Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C041802.532ON26425612181e-171
Kpol_1018.342.532ON2922494122e-48
NCAS0D026402.532ON2602204067e-48
KAFR0A018502.532ON2562513684e-42
CAGL0K02981g2.532ON2782263652e-41
NDAI0I022702.532ON2772333591e-40
SAKL0A09460g2.532ON2402253542e-40
TDEL0A030602.532ON2442363473e-39
KNAG0C058202.532ON2712453084e-33
YMR069W (NAT4)2.532ON2852022938e-31
Smik_13.2482.532ON2552242786e-29
Skud_13.2252.532ON2542182734e-28
TBLA0G022202.532ON2782372552e-25
KLTH0D06820g2.532ON2601582482e-24
ZYRO0B01980g2.532ON1881532274e-22
Suva_13.2442.532ON2571602166e-20
Kwal_26.80162.532ON2401822122e-19
KLLA0E18569g2.532ON2152081523e-11
Ecym_72562.532ON2431801507e-11
Agos_YGOB_Anc_2.5322.532ON187144820.037
NDAI0K020802.494ON55354666.2
KLTH0D05104g2.458ON40552666.5
TPHA0A037503.331ON176152646.6
CAGL0F00957g7.88ON61170658.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C04180
         (264 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...   473   e-171
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...   163   2e-48
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   160   7e-48
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   146   4e-42
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...   145   2e-41
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...   142   1e-40
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...   140   2e-40
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...   138   3e-39
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...   123   4e-33
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...   117   8e-31
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...   111   6e-29
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...   109   4e-28
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...   102   2e-25
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...   100   2e-24
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...    92   4e-22
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...    88   6e-20
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    86   2e-19
KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa] ...    63   3e-11
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    62   7e-11
Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187...    36   0.037
NDAI0K02080 Chr11 (465383..467044) [1662 bp, 553 aa] {ON} Anc_2....    30   6.2  
KLTH0D05104g Chr4 complement(458869..460086) [1218 bp, 405 aa] {...    30   6.5  
TPHA0A03750 Chr1 complement(820349..820879) [531 bp, 176 aa] {ON...    29   6.6  
CAGL0F00957g Chr6 (102956..104791) [1836 bp, 611 aa] {ON} simila...    30   8.8  

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score =  473 bits (1218), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 240/256 (93%), Positives = 240/256 (93%)

Query: 1   MDDIVKFVKIVDSHYPDEIYVNKNLTKLVKKIIVVDSETEDIKNSAELYNGRYLTYSQNK 60
           MDDIVKFVKIVDSHYPDEIYVNKNLTKLVKKIIVVDSETEDIKNSAELYNGRYLTYSQNK
Sbjct: 1   MDDIVKFVKIVDSHYPDEIYVNKNLTKLVKKIIVVDSETEDIKNSAELYNGRYLTYSQNK 60

Query: 61  EECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLEDEK 120
           EECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLEDEK
Sbjct: 61  EECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLEDEK 120

Query: 121 KTVSLYLSFTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDV 180
           KTVSLYLSFTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDV
Sbjct: 121 KTVSLYLSFTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDV 180

Query: 181 HENIHKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRIKTRXXXXXXXX 240
           HENIHKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRIKTR        
Sbjct: 181 HENIHKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRIKTRSQNSSKKG 240

Query: 241 XXXXXXXXLSVVKKPD 256
                   LSVVKKPD
Sbjct: 241 SSSDKPTSLSVVKKPD 256

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score =  163 bits (412), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 152/249 (61%), Gaps = 26/249 (10%)

Query: 1   MDDIVKFVKIVDSHYPDEI-YVNKNLTK------LVKKIIVVDSETE--DIKNSAELYNG 51
           M +++  V + ++ +P+ +  +N N +       L +++I +DS+    D++N+      
Sbjct: 1   MSELLHLVDVAENIFPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNNV----- 55

Query: 52  RYLTYSQNKEECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIY 111
             L+Y ++  +C++  +K+L ILDNNLG IY  K+ K+Y N KPWKENKI EMK+EGL+Y
Sbjct: 56  --LSYYKDNVKCDVVLNKLLDILDNNLGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLY 113

Query: 112 VVYHLEDEKKTVSLYLSFTLTKESGFLPDID--------VFSPVIYLYEIQLTPEVRNNG 163
           V+Y+ +D  K   L++SF +T +   +   D          + VIYLYEIQL   +RN  
Sbjct: 114 VIYN-DDITKEPLLFMSFMITDDPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQK 172

