Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C035202.306ON44244216250.0
Kpol_1043.342.306ON4421838041e-102
TBLA0B071702.306ON4701907852e-99
TDEL0G023602.306ON4021867566e-96
NCAS0B061402.306ON4431927432e-93
ZYRO0A02398g2.306ON4101907402e-93
Suva_14.3302.306ON4571917424e-93
Smik_14.3132.306ON4511907381e-92
CAGL0H10604g2.306ON4161897342e-92
Skud_14.3122.306ON4591907346e-92
YNL016W (PUB1)2.306ON4531907311e-91
SAKL0E07128g2.306ON4011927252e-91
AGR390C2.306ON3781847084e-89
Ecym_33442.306ON4211887115e-89
NDAI0B034402.306ON4991937142e-88
KNAG0A054402.306ON4421917066e-88
KLLA0E08779g2.306ON4751897017e-87
KLTH0G10912g2.306ON4361896917e-86
Kwal_27.114472.306ON4391966874e-85
KAFR0J012602.306ON3651856735e-84
Kpol_1032.498.229ON5801892479e-22
Ecym_80105.382ON6021812433e-21
TPHA0B034208.229ON5791912423e-21
CAGL0L11792g8.229ON5791752408e-21
TBLA0F037808.229ON5771612399e-21
ADR307W5.382ON5661822344e-20
TDEL0E024505.382ON4721812325e-20
Ecym_55628.229ON5801692319e-20
KNAG0G018108.229ON5961702292e-19
NDAI0C061008.229ON5851652273e-19
TDEL0A013508.229ON5881672273e-19
NCAS0A036808.229ON5751612255e-19
KNAG0B044405.382ON3971862225e-19
ZYRO0B11660g8.229ON5871672247e-19
Smik_5.3378.229ON5771832193e-18
SAKL0H17952g8.229ON5891842175e-18
KLLA0F14861g5.382ON5891772176e-18
AGR122C8.229ON5851672166e-18
Skud_5.3048.229ON5771672166e-18
YER165W (PAB1)8.229ON5771672166e-18
Kwal_55.201545.382ON5221782167e-18
KAFR0B025008.229ON5821612151e-17
KLLA0C17600g8.229ON5921672132e-17
KLTH0E03520g5.382ON5161722122e-17
SAKL0G08118g5.382ON5451742122e-17
KAFR0D048305.382ON4061652102e-17
TBLA0H017905.382ON6741872104e-17
Suva_5.2998.229ON5771672095e-17
CAGL0H02123g5.382ON5551942086e-17
NCAS0H018105.382ON4431782068e-17
NDAI0C018205.382ON4981752014e-16
Kwal_56.234868.229ON5871671999e-16
Smik_8.1645.382ON5242041999e-16
TPHA0H015205.382ON4941881962e-15
KNAG0D032204.61ON3991791942e-15
KLTH0G14344g8.229ON5871611953e-15
NDAI0D028404.61ON4261771924e-15
Smik_6.2644.61ON3951831915e-15
YGR159C (NSR1)4.61ON4141791916e-15
ZYRO0A07018g5.382ON5582001927e-15
Ecym_62014.61ON4481851917e-15
TBLA0C043604.61ON4031781908e-15
Skud_7.4834.61ON3931831898e-15
KAFR0F031204.61ON4121781891e-14
Skud_6.1071.357ON611771901e-14
KAFR0C016803.49ON4791731882e-14
NCAS0A058904.61ON4151781872e-14
TDEL0F029104.61ON4361841863e-14
Skud_8.1475.382ON5131951863e-14
KLTH0E14036g8.797ON2091971783e-14
Suva_6.951.357ON6131161864e-14
Suva_7.4504.61ON3911841801e-13
Suva_15.2805.382ON5412141802e-13
YHR086W (NAM8)5.382ON5231971802e-13
NCAS0B072401.357ON610871802e-13
AFR107W4.61ON3962031764e-13
Kpol_1076.113.49ON5261751774e-13
TPHA0P013103.49ON5181751775e-13
Ecym_20503.49ON5411741775e-13
Ecym_30826.104ON5862471759e-13
ADL160W3.49ON5261741741e-12
CAGL0E03245g4.61ON4252031731e-12
KAFR0G023206.104ON6202521732e-12
KNAG0A013703.49ON5451731722e-12
SAKL0H23562g4.61ON4211821712e-12
CAGL0M03795g3.49ON5131701712e-12
KLLA0C12925g3.49ON5701741713e-12
NDAI0A061703.49ON5521751713e-12
TBLA0A078103.49ON4721731703e-12
SAKL0C12672g3.49ON5511731704e-12
TPHA0K019104.61ON4161801684e-12
Kwal_55.219603.49ON5971731695e-12
NDAI0G039703.49ON6071731695e-12
AEL016C1.357ON678951695e-12
NCAS0C046003.49ON5811751686e-12
KLTH0F18766g3.49ON5881731686e-12
Ecym_27461.357ON681951686e-12
KLLA0C11495g4.61ON4451821676e-12
Kpol_1026.214.61ON4371831669e-12
TDEL0G036706.104ON6171471661e-11
TBLA0B085903.49ON6231751661e-11
TDEL0E006003.49ON5471731651e-11
TBLA0D049401.357ON665761652e-11
AAR151W6.104ON4812261642e-11
NCAS0A100103.49ON5061731632e-11
KLLA0C05522g6.104ON5402221632e-11
ZYRO0C02574g3.49ON5432001632e-11
Skud_2.3456.104ON6641471633e-11
SAKL0D09680g1.357ON672791624e-11
ABL059W8.797ON2041781545e-11
Suva_4.4706.104ON6631471615e-11
Smik_2.3556.104ON7361471615e-11
TPHA0A022201.357ON713721606e-11
CAGL0E01947g3.49ON4521731597e-11
Ecym_74208.797ON2041721528e-11
KLTH0D03916g4.61ON5051811589e-11
NDAI0B045701.357ON4641151571e-10
Kwal_0.3701.357ON560891581e-10
YBR212W (NGR1)6.104ON6721471572e-10
SAKL0A07370g6.104ON4902331562e-10
ZYRO0C05060g6.104ON7161461562e-10
KLTH0H12958g1.357ON639801552e-10
CAGL0K06655g6.104ON8021461553e-10
KLLA0C14388g8.797ON2031701473e-10
Kpol_1008.231.357ON660721543e-10
SAKL0D08558g1.408ON4641771534e-10
Kpol_224.18.797ON2171841474e-10
KAFR0H014508.491ON690791534e-10
SAKL0B06270g8.797ON2091731456e-10
KAFR0C044101.357ON589721526e-10
ZYRO0G00814g1.357ON654871527e-10
AGL250W8.491ON729841518e-10
Suva_16.2718.491ON686931518e-10
TBLA0A099206.104ON5941441509e-10
Kpol_530.466.104ON5871451501e-09
YOL123W (HRP1)3.49ON5341731491e-09
Smik_15.303.49ON5361731491e-09
NCAS0C048301.408ON3771681472e-09
Kwal_27.123378.797ON2091791422e-09
YFR023W (PES4)1.357ON611771492e-09
Smik_16.1928.491ON690941482e-09
Suva_15.373.49ON5511731482e-09
KLLA0D11792g8.491ON685841482e-09
Smik_7.3341.357ON611771482e-09
Skud_15.303.49ON5391731482e-09
TDEL0D022501.357ON622811473e-09
Skud_16.2388.491ON680931473e-09
ZYRO0G07326g4.61ON4681821463e-09
TDEL0B014608.491ON692821463e-09
YPL043W (NOP4)8.491ON685931463e-09
KNAG0G032608.797ON2011691394e-09
Kwal_26.7493singletonOFF2221441386e-09
NDAI0E030708.491ON701851438e-09
Kwal_27.118328.491ON686791421e-08
KLLA0A08338g1.357ON766851421e-08
TDEL0B010108.797ON2101841361e-08
CAGL0I08943g1.357ON602721402e-08
KLTH0H06842g6.104ON5471031402e-08
Kwal_14.18516.104ON5351461402e-08
KLTH0E11418g8.491ON693811383e-08
KLLA0E19031g6.183ON6521861374e-08
KNAG0A022108.491ON682821374e-08
Kpol_1018.1221.357ON6341781366e-08
ZYRO0F08294g8.491ON714871357e-08
CAGL0L12672g8.491ON682841357e-08
NCAS0C023808.491ON702811358e-08
TDEL0H032407.159ON1671161279e-08
TBLA0A015708.491ON742911349e-08
Skud_8.671.357ON652831349e-08
Ecym_25418.491ON675811331e-07
NCAS0G042801.408ON4351881312e-07
KAFR0D016608.797ON2121841262e-07
KNAG0C020301.357ON365791292e-07
NDAI0G059701.357ON611721312e-07
YOR319W (HSH49)8.797ON2131801262e-07
YHR015W (MIP6)1.357ON659721303e-07
CAGL0I09900g8.797ON2111771253e-07
Kpol_1075.1a8.229ON264801263e-07
TPHA0F028206.104ON6081511294e-07
AAL018W1.408ON3371721274e-07
TPHA0C017408.491ON697841285e-07
KNAG0I015901.357ON590811285e-07
Smik_8.801.357ON670831276e-07
Ecym_22336.183ON5761881268e-07
NCAS0B009508.797ON2191911219e-07
Ecym_11211.102ON324751249e-07
KAFR0B045402.167ON220861211e-06
Suva_8.3708.797ON2131811211e-06
SAKL0H11330g8.491ON697941242e-06
ZYRO0B09790g2.167ON198901192e-06
KAFR0A009801.357ON642861232e-06
TPHA0B043001.102ON334751222e-06
Suva_15.1981.357ON662721232e-06
NDAI0E004708.797ON2581961202e-06
TBLA0B080105.76ON939801232e-06
AFL061C6.183ON5231861222e-06
KAFR0B066906.183ON5331881222e-06
CAGL0J11154g2.80ON3801371212e-06
Kwal_33.134961.102ON330811203e-06
TDEL0F028504.66ON2791211193e-06
CAGL0B04807g1.408ON4191781213e-06
ZYRO0G07216g4.66ON271881193e-06
KAFR0H031101.408ON4411951203e-06
KLTH0H04906g6.183ON5691861213e-06
TPHA0F023102.80ON400781194e-06
KLLA0D13420g7.159ON1661121144e-06
ZYRO0F16214g1.102ON330821185e-06
Skud_15.4878.797ON2131801165e-06
KLLA0D05016g1.408ON4431741195e-06
SAKL0A05280g6.183ON5821861196e-06
Kpol_2000.441.102ON338751186e-06
SAKL0C03234g1.102ON340751177e-06
KAFR0B044205.76ON6251951197e-06
TBLA0B008102.80ON389781177e-06
ZYRO0G08140g6.183ON6321871187e-06
NDAI0G001801.408ON4641911188e-06
CAGL0J01914g7.159ON1691071128e-06
Kwal_55.209727.159ON1351091109e-06
Kwal_27.111586.183ON5671861179e-06
Kpol_1041.42.80ON384781169e-06
NDAI0F022606.183ON6801921171e-05
YNL175C (NOP13)2.80ON403781161e-05
Suva_14.1662.80ON403781161e-05
Skud_14.1592.80ON400781161e-05
TDEL0H019407.250ON3181161151e-05
KLTH0B06886g2.80ON396781161e-05
ZYRO0F12716g8.797ON2101861121e-05
ZYRO0E04928g1.408ON4091941151e-05
NDAI0F01720singletonON4741591161e-05
KLLA0C08019g7.250ON301871141e-05
NDAI0F033202.80ON399781152e-05
Kpol_1026.164.66ON277801132e-05
NCAS0H010406.183ON6291921152e-05
KLTH0F02838g1.102ON330751142e-05
TBLA0C056002.167ON215771112e-05
Smik_14.1552.80ON403781142e-05
TDEL0B060601.408ON3451791132e-05
NCAS0F011505.542ON3791691132e-05
TDEL0C059901.102ON337831123e-05
NCAS0G019502.80ON404781123e-05
Kwal_33.144632.80ON393781123e-05
ADR189W5.536ON269821104e-05
NCAS0G025802.167ON224771094e-05
NCAS0E038805.76ON7172141134e-05
SAKL0H02332g5.76ON8172181134e-05
Kpol_487.61.408ON3761801114e-05
NCAS0A089801.357ON605721124e-05
TDEL0F006802.80ON3882121114e-05
CAGL0L03806g2.167ON255771095e-05
KAFR0B036808.822ON4411851115e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C03520
         (442 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.3...   630   0.0  
Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {O...   314   e-102
TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa] ...   306   2e-99
TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.3...   295   6e-96
NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa] ...   290   2e-93
ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} simila...   289   2e-93
Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 ...   290   4e-93
Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016...   288   1e-92
CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]...   287   2e-92
Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016...   287   6e-92
YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly ...   286   1e-91
SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {...   283   2e-91
AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}...   277   4e-89
Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar t...   278   5e-89
NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {O...   279   2e-88
KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.3...   276   6e-88
KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} simila...   274   7e-87
KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some s...   270   7e-86
Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {...   269   4e-85
KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {...   263   5e-84
Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON} (1110...   100   9e-22
Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to ...    98   3e-21
TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {O...    98   3e-21
CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} hig...    97   8e-21
TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.2...    97   9e-21
ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic ...    95   4e-20
TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {O...    94   5e-20
Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar...    94   9e-20
KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.2...    93   2e-19
NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON}             92   3e-19
TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {O...    92   3e-19
NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {O...    91   5e-19
KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {O...    90   5e-19
ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly...    91   7e-19
Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W ...    89   3e-18
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    88   5e-18
KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some...    88   6e-18
AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON} S...    88   6e-18
Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W ...    88   6e-18
YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A...    88   6e-18
Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {...    88   7e-18
KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.2...    87   1e-17
KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} simi...    87   2e-17
KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {...    86   2e-17
SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {...    86   2e-17
KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.3...    86   2e-17
TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {O...    86   4e-17
Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W ...    85   5e-17
CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {...    85   6e-17
NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382     84   8e-17
NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {O...    82   4e-16
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    81   9e-16
Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W ...    81   9e-16
TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.3...    80   2e-15
KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.6...    79   2e-15
KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} high...    80   3e-15
NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {O...    79   4e-15
Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON...    78   5e-15
YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}  ...    78   6e-15
ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {...    79   7e-15
Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar t...    78   7e-15
TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa] ...    78   8e-15
Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON...    77   8e-15
KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.6...    77   1e-14
Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W ...    78   1e-14
KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {O...    77   2e-14
NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON}             77   2e-14
TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {O...    76   3e-14
Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W ...    76   3e-14
KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa] ...    73   3e-14
Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W (...    76   4e-14
Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON...    74   1e-13
Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086...    74   2e-13
YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA bi...    74   2e-13
NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON} Anc_1...    74   2e-13
AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic ho...    72   4e-13
Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {O...    73   4e-13
TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {...    73   5e-13
Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to ...    73   5e-13
Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}...    72   9e-13
ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic ho...    72   1e-12
CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {...    71   1e-12
KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {O...    71   2e-12
KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49 ...    71   2e-12
SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]...    70   2e-12
CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa] ...    70   2e-12
KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weak...    70   3e-12
NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa] ...    70   3e-12
TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3...    70   3e-12
SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]...    70   4e-12
TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {...    69   4e-12
Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]...    70   5e-12
NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.4...    70   5e-12
AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON} S...    70   5e-12
NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49      69   6e-12
KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]...    69   6e-12
Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar...    69   6e-12
KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {...    69   6e-12
Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {O...    69   9e-12
TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {O...    69   1e-11
TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa] ...    69   1e-11
TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.4...    68   1e-11
TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON} Anc_1...    68   2e-11
AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic ho...    68   2e-11
NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa] ...    67   2e-11
KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some s...    67   2e-11
ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {...    67   2e-11
Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W ...    67   3e-11
SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} simila...    67   4e-11
ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic hom...    64   5e-11
Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W ...    67   5e-11
Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W ...    67   5e-11
TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {O...    66   6e-11
CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some s...    66   7e-11
Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON} ...    63   8e-11
KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some s...    65   9e-11
NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON} Anc_1...    65   1e-10
Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W (P...    65   1e-10
YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA bi...    65   2e-10
SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {...    65   2e-10
ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {...    65   2e-10
KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} simi...    64   2e-10
CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} simil...    64   3e-10
KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa] ...    61   3e-10
Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON} (47628....    64   3e-10
SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} simila...    64   4e-10
Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON} comp...    61   4e-10
KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.4...    64   4e-10
SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {O...    60   6e-10
KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {O...    63   6e-10
ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON...    63   7e-10
AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic ho...    63   8e-10
Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043...    63   8e-10
TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON} Anc_6...    62   9e-10
Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {O...    62   1e-09
YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit...    62   1e-09
Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W (...    62   1e-09
NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408     61   2e-09
Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa] ...    59   2e-09
YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A...    62   2e-09
Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043...    62   2e-09
Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W (...    62   2e-09
KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} simi...    62   2e-09
Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W ...    62   2e-09
Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W (...    62   2e-09
TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {O...    61   3e-09
Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043...    61   3e-09
ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {...    61   3e-09
TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.4...    61   3e-09
YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}  NOP4Nucle...    61   3e-09
KNAG0G03260 Chr7 (701431..702036) [606 bp, 201 aa] {ON} Anc_8.79...    58   4e-09
Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C...    58   6e-09
NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.4...    60   8e-09
Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {...    59   1e-08
KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} simila...    59   1e-08
TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON...    57   1e-08
CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} simila...    59   2e-08
KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {...    59   2e-08
Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {O...    59   2e-08
KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]...    58   3e-08
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...    57   4e-08
KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.4...    57   4e-08
Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON} (325...    57   6e-08
ZYRO0F08294g Chr6 complement(670688..672832) [2145 bp, 714 aa] {...    57   7e-08
CAGL0L12672g Chr12 complement(1361933..1363981) [2049 bp, 682 aa...    57   7e-08
NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.4...    57   8e-08
TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON...    54   9e-08
TBLA0A01570 Chr1 (364733..366961) [2229 bp, 742 aa] {ON} Anc_8.4...    56   9e-08
Skud_8.67 Chr8 (116061..118019) [1959 bp, 652 aa] {ON} YHR015W (...    56   9e-08
Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {O...    56   1e-07
NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408     55   2e-07
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    53   2e-07
KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.3...    54   2e-07
NDAI0G05970 Chr7 complement(1475760..1477595) [1836 bp, 611 aa] ...    55   2e-07
YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-sn...    53   2e-07
YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putati...    55   3e-07
CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar...    53   3e-07
Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 ...    53   3e-07
TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.1...    54   4e-07
AAL018W Chr1 (309542..310555) [1014 bp, 337 aa] {ON} Syntenic ho...    54   4e-07
TPHA0C01740 Chr3 (398136..400229) [2094 bp, 697 aa] {ON} Anc_8.4...    54   5e-07
KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {O...    54   5e-07
Smik_8.80 Chr8 (114815..116827) [2013 bp, 670 aa] {ON} YHR015W (...    54   6e-07
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...    53   8e-07
NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797      51   9e-07
Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to...    52   9e-07
KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.16...    51   1e-06
Suva_8.370 Chr8 (653473..654114) [642 bp, 213 aa] {ON} YOR319W (...    51   1e-06
SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} simila...    52   2e-06
ZYRO0B09790g Chr2 (765258..765854) [597 bp, 198 aa] {ON} similar...    50   2e-06
KAFR0A00980 Chr1 complement(182578..184506) [1929 bp, 642 aa] {O...    52   2e-06
TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON} Anc_1...    52   2e-06
Suva_15.198 Chr15 (343049..345037) [1989 bp, 662 aa] {ON} YHR015...    52   2e-06
NDAI0E00470 Chr5 complement(91514..92290) [777 bp, 258 aa] {ON} ...    51   2e-06
TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5...    52   2e-06
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...    52   2e-06
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...    52   2e-06
CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON} sim...    51   2e-06
Kwal_33.13496 s33 complement(251014..252006) [993 bp, 330 aa] {O...    51   3e-06
TDEL0F02850 Chr6 (516483..517322) [840 bp, 279 aa] {ON} Anc_4.66...    50   3e-06
CAGL0B04807g Chr2 (460721..461980) [1260 bp, 419 aa] {ON} simila...    51   3e-06
ZYRO0G07216g Chr7 (568877..569692) [816 bp, 271 aa] {ON} similar...    50   3e-06
KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326...    51   3e-06
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...    51   3e-06
TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.8...    50   4e-06
KLLA0D13420g Chr4 complement(1157491..1157991) [501 bp, 166 aa] ...    49   4e-06
ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON} conse...    50   5e-06
Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W...    49   5e-06
KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [133...    50   5e-06
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...    50   6e-06
Kpol_2000.44 s2000 (86199..87215) [1017 bp, 338 aa] {ON} (86199....    50   6e-06
SAKL0C03234g Chr3 complement(306710..307732) [1023 bp, 340 aa] {...    50   7e-06
KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {O...    50   7e-06
TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {O...    50   7e-06
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...    50   7e-06
NDAI0G00180 Chr7 complement(23120..24514) [1395 bp, 464 aa] {ON}...    50   8e-06
CAGL0J01914g Chr10 complement(191912..192421) [510 bp, 169 aa] {...    48   8e-06
Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W...    47   9e-06
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...    50   9e-06
Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON} (12746.....    49   9e-06
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183     50   1e-05
YNL175C Chr14 complement(307401..308612) [1212 bp, 403 aa] {ON} ...    49   1e-05
Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {...    49   1e-05
Skud_14.159 Chr14 complement(298222..299424) [1203 bp, 400 aa] {...    49   1e-05
TDEL0H01940 Chr8 complement(334207..335163) [957 bp, 318 aa] {ON...    49   1e-05
KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} simila...    49   1e-05
ZYRO0F12716g Chr6 (1035111..1035743) [633 bp, 210 aa] {ON} simil...    48   1e-05
ZYRO0E04928g Chr5 complement(374326..375537,375710..375727) [123...    49   1e-05
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    49   1e-05
KLLA0C08019g Chr3 complement(704199..705104) [906 bp, 301 aa] {O...    49   1e-05
NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80      49   2e-05
Kpol_1026.16 s1026 (34514..35347) [834 bp, 277 aa] {ON} (34514.....    48   2e-05
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...    49   2e-05
KLTH0F02838g Chr6 complement(245748..246740) [993 bp, 330 aa] {O...    49   2e-05
TBLA0C05600 Chr3 complement(1357001..1357648) [648 bp, 215 aa] {...    47   2e-05
Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {...    49   2e-05
TDEL0B06060 Chr2 complement(1071469..1072506) [1038 bp, 345 aa] ...    48   2e-05
NCAS0F01150 Chr6 (227262..228401) [1140 bp, 379 aa] {ON} Anc_5.5...    48   2e-05
TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON} Anc_1...    48   3e-05
NCAS0G01950 Chr7 complement(348633..349847) [1215 bp, 404 aa] {O...    48   3e-05
Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {...    48   3e-05
ADR189W Chr4 (1034091..1034900) [810 bp, 269 aa] {ON} Syntenic h...    47   4e-05
NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON...    47   4e-05
NCAS0E03880 Chr5 complement(761175..763328) [2154 bp, 717 aa] {O...    48   4e-05
SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some s...    48   4e-05
Kpol_487.6 s487 (35743..36873) [1131 bp, 376 aa] {ON} (35743..36...    47   4e-05
NCAS0A08980 Chr1 (1778830..1780647) [1818 bp, 605 aa] {ON} Anc_1...    48   4e-05
TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {O...    47   4e-05
CAGL0L03806g Chr12 (440385..441152) [768 bp, 255 aa] {ON} simila...    47   5e-05
KAFR0B03680 Chr2 (767040..768365) [1326 bp, 441 aa] {ON} Anc_8.8...    47   5e-05
KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2...    47   5e-05
Kpol_150.1 s150 (1938..2354) [417 bp, 138 aa] {ON} (1938..2354) ...    45   5e-05
KAFR0K01050 Chr11 complement(216574..217038) [465 bp, 154 aa] {O...    45   5e-05
TDEL0G01000 Chr7 (206991..209408) [2418 bp, 805 aa] {ON} Anc_5.7...    47   6e-05
NDAI0A02810 Chr1 complement(633738..634247) [510 bp, 169 aa] {ON...    45   6e-05
NDAI0D02800 Chr4 (649804..650751) [948 bp, 315 aa] {ON} Anc_4.66       47   6e-05
YGL044C Chr7 complement(416146..417036) [891 bp, 296 aa] {ON}  R...    47   6e-05
ZYRO0G04862g Chr7 complement(387238..388368) [1131 bp, 376 aa] {...    47   6e-05
KLTH0F13442g Chr6 (1103806..1104210) [405 bp, 134 aa] {ON} simil...    44   6e-05
Ecym_4446 Chr4 (912645..915212) [2568 bp, 855 aa] {ON} similar t...    47   7e-05
CAGL0H03861g Chr8 complement(361189..362520) [1332 bp, 443 aa] {...    47   7e-05
Smik_7.239 Chr7 complement(407397..408296) [900 bp, 299 aa] {ON}...    46   7e-05
ADR017W Chr4 (734484..735005) [522 bp, 173 aa] {ON} Syntenic hom...    45   7e-05
KNAG0D03250 Chr4 complement(580147..580956) [810 bp, 269 aa] {ON...    46   7e-05
Suva_14.229 Chr14 complement(414648..415316) [669 bp, 222 aa] {O...    45   8e-05
Skud_7.240 Chr7 complement(418142..419098) [957 bp, 318 aa] {ON}...    46   8e-05
AFR649W Chr6 (1619582..1620514) [933 bp, 310 aa] {ON} NOHBY659; ...    46   8e-05
Smik_15.500 Chr15 (862344..862985) [642 bp, 213 aa] {ON} YOR319W...    45   9e-05
AEL217W Chr5 (225217..227721) [2505 bp, 834 aa] {ON} Syntenic ho...    47   9e-05
NDAI0H01670 Chr8 (404385..405596) [1212 bp, 403 aa] {ON} Anc_5.5...    46   1e-04
NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167      45   1e-04
TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON...    45   1e-04
KNAG0I02030 Chr9 (396201..396890) [690 bp, 229 aa] {ON} Anc_2.16...    45   1e-04
Skud_9.178 Chr9 complement(326982..327734) [753 bp, 250 aa] {ON}...    45   1e-04
ABL134C Chr2 complement(140623..141750) [1128 bp, 375 aa] {ON} S...    46   1e-04
KLTH0B02992g Chr2 complement(234560..235174) [615 bp, 204 aa] {O...    45   1e-04
KLLA0F23650g Chr6 (2210563..2211501) [939 bp, 312 aa] {ON} simil...    45   2e-04
Kwal_56.24709 s56 complement(1113983..1116469) [2487 bp, 828 aa]...    46   2e-04
KNAG0H01710 Chr8 (304440..304469,304846..306099) [1284 bp, 427 a...    46   2e-04
ZYRO0D09482g Chr4 complement(808223..809092) [870 bp, 289 aa] {O...    45   2e-04
TPHA0D03960 Chr4 complement(829035..831653) [2619 bp, 872 aa] {O...    46   2e-04
TPHA0K01870 Chr11 (391768..392637) [870 bp, 289 aa] {ON} Anc_4.6...    45   2e-04
SAKL0E12738g Chr5 (1052695..1053885) [1191 bp, 396 aa] {ON} simi...    45   2e-04
YNL110C Chr14 complement(417826..418488) [663 bp, 220 aa] {ON}  ...    44   2e-04
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...    45   2e-04
TBLA0A03300 Chr1 (785613..786701) [1089 bp, 362 aa] {ON} Anc_5.3...    45   2e-04
CAGL0D06182g Chr4 (581992..582834) [843 bp, 280 aa] {ON} similar...    45   2e-04
CAGL0M12573g Chr13 (1247678..1248577) [900 bp, 299 aa] {ON} simi...    45   2e-04
SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar...    44   2e-04
TPHA0B02950 Chr2 complement(672465..673121) [657 bp, 218 aa] {ON...    44   3e-04
Kpol_1062.7 s1062 (14539..16821) [2283 bp, 760 aa] {ON} (14539.....    45   3e-04
Ecym_5419 Chr5 (864517..865164) [648 bp, 215 aa] {ON} similar to...    44   3e-04
CAGL0F08217g Chr6 complement(814508..816544) [2037 bp, 678 aa] {...    45   3e-04
YCL011C Chr3 complement(102075..103358) [1284 bp, 427 aa] {ON}  ...    45   3e-04
KAFR0F02770 Chr6 complement(547451..549682) [2232 bp, 743 aa] {O...    45   3e-04
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...    45   3e-04
TPHA0H01140 Chr8 complement(251773..254277) [2505 bp, 834 aa] {O...    45   3e-04
Smik_14.217 Chr14 complement(397474..398136) [663 bp, 220 aa] {O...    44   3e-04
Skud_7.583 Chr7 complement(965719..968058) [2340 bp, 779 aa] {ON...    45   3e-04
Suva_9.210 Chr9 complement(343096..343848) [753 bp, 250 aa] {ON}...    44   4e-04
ZYRO0C12452g Chr3 complement(983386..985986) [2601 bp, 866 aa] {...    45   4e-04
ZYRO0G04004g Chr7 complement(327232..327735) [504 bp, 167 aa] {O...    43   4e-04
Skud_9.182 Chr9 (335662..336111) [450 bp, 149 aa] {ON} YIR005W (...    42   4e-04
TDEL0F03140 Chr6 complement(574041..576608) [2568 bp, 855 aa] {O...    45   4e-04
Skud_13.439 Chr13 complement(776753..778090) [1338 bp, 445 aa] {...    44   4e-04
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....    45   4e-04
KNAG0E03510 Chr5 complement(701816..702334) [519 bp, 172 aa] {ON...    43   4e-04
Suva_9.214 Chr9 (351853..352293) [441 bp, 146 aa] {ON} YIR005W (...    42   5e-04
Kpol_1029.3 s1029 complement(3577..4251) [675 bp, 224 aa] {ON} c...    43   5e-04
Kwal_27.10364 s27 (303432..304763) [1332 bp, 443 aa] {ON} YMR268...    44   5e-04
SAKL0H23298g Chr8 complement(2021024..2021797) [774 bp, 257 aa] ...    44   5e-04
Suva_7.231 Chr7 complement(407919..408848) [930 bp, 309 aa] {ON}...    44   5e-04
YGR250C Chr7 complement(991176..993521) [2346 bp, 781 aa] {ON} P...    44   5e-04
KLTH0A04554g Chr1 (380152..380988) [837 bp, 278 aa] {ON} weakly ...    44   5e-04
Suva_3.8 Chr3 complement(12157..13458) [1302 bp, 433 aa] {ON} YC...    44   5e-04
Suva_7.546 Chr7 complement(946681..949020) [2340 bp, 779 aa] {ON...    44   5e-04
KLLA0A05346g Chr1 (485886..488510) [2625 bp, 874 aa] {ON} some s...    44   5e-04
Skud_14.222 Chr14 complement(408018..408680) [663 bp, 220 aa] {O...    43   5e-04
YIR005W Chr9 (364889..365335) [447 bp, 148 aa] {ON}  IST3Compone...    42   6e-04
NCAS0A05830 Chr1 complement(1146244..1147188) [945 bp, 314 aa] {...    44   6e-04
KLLA0D13772g Chr4 (1185663..1186700) [1038 bp, 345 aa] