNVKLQL--- 54
           MP++IL SK++ + DSIFL+PWI+  + +  +      GN       LN  +++      
Sbjct: 1   MPRVILSSKLSQT-DSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSP 59

Query: 55  -ILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKN 113
            +L       K+T  + I NY +  SIRD++ QLLVEFT  CVSNFER +  R+T +T N
Sbjct: 60  KVLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETLN 119

Query: 114 CLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPIL 173
           CL +IGD  I Y + D++         QF N              +I+S +  + L PIL
Sbjct: 120 CLLVIGDAAIIYKSRDQITT-------QFGN------------IDFIIS-KNVSPLVPIL 159

Query: 174 QVNQVMIFDWDQVVTFENYPFVYSQI 199
           Q+NQ  +FD DQV    ++PFVYS +
Sbjct: 160 QINQASLFDGDQVQHLRSFPFVYSTL 185

>Suva_9.195 Chr9
           complement(324112..324381,324353..324373,324377..324652)
           [567 bp, 189 aa] {ON} YIL009C-A (REAL)
          Length = 189

 Score =  115 bits (289), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 74/209 (35%), Positives = 103/209 (49%), Gaps = 36/209 (17%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIEDGKKNSIGKIGNLDELLNNTNVKLQ----LIL 56
           MP++ L S  +   DSIFL+PWIK  I+D  ++      ++   L   ++ L      IL
Sbjct: 1   MPRVFLESN-SRQVDSIFLQPWIKLLIDDNSEHHHIPSDHVIPALAQQDLALPHMCPQIL 59

Query: 57  KYPNQLVKLTNIYNILNYCVFGSIRDNKHQLL---------VEFTSNCVSNFERNYKIRI 107
             P    ++T  YN+ +Y V+ S+RD+ HQ+L         VEF+  CVS+FER    RI
Sbjct: 60  TNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNFRI 119

Query: 108 TDQTKNCLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFN 167
           T +T NCL +IGD  + YVT  + L  F I                       LS    +
Sbjct: 120 TSETTNCLMIIGDADLAYVTSTQALARFMIR----------------------LSSISTS 157

Query: 168 RLYPILQVNQVMIFDWDQVVTFENYPFVY 196
              PIL +NQ  IFD DQV +  N+PFVY
Sbjct: 158 ETVPILIINQATIFDIDQVGSLNNFPFVY 186

>Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [507
           bp, 168 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 168

 Score =  111 bits (277), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 101/197 (51%), Gaps = 33/197 (16%)

Query: 1   MPKIILPSKVNLSP-DSIFLKPWIKEFIEDGKKNSIGKIGNLDELLNNTNVKLQL-ILKY 58
           MP+ I    V++ P DS+FL+PWI+  + +       ++       + +  +L   +L  
Sbjct: 1   MPQAI----VSVKPFDSVFLQPWIQTALAEHDPRLGDRLIPPVPTQDLSQPELSSKVLSN 56

Query: 59  PNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKNCLFLI 118
               VK+T  +++ +Y V+ SIRD+K QLLVEFT  CVS+FER Y  RIT +T NC+F+I
Sbjct: 57  IRHFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNCVFII 116

Query: 119 GDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPILQVNQV 178
            DC + Y +           P   +NH  I    +                 P+L+VNQ 
Sbjct: 117 ADCQLIYHS-----------PSYIENHYKIVTRGE----------------TPVLRVNQT 149

Query: 179 MIFDWDQVVTFENYPFV 195
            IFDWDQV + E YP V
Sbjct: 150 AIFDWDQVESLETYPLV 166

>TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 bp,
           188 aa] {ON} Anc_7.128 YIL009C-A
          Length = 188

 Score =  110 bits (276), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 111/204 (54%), Gaps = 24/204 (11%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWIKE----FIEDGKKNSIGKIGNLDELLNNTNVKLQL-- 54
           MPK IL S      D++FL PWI++     I D     +     + +L      K QL  
Sbjct: 1   MPKTILSSSSK-QKDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSP 59

Query: 55  -ILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKN 113
            IL+ P+  VK+   +++  + VF ++RD+ HQ+LVEFT  CVS FER ++ RIT +T++
Sbjct: 60  RILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETEH 119

Query: 114 CLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPIL 173
            LF+I DC + +   + +LKNF I               D K +    + +R + + P+L
Sbjct: 120 SLFIISDCKLYHRDRNYILKNFGI---------------DMKNWQSAANHKRCSTI-PVL 163

Query: 174 QVNQVMIFDWDQVVTFENYPFVYS 197
            VNQ   F+ DQ+ +FE++P++Y+
Sbjct: 164 IVNQASQFEMDQIESFEHFPYLYT 187

>Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196
           aa] {ON} ANNOTATED BY YGOB - Ribosomal frameshifting
           (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 196

 Score =  107 bits (266), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 108/207 (52%), Gaps = 34/207 (16%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWIKEFI--EDGKKNSIGKIGNL---------DELLNNTN 49
           MPK+ L S+ N   DSI+L  WI   I     +K +IG IG++          ++ ++ +
Sbjct: 1   MPKVALSSR-NKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVH 59

Query: 50  VKLQLILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITD 109
           +  ++IL +    +KLT  Y + NY V+ S RD+   +LVEFT+ CVSNFER +  RIT 
Sbjct: 60  LSRKIILNH-RHFIKLTKFYQVNNYQVYASARDSLCSILVEFTACCVSNFERLHHSRITS 118

Query: 110 QTKNCLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRL 169
           +T N LF+IGD  + ++    + + F ID  QF+  +                      L
Sbjct: 119 ETTNTLFVIGDVKLVFMDKASVSQKFGIDITQFNPQLN---------------------L 157

Query: 170 YPILQVNQVMIFDWDQVVTFENYPFVY 196
            PIL+VNQ  ++D DQV +   +PF Y
Sbjct: 158 VPILRVNQAFVYDMDQVESNRKFPFFY 184

>CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 aa]
           {ON} similar to uniprot|Q03096 Saccharomyces cerevisiae
           YIL009ca
          Length = 180

 Score = 95.9 bits (237), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 97/200 (48%), Gaps = 21/200 (10%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIEDGKKNS-IGKIGNLDELLNNTNVKLQLILKYP 59
           MP  I  S+ N + +S++L  W+++ + + K +  I  I  +D    +  +  + I    
Sbjct: 1   MPPFIPKSRSN-AVESVYLHGWVRDMLLESKTSQNIAVIPRVDPDEASIPLLSRRIYANR 59

Query: 60  NQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKNCLFLIG 119
              VK+T  + + NY V+ S++D++HQ+L +FT  CVS FE   + RIT  T N LF+IG
Sbjct: 60  RHFVKITKFFQVHNYSVYASVKDSQHQILSQFTPKCVSEFESRNRSRITSDTVNTLFMIG 119

Query: 120 DCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPILQVNQVM 179
           D  +  +  DEL   F            I   F+     YI          P L +NQ  
Sbjct: 120 DAKLGIMVVDELRHYFGEK---------IVSLFNGLDMPYI----------PYLIINQAF 160

Query: 180 IFDWDQVVTFENYPFVYSQI 199
           I D+DQV  F+  PFVY  I
Sbjct: 161 ILDYDQVEAFKMTPFVYQYI 180

>KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558
           bp, 185 aa] {ON} Anc_7.128 YIL009C-A ribosomal
           frameshifting
          Length = 185

 Score = 92.4 bits (228), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 97/208 (46%), Gaps = 32/208 (15%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIE---------DGKKNSIGKIGNLDELLNNTNVK 51
           MP + L    +   + IF  PWIK  ++            +  I K+   D L N T  K
Sbjct: 1   MPAVKLSQTGHKFQEWIFTHPWIKNLVKLPTEEISLMRPVRQIIPKLTTND-LKNPTRSK 59

Query: 52  LQLILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQT 111
              +LK      K+   Y++ NY VF  IRD++ QLLVEF   CVS FER +  RIT  T
Sbjct: 60  R--VLKNKTHFAKVMKFYSVHNYKVFACIRDSECQLLVEFHPECVSYFERFHHCRITSGT 117

Query: 112 KNCLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYP 171
            NCLF+IG+C ++Y +   +   F+I+ L                      +++     P
Sbjct: 118 VNCLFVIGNCDLEYRSVARVNDEFRINILP--------------------RKQKLMDQIP 157

Query: 172 ILQVNQVMIFDWDQVVTFENYPFVYSQI 199
           +L +NQ  + DW Q+     +PFV+ ++
Sbjct: 158 VLVINQATVADWGQMEAQTTFPFVHQEV 185

>ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, 202
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YIL009C-A (EST3)
          Length = 202

 Score = 85.5 bits (210), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 88/203 (43%), Gaps = 32/203 (15%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWIKEFI-----EDGKKNSIGKIGNLDELLNNTNVKLQL- 54
           MPK++L S+ + + DSIFL+ W+ + +       G       +      L      L L 
Sbjct: 1   MPKVVLASRAHKA-DSIFLREWLVDAVVPALERSGACAPWAGVECFIPALPPATATLSLE 59

Query: 55  --ILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTK 112
             +++ P + +++     + ++ V    RD    +LVEFT +CVSNFER Y  RIT  T 
Sbjct: 60  PTVIQNPKRFLRIVRFTRVHDFAVCAVARDAGCCILVEFTPHCVSNFERRYHQRITSSTV 119

Query: 113 NCLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPI 172
           N LF+IG+  + +    +    F++  L   +                          P+
Sbjct: 120 NSLFVIGNTSLLFYARSDAAAAFEVPALMNGSST-----------------------LPV 156

Query: 173 LQVNQVMIFDWDQVVTFENYPFV 195
           L+V    IFD DQV +   +P V
Sbjct: 157 LRVGDCAIFDQDQVESHRRFPLV 179

>Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [579
           bp, 192 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 192

 Score = 79.3 bits (194), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 97/206 (47%), Gaps = 35/206 (16%)

Query: 1   MPKIILPSKV--NLSPDSIFLKPWIKEFIEDGKKNSIG-----KIGNLDELLNNTNVKLQ 53
           MPK   PS +      +S FL+ WI++ + +  K  +       +      +  ++  +Q
Sbjct: 1   MPK---PSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPMQ 57

Query: 54  L---ILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQ 110
           L   +L+     +K+T  + I N+ V+ S RD+  Q+LVEFT  CVS FER + +RIT +
Sbjct: 58  LSSQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITAR 117

Query: 111 TKNCLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLY 170
           T N +FLIG   IKY+   E+ + +       D  I +                      
Sbjct: 118 TVNTIFLIGAVTIKYIPIYEVRETWCWAS-DLDTRIPV---------------------L 155

Query: 171 PILQVNQVMIFDWDQVVTFENYPFVY 196
           P+L VN+  +FD DQV +   + ++Y
Sbjct: 156 PVLVVNECTVFDLDQVESRRKFNYLY 181

>TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 bp,
           215 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 215

 Score = 72.0 bits (175), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 71/137 (51%), Gaps = 14/137 (10%)

Query: 61  QLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKNCLFLIGD 120
            ++K+T  + + NY +  S++D + Q+LVE T  CV+ +ER  + R+T  T +CLF+IGD
Sbjct: 91  HIIKITKFFKVNNYKICASVQDAECQILVELTPICVTEYERKTRDRMTSNTLDCLFVIGD 150

Query: 121 CIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPILQVNQVMI 180
           C + +   +E+L NF  +   F N I      D             + L P+L +NQ++ 
Sbjct: 151 CRLYFQNKNEVLHNFNCN--TFRNIIPGLNALD------------RDSLIPVLVINQIIC 196

Query: 181 FDWDQVVTFENYPFVYS 197
            D     +    PF++S
Sbjct: 197 VDRHPSKSLSTLPFLHS 213

>Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026)
           [582 bp, 193 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006).
           Replaces KLTH0F12606g.
          Length = 193

 Score = 66.2 bits (160), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 90/196 (45%), Gaps = 32/196 (16%)

Query: 15  DSIFLKPWI-KEFIEDGKKNSIGKI--------GNLDELLNNTNVKLQLILKYPNQLVKL 65
           +S+FL+ WI  + +   K+++   I          L +L  +   K +++L      +K+
Sbjct: 14  ESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKSEILLNR-RHFLKI 72

Query: 66  TNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKNCLFLIGDCIIKY 125
           TN + +  + VF S RDN  ++LVEFT  CVS FER   IRIT +T N + LIG   +KY
Sbjct: 73  TNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTVNTILLIGSGTLKY 132

Query: 126 VTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPILQVNQVMIFDWDQ 185
           +   E                       + ++   +       + P+L V Q  +FD DQ
Sbjct: 133 LPVHE----------------------AYTQWSLSIPLDPRVPVVPVLVVEQCAVFDLDQ 170

Query: 186 VVTFENYPFVYSQIPY 201
           V    ++ ++Y   P+
Sbjct: 171 VEARPSFDYLYQLTPF 186

>KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} similar
           to uniprot|Q03096 Saccharomyces cerevisiae YIL009C-A
           EST3 Component of the telomerase holoenzyme involved in
           telomere replication
          Length = 184

 Score = 62.4 bits (150), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 99/208 (47%), Gaps = 35/208 (16%)

Query: 1   MPKIILPSKVNLSPDSIFLKPWIKE-----FIEDGKKNSIGKIGNL-DELLNNTNVK--L 52
           MP ++L S++  + DS+FL+ WIK      ++++ K     +   L  +LL +  ++   
Sbjct: 1   MPNVVLSSRLT-NNDSVFLQEWIKPSVRPYYLKNEKTKFWPEQRELVTDLLEHDIIESAF 59

Query: 53  QLILK-YPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQT 111
           Q  L   P + V++   + + +Y V+ +IRD+   +L  FT +CV ++E     RIT  T
Sbjct: 60  QTALNPAPQRFVRIVKFHRVNDYTVYATIRDSTALILCYFTVDCVLDYETINNDRITLNT 119

Query: 112 KNCLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYP 171
            N LF+IG+                   LQF NH     +F+    G         R+ P
Sbjct: 120 LNTLFVIGNVT-----------------LQFWNHRECKLWFNQDFPGL--------RMVP 154

Query: 172 ILQVNQVMIFDWDQVVTFENYPFVYSQI 199
           +L++ +  +FD DQ+ +   + +VY  +
Sbjct: 155 VLKIEKARMFDRDQISSNVQFEWVYDTL 182

>Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF}
          ANNOTATED BY YGOB -
          Length = 98

 Score = 42.0 bits (97), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 50/94 (53%), Gaps = 13/94 (13%)

Query: 1  MPKIILPSKVNLSPDSIFLKPWIKEFI--EDGKKNSIGKIGNL---------DELLNNTN 49
          MPK+ L S+ N   DSI+L  WI   I     +K +IG IG++          ++ ++ +
Sbjct: 1  MPKVALSSR-NKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVH 59

Query: 50 VKLQLILKYPNQLVKLTNIYNILNYCVFGSIRDN 83
          +  ++IL +    +KLT  Y + NY V+ S RD+
Sbjct: 60 LSRKIILNH-RHFIKLTKFYQVNNYQVYASARDS 92

>ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa]
          {OFF} some similarities with uniprot|Q03096
          Saccharomyces cerevisiae YIL009C-A
          Length = 87

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 47/93 (50%), Gaps = 12/93 (12%)

Query: 1  MPKIILPSKVNLSP-DSIFLKPWIKEFIEDGKKNS----IGKIGNLDELLNNTNVKLQLI 55
          MP+ I    V++ P DS+FL+PWI+  + +         I  +   D      + K   +
Sbjct: 1  MPQAI----VSVKPFDSVFLQPWIQTALAEHDPRLGDRLIPPVPTQDLSQPELSSK---V 53

Query: 56 LKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLL 88
          L      VK+T  +++ +Y V+ SIRD+K QLL
Sbjct: 54 LSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLL 86

>Ecym_1214 Chr1 (435623..437833) [2211 bp, 736 aa] {ON} similar to
           Ashbya gossypii AER358C
          Length = 736

 Score = 31.6 bits (70), Expect = 1.5,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 8/97 (8%)

Query: 10  VNLSPDSIFLKPWIKEFIEDGKKNSIGKIGNLDELLNNTNVKLQLILKYPNQLVKLTN-- 67
           VN  P   +LK    + +      SIG + NLD+  +   V L   LKY  ++V+     
Sbjct: 506 VNYDPSLSYLKTDFVQKVVFSSTKSIGNLANLDDYRDIWAVALIKYLKYCGEIVRKNKDP 565

Query: 68  ------IYNILNYCVFGSIRDNKHQLLVEFTSNCVSN 98
                 + +I  +  F S+    H+ L   T +CVS+
Sbjct: 566 NSISKALVSIAKFHAFHSMLQEFHRKLSSDTDSCVSD 602

>KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 797

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 49  NVKLQLILKYPNQLVKLTNIYNILNYCVFGSIRD-NKHQLLVE 90
           N++ Q I++Y   + K   +Y IL YC  GS+RD  KH  L+E
Sbjct: 61  NLRHQNIVEYRGFIQKAHELYIILEYCARGSLRDILKHGPLLE 103

>Smik_6.476 Chr6 complement(783396..786002) [2607 bp, 868 aa] {ON}
           YPL268W (REAL)
          Length = 868

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 100 ERNYKIRITDQTKNCLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGY 159
           E+   +  TD  K C     D    YV+  +LL+ F++  +   NH G+  YF+F+K+  
Sbjct: 248 EKKDTLSFTDVKKLC-----DKFHTYVSTGQLLQFFQLADI---NHNGLLNYFEFEKFVR 299

Query: 160 ILSERR 165
           IL  R+
Sbjct: 300 ILKNRK 305

>Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 29.3 bits (64), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 120 DCIIKYVTHDELLKNFKI-DPLQFDNHIGI--TEYFDFKKYGYILSERRFNRLYPILQV 175
           D I+K +T  +L+KN  + +     +HI +   + F F+ Y YI  E+  + + P+++V
Sbjct: 53  DTILKSITLGQLVKNADVLNKRLCQHHIALDAKQSFHFQDYKYISDEKGIHDMVPLMEV 111

>Suva_16.37 Chr16 (50802..53426) [2625 bp, 874 aa] {ON} YPL268W
           (REAL)
          Length = 874

 Score = 29.3 bits (64), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 125 YVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERR 165
           YV+  +LL+ F++  +   NH G+  YF+F+K+  IL  R+
Sbjct: 268 YVSTGQLLQAFQMADI---NHNGLLNYFEFEKFIKILRNRK 305

>NCAS0G03170 Chr7 (581715..582719) [1005 bp, 334 aa] {ON} Anc_1.430
           YCR015C
          Length = 334

 Score = 28.9 bits (63), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 9/35 (25%), Positives = 24/35 (68%)

Query: 167 NRLYPILQVNQVMIFDWDQVVTFENYPFVYSQIPY 201
           ++L PI ++  ++I D+D+ +T ++   + +++PY
Sbjct: 14  HKLQPITKMKNILITDFDETITAKDTTTILAKLPY 48

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.144    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,498,017
Number of extensions: 1156287
Number of successful extensions: 3581
Number of sequences better than 10.0: 72
Number of HSP's gapped: 3612
Number of HSP's successfully gapped: 72
Length of query: 201
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 97
Effective length of database: 41,556,135
Effective search space: 4030945095
Effective search space used: 4030945095
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 63 (28.9 bits)