Query: 164 LGTKLIAGYLKDCLVDVHENIHKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTI 223
           LGT LI  YLK  +  ++++  K+II +ELTVFS+N NAI FY+ IGM  TPDSP DK I
Sbjct: 173 LGTILITNYLKKTIEILNKDYQKNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKII 232

Query: 224 NYGHRIKTR 232
               + +TR
Sbjct: 233 -LPQKRRTR 240

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  160 bits (406), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 94/220 (42%), Positives = 145/220 (65%), Gaps = 13/220 (5%)

Query: 18  EIYVNKNLTKLVKKIIVVDSE-TEDIKNSAELYNGRYLTYSQNKEECEIEFSKILTILDN 76
           E+ + + L  L +KI++++ +     KNS ++    Y+  S ++ +  ++  + L ILD 
Sbjct: 20  EVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVV---YMKCSTDQGDKMLD--QFLDILDV 74

Query: 77  NLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLEDEKKTVSLYLSFTLTKESG 136
           NLG+ YT  +KK+Y N++PWK NK++EM++ GL+YV Y  ++E     L+LSF LT+E G
Sbjct: 75  NLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSY-WDEESDEPMLFLSFMLTEEDG 133

Query: 137 FLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVH----ENIHKDIIGIE 192
           F  D  + S V+YLYEIQ+ P +RN  LGT+L+A +L+D    +     E +   +IGIE
Sbjct: 134 FTEDDKLLS-VVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEYPLIGIE 192

Query: 193 LTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRIKTR 232
           LTVFSDN NAI+FY++IGM+LTPDSP D+ + +  R +TR
Sbjct: 193 LTVFSDNENAIKFYKSIGMELTPDSPRDR-VAHLERRRTR 231

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  146 bits (368), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 105/251 (41%), Positives = 137/251 (54%), Gaps = 15/251 (5%)

Query: 7   FVKIVDSHYPDEIYVNKNLTKLVKKIIVVDSETEDIKNSAELYNGRYLTYSQNKEECEIE 66
           F+KIV   +P E+        L +KI+ + SE E+ K S  + N +       +      
Sbjct: 10  FLKIVSDEFPKELRTKGQ--NLKRKILYIASEDEENKESDSVINEQDDLTKFTEGIGSKL 67

Query: 67  FSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLED-EKKTVSL 125
               L ILDNNLG+ Y   ++++Y N+  WK+NK+ EMK+ GLIYV Y  E+ EKKT +L
Sbjct: 68  LDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCAL 127

Query: 126 YLSFTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDC-LVDVHENI 184
           +LSF LT+E   + DI  FS VIYLYEIQL  + R   LGT+LI G    C +  V    
Sbjct: 128 FLSFMLTEEDFVVDDIRKFS-VIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRP 186

Query: 185 HKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRIKTRXXXXXXXXXXXX 244
              +IGI+LTVFSDN  AI+FYE IGMK T  SP D+      R KTR            
Sbjct: 187 AFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESR-KTR---------TSV 236

Query: 245 XXXXLSVVKKP 255
               L VV+KP
Sbjct: 237 NRKTLKVVRKP 247

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score =  145 bits (365), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/226 (42%), Positives = 128/226 (56%), Gaps = 15/226 (6%)

Query: 7   FVKIVDSHYPDEIYVNKNLTK------LVKKIIVVDSETEDIKNSAELYNGRYLTYSQNK 60
           F+  V   +P  I    NL K      L +K++V+D +   + N A L N   L     K
Sbjct: 15  FLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKA-LTNEVVLRSKHIK 73

Query: 61  EECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVY--HLED 118
           E   I  S +L +LD NLG  Y I +K++YGN KPWKENKI+EM TEG+IYV Y   ++D
Sbjct: 74  ESKNI-LSSLLELLDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDD 132

Query: 119 EKKTVSLYLSFTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDC-- 176
           E     L+LSF LT+E   L   D  S VI+LYEIQ++ E+R  GLG   ++  L  C  
Sbjct: 133 EHTVPLLFLSFMLTEEEN-LTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAK 191

Query: 177 -LVDVHE-NIHKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPND 220
            L+D    N+     GIELTVF+DN  AI  Y+ +GM  TP+SP D
Sbjct: 192 RLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKD 237

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score =  142 bits (359), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 93/233 (39%), Positives = 131/233 (56%), Gaps = 24/233 (10%)

Query: 7   FVKIVDSHYPDEIYVNKNLTKLVKKIIVVDSETE---DIKNSAELYNGRYLTYSQNKEEC 63
            + IV   +P  +     +T   ++I    S  E    I++S+E+YN      S + ++ 
Sbjct: 9   LLNIVCEEFPTILQSADGVTTWRRRIHHKPSHDEVSIPIEHSSEVYN-----LSSDPQQR 63

Query: 64  EIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLEDEKKTV 123
               +K L ILD NLG  YT  +K +Y N K WK NK++EM + GLIYV Y  E  ++ +
Sbjct: 64  SDVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQEPL 123

Query: 124 SLYLSFTLTKESGFLPDI----------DVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYL 173
            L+LSF LT+  GF+             D    VIYLYEIQ+ P++R  G+GTKL++ +L
Sbjct: 124 -LFLSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKLLSVHL 182

Query: 174 KDCLVDVHENIHKD-----IIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDK 221
             C   +     KD     ++GIELTVFSDN  AI FY++IGMKLTPDSP D+
Sbjct: 183 HQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDE 235

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score =  140 bits (354), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 128/225 (56%), Gaps = 22/225 (9%)

Query: 10  IVDSHYPDEIYVNKNLTKLVKKIIVVDSETEDIKNSAELYNGRYLTYSQNKEECEIEFSK 69
           ++DS +P  I + K+ +   +K++V+D  +  I  S     G+  T+S +++       +
Sbjct: 13  VLDS-FPTSITL-KDGSLATRKVLVIDEPSSGIAPS-----GQVCTWSGDRQSSNSLLIQ 65

Query: 70  ILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLEDEKKTVSLYLSF 129
            L +LD NLG  Y   +  LYGN++ W ENK++EM+T GL+YV Y    +  +  ++LSF
Sbjct: 66  FLKVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYF---QGVSPLMFLSF 122

Query: 130 TLTKESGFLPDIDVFSP--VIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIHKD 187
            LT E  FLPD     P  V+YLYEIQL PEV+   LGT+++  YLK+    VH     D
Sbjct: 123 LLTDEPDFLPD-----PVKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNT---VHSLSRLD 174

Query: 188 II--GIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRIK 230
            +  GIELTVFSDN  A+  Y +IGM L P SP D+      R +
Sbjct: 175 PLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTR 219

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score =  138 bits (347), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 128/236 (54%), Gaps = 29/236 (12%)

Query: 1   MDDIVKFVKIVDSHYPDEIYVNKNLTKLVKKIIVVDSETEDIKNSAELYNGRYLTYSQNK 60
           ++D+VK+    + ++P  I  N    +L +K++ +D+E   ++        + ++Y  + 
Sbjct: 6   LNDVVKYA---NQNFPTTI--NAAGIQLTRKLLAIDTEEYPVETD------QCISYVHSP 54

Query: 61  EECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVY------ 114
            E E    ++L ILD NLG  Y   ++ LY N++PW+ NK +EM T GL+YV+Y      
Sbjct: 55  REAEKLLWQLLEILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSTAATT 114

Query: 115 ---HLEDEKKTVSLYLSFTLTKESGFLPD--IDVFSPVIYLYEIQLTPEVRNNGLGTKLI 169
                 +   +  L+LSF LT+E G + D   +V++ V+YLYE+QL P VR  GL  +L+
Sbjct: 115 TATQRRNAPFSPLLFLSFMLTEEDGLVADDPTEVWT-VLYLYELQLLPRVRRLGLAARLL 173

Query: 170 AGYLKDCLVDVHENIHKD------IIGIELTVFSDNTNAIRFYETIGMKLTPDSPN 219
             +L  C   +               G+ELTVF+DN  AIR YE++GM+L  DSP 
Sbjct: 174 GDHLAQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSPT 229

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score =  123 bits (308), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 83/245 (33%), Positives = 125/245 (51%), Gaps = 31/245 (12%)

Query: 2   DDIVKFVKIVDSHYPDEIYVNKNLT--KLVKKIIVVDSETEDIKNSAELYNGRYLTY--- 56
           +D+  F++ VD  +P  I  + N T   L ++I  ++   +D   S    + + ++Y   
Sbjct: 4   NDLTLFLQTVDRQFPTVIGCDLNGTAVSLKRRIHYIEGVGDDDDES----HNKIMSYPGG 59

Query: 57  -------------SQNKEECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQE 103
                        ++    CE      L ILDNNLG +Y   ++K+YGNSK W+ENK  E
Sbjct: 60  LPPLPPTTDDNPTAKEDNTCERCLRIFLEILDNNLGPVYARLSRKIYGNSKHWRENKWLE 119

Query: 104 MKTEGLIYVVYHLEDEKKTVSLYLSFTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNG 163
           M +  L+YV Y + D +    LY SF LT+E+G +  I+    V+YLYEIQL   +R   
Sbjct: 120 MLSAQLVYVSYWVSDSEPV--LYTSFMLTEENG-ISSIESTDRVVYLYEIQLIEAIRRQK 176

Query: 164 LGTKLIAGYLKDCLVDVHENIHKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTI 223
           LG + I  YL +C ++  E     +  + LTVFSDN  A++FYE +    T DSP D+  
Sbjct: 177 LG-QAIVSYLTECALESPE-----VAAVALTVFSDNEKALKFYERLNFTYTIDSPRDEVT 230

Query: 224 NYGHR 228
               R
Sbjct: 231 EKPRR 235

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score =  117 bits (293), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 107/202 (52%), Gaps = 10/202 (4%)

Query: 22  NKNLTKLV--KKIIVVDSETEDIKNSAELYNGRYLTYSQNKEECEIEFSKILTILDNNLG 79
           N N T  +  ++II +  +  D  +S +  + + + Y  +K   +      + ++D +LG
Sbjct: 56  NGNFTTAILEREIIYIPEDDTDSIDSVD--SLKCINYKLHKSRGDQVLDACVQLIDKHLG 113

Query: 80  DIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLEDEKKTVSLYLSFTLTKESGFLP 139
             Y   ++ +YGN KPWK NK+ EMK+ GL+YV Y    +   +  + SF LT+E+G + 
Sbjct: 114 AKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYW---DNGVLGAFTSFMLTEETGLVE 170

Query: 140 D---IDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIHKDIIGIELTVF 196
                +V  PVIYLYE+ +    R +G+G +L+   L D +      +  +  G+ LTVF
Sbjct: 171 GDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRRMCDNFFGVALTVF 230

Query: 197 SDNTNAIRFYETIGMKLTPDSP 218
           SDNT A R YE +G    P SP
Sbjct: 231 SDNTRARRLYEALGFYRAPGSP 252

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score =  111 bits (278), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 117/224 (52%), Gaps = 16/224 (7%)

Query: 6   KFVKIVDSHYPDEI-YVNKN-------LTKLVKKIIVVDSETEDIKNSAELYNGRYLTYS 57
           +F+KI    +P+ + Y N +        T L ++++ +     + +++ E+     + Y 
Sbjct: 4   QFLKICMQDFPETLEYTNTDGNNGTATTTVLKREMLFIPEGDSNSQDNIEIPT--CVNYR 61

Query: 58  QNKEECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLE 117
            +K          + ++D +LG  Y   ++ +YGN KPWK NK+ EMK+  L+YV Y   
Sbjct: 62  LHKSRGNHILDSCVQLIDEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLVYVSYW-- 119

Query: 118 DEKKTVSLYLSFTLTKESGFL---PDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLK 174
            +   ++ + SF LT+E+G +      +V  PVIYLYE+ +    R +G+G +L+   L 
Sbjct: 120 -DNGALAAFASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGIGRRLLERALC 178

Query: 175 DCLVDVHENIHKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSP 218
           + +      ++++  G+ LTVFSDNT A R YE +G    P SP
Sbjct: 179 EGVARHVRCLYEEFFGVALTVFSDNTRARRLYEALGFYRAPGSP 222

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score =  109 bits (273), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 71/218 (32%), Positives = 110/218 (50%), Gaps = 19/218 (8%)

Query: 6   KFVKIVDSHYPDEI-YVNKN-------LTKLVKKIIVVDSETEDIKNSAELYNGRYLT-Y 56
           KF+ I    +P+ + Y   N        T L ++I+ +  E  ++ +     +G   T Y
Sbjct: 4   KFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDS----IDGPQCTNY 59

Query: 57  SQNKEECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHL 116
           + +K   +      + ++D +LGD Y   ++ +YGN  PWK NK+ EMK+ GL+YV Y  
Sbjct: 60  NLHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYW- 118

Query: 117 EDEKKTVSLYLSFTLTKESGFL---PDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYL 173
                 +  + SF LT+E+G +      +V  PVIYLYEI +    R +GLG +L+   L
Sbjct: 119 --GNGALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGLGRRLLERAL 176

Query: 174 KDCLVDVHENIHKDIIGIELTVFSDNTNAIRFYETIGM 211
            + +      +  D  G+ LTVF DNT A R YE IG 
Sbjct: 177 CEGVARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGF 214

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score =  102 bits (255), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 127/237 (53%), Gaps = 14/237 (5%)

Query: 3   DIVKFVKIVDSHYPDEIYVNKNLTKLVKKIIVVDSETEDI-------KNSAELYNGRYLT 55
           D+ + V++VD+ +P  I   + +T   K  I+ DSE   +        N  E+Y   Y  
Sbjct: 2   DVRRLVQLVDNAFPKSISTKQGITLERKIYIIGDSENNSLLSDQNNNSNDDEIY--WYFK 59

Query: 56  YSQNKEECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYH 115
             +N     I  ++I  ++D NLG +Y  K+KK+Y N   W  NK +EM T  +IY+ Y 
Sbjct: 60  DRKNPTVENIIKTQIFQLIDENLGKLYKKKSKKIYENDLDWSINKREEMFTSNMIYITY- 118

Query: 116 LEDEKKTVSLYLSFTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKD 175
            + ++ +V+L+LS    +E+  L + D    V+YLYEI +T E +  G+G +LI  YL +
Sbjct: 119 WDCKQNSVALFLSILSCEETYILENNDQ-GEVLYLYEIHITKEYQRQGIGERLIKDYLIE 177

Query: 176 CLVDVH--ENIHKDIIGIELTVFSDNTNAIRFY-ETIGMKLTPDSPNDKTINYGHRI 229
            L+     E    + IG+ELTVFS+N +A  FY   I M+ T  SP D+ IN   RI
Sbjct: 178 KLIKPLKIERQDNNFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRI 234

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score =  100 bits (248), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 90/158 (56%), Gaps = 16/158 (10%)

Query: 69  KILTILDNNLGDIYTIKNKKLYGNSK-PWKENKIQEMKTEGLIYVVYHLEDEKKTVSLYL 127
           ++L+++  NLG +YT   + +YG  +  W   K  EM+T GL+YVVY   D      +++
Sbjct: 80  QLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVY--SDSHSQPLVFM 137

Query: 128 SFTLTKESGFLPDI--DVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIH 185
           S  LT E    P++  ++ + V+YL+EI ++  +R  GLGT L    L+DCL     ++ 
Sbjct: 138 SLLLTDE----PELGQELAARVLYLFEIHVSDIIRGQGLGTHL----LRDCLGGTLASLS 189

Query: 186 K---DIIGIELTVFSDNTNAIRFYETIGMKLTPDSPND 220
           +    ++G ELTVFS+N  A+R Y  +GM +   SP D
Sbjct: 190 RASPSVLGAELTVFSENQRALRLYLALGMHVAAWSPQD 227

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score = 92.0 bits (227), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 79/153 (51%), Gaps = 10/153 (6%)

Query: 69  KILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLEDEKKTVSLYLS 128
           K L +++ NLG  Y   NK +Y N+K W+ NK QEM +E L +V Y    E   +  + S
Sbjct: 23  KQLQLIEINLGSYYNKYNKTIYKNNKRWQSNKWQEMCSENLFHVSY-WNVESNELVCFCS 81

Query: 129 FTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIHKDI 188
               +ES    ++   S +IYLYEI + PE RN   G  ++    +      H      +
Sbjct: 82  IMPCEESIVEGEM---SNIIYLYEIHVAPEWRNQKFGKSILNALKEKLCPKAH------L 132

Query: 189 IGIELTVFSDNTNAIRFYETIGMKLTPDSPNDK 221
            GIELTVFS N  AI FY   G  L+ DSP+DK
Sbjct: 133 SGIELTVFSSNERAINFYRNNGFTLSYDSPSDK 165

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score = 87.8 bits (216), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 83/160 (51%), Gaps = 7/160 (4%)

Query: 54  LTYSQNKEECEIEFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVV 113
           + Y  +K + +      + ++D +LG  Y   ++ +YGN  PWK NK+ EMK+ GL+YV 
Sbjct: 57  MNYKLHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVC 116

Query: 114 YHLEDEK--KTVSLYLSFTLTKESGFLPDIDVFS---PVIYLYEIQLTPEVRNNGLGTKL 168
           Y   D +  + +  + SF LT+E+G +          PVIYLYE+      R    G +L
Sbjct: 117 YWGNDAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHRGRGL--GRRL 174

Query: 169 IAGYLKDCLVDVHENIHKDIIGIELTVFSDNTNAIRFYET 208
           +A  L + +         D+ G+ LTVF DNT A R YE+
Sbjct: 175 LAKALCEGVAARVRRTCDDLFGVALTVFGDNTRARRLYES 214

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 86.3 bits (212), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 90/182 (49%), Gaps = 23/182 (12%)

Query: 61  EECEIEFSKILTILDNNLGDIYTIKNKKLYGN-SKPWKENKIQEMKTEGLIYVVYHLEDE 119
           + C +E  ++L ++D+NLG +Y    K LYG+    WKE K QEM T GL+YVVY   DE
Sbjct: 49  DPCLLE--QLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDE 106

Query: 120 K------KTVSLYLSFTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKL----I 169
           +          L L  T   E G  P     + V+YL EI +   +R  GLG  L    +
Sbjct: 107 ETGKEGLPLAFLSLLLTDEPELGPAP-----AAVVYLMEIHVADIIRGLGLGGTLLREGV 161

Query: 170 AGYLKDCLVDVHENIHKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRI 229
           AG ++          H  I G ELTVF+DN  A+R Y  +GM++   SP D  I    R 
Sbjct: 162 AGTVRGA-----RRAHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVHRRT 216

Query: 230 KT 231
           + 
Sbjct: 217 RA 218

>KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa]
           {ON} no similarity
          Length = 215

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 91/208 (43%), Gaps = 26/208 (12%)

Query: 20  YVNKNLTKLVKKIIVVDSETEDIKNSAELYNGRYLTYSQNKEECEIEFSKILTILDNNLG 79
           Y ++NL ++   +    + T D     E+++ R   +S +         K L I+  NL 
Sbjct: 4   YHSRNLRRVAGVLCQELNSTGDSDVVCEVFSNR--VHSGDPNYLGSTLPKCLAIIKQNLS 61

Query: 80  DIYTIKNKKLY---------GNSKPWKENKIQEMKTEGLIYVVYHLEDEKKTVSLYLSFT 130
             Y +    +Y         GN K W   K  EM  + L+Y+V    D  K V     FT
Sbjct: 62  TFYELHGSSIYNYTDDDKGKGNEK-WIRFKWDEMLDKDLVYIVLFKRDTTKIVG----FT 116

Query: 131 LTKESGFL-PDID---VFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIHK 186
               S  L P++D   +  P ++LYEI L  E ++ GLG+ +  G L     D+      
Sbjct: 117 SVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIFNGLLIPLARDL------ 170

Query: 187 DIIGIELTVFSDNTNAIRFYETIGMKLT 214
               IEL VF+ N  A R+Y+ +G +LT
Sbjct: 171 TCPSIELCVFTANDVACRWYKRLGFQLT 198

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 80/180 (44%), Gaps = 35/180 (19%)

Query: 66  EFSKILT-ILDNNLGDIYTIKNKKLYGN---SKPWKENKIQEMKTEGLIYVVYHLEDEKK 121
           +F+K LT I++  LG  Y +    LY     S+PW+ +K  E++  G  +V+Y  E+   
Sbjct: 45  KFAKQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPGG 104

Query: 122 TVSLYLSF-------------------TLTKESG-----FLPDIDVFSP-----VIYLYE 152
            ++ ++S                    T  +E G       P  +   P     V+Y+ E
Sbjct: 105 AIAGFVSLLFCDEPHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKVVYVME 164

Query: 153 IQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIHKDIIGIELTVFSDNTNAIRFYETIGMK 212
           I ++P  +N GLG+ ++    +  LV   +     + G+ELTVF+ N  A+  Y   G K
Sbjct: 165 IHVSPSFQNQGLGSCMLLCARQ--LVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFK 222

>Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187
           aa] {ON} ANNOTATED BY YGOB -
          Length = 187

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 28/144 (19%), Positives = 53/144 (36%), Gaps = 21/144 (14%)

Query: 72  TILDNNLGDIYTIKNKKLYG---NSKPWKENKIQEMKTEGLIYVVYHLEDEKKTVSLYLS 128
            ++   L  +Y    + LY    +   W   K  E+     ++++Y   D    ++ ++S
Sbjct: 46  ALVAAGLAPLYRAHARLLYPRLRDPAAWPRCKRAELLDPAALHILY--RDPAGRLACFIS 103

Query: 129 FTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIHKDI 188
             L   +          PV+Y+ E+ +    R  GL   L+                  +
Sbjct: 104 LLLPGPA---------DPVLYILELHVAAPFRRRGLAAALLD-------AATRTARAAGL 147

Query: 189 IGIELTVFSDNTNAIRFYETIGMK 212
             +ELTVF+ N  A+  Y   G +
Sbjct: 148 TRLELTVFTANRPALALYARAGFR 171

>NDAI0K02080 Chr11 (465383..467044) [1662 bp, 553 aa] {ON} Anc_2.494
           YKL090W
          Length = 553

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 172 YLKDCLVDVHENIHKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTINY 225
           + K+CL   + +I+K II + L +  DN     F   +G K    +PND T NY
Sbjct: 342 FYKNCLRFFNGDINK-IIPLALFIIKDNLANATFIHNLGTKENNVNPNDDTSNY 394

>KLTH0D05104g Chr4 complement(458869..460086) [1218 bp, 405 aa] {ON}
           highly similar to uniprot|P22936 Saccharomyces
           cerevisiae YKL114C APN1 Major apurinic/apyrimidinic
           endonuclease 3'-repair diesterase involved in repair of
           DNA damage by oxidation and alkylating agents controls
           spontaneous mutations
          Length = 405

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 179 DVHENIHKDIIGIELTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRIK 230
           D+HE + +  +G+E+     N+  +R     G+ +  ++P+ K   YGH IK
Sbjct: 286 DLHEKLGQGFLGLEVFKLVANSEFLR-----GIPVILETPHTKDEGYGHEIK 332

>TPHA0A03750 Chr1 complement(820349..820879) [531 bp, 176 aa] {ON}
           Anc_3.331 YPR051W
          Length = 176

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 63/152 (41%), Gaps = 37/152 (24%)

Query: 66  EFSKILTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVY--HLEDEKKTV 123
           +F +I T++DN+L + Y++   + + N+ P            GL Y+V    LE+EK  +
Sbjct: 15  QFKQIKTLVDNDLSEPYSVWVYRFFLNNWP------------GLTYIVIDTELEEEKNVI 62

Query: 124 SLYLS----FTLTKESGFLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVD 179
              +        T+  G++  + V              E R  G+   L+        ++
Sbjct: 63  GCIICKNELHRNTRRRGYIGMLVV------------NNEYRGQGIAKNLVK-----TAIN 105

Query: 180 VHENIHKDIIGIELTVFSDNTNAIRFYETIGM 211
             +N   D I +E  V   NT AI+ YE +G 
Sbjct: 106 KMKNEQCDEIMLETEV--SNTIAIKLYENMGF 135

>CAGL0F00957g Chr6 (102956..104791) [1836 bp, 611 aa] {ON} similar
           to uniprot|P31383 Saccharomyces cerevisiae YAL016w TPD3
          Length = 611

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 71  LTILDNNLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLE-DEKKTVSLYLSF 129
           L++ ++N GD+       + G SK  K+  I E K   +I  +Y L  DE +TV   L+ 
Sbjct: 302 LSLCEDNEGDVRKAIAGHVSGFSKHIKDASIIEAK---IIPAIYTLSIDENETVRASLAQ 358

Query: 130 TLTKESGFLP 139
           ++T  S  LP
Sbjct: 359 SITGMSSLLP 368

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.137    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,090,577
Number of extensions: 1423128
Number of successful extensions: 4503
Number of sequences better than 10.0: 71
Number of HSP's gapped: 4623
Number of HSP's successfully gapped: 72
Length of query: 264
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 157
Effective length of database: 41,212,137
Effective search space: 6470305509
Effective search space used: 6470305509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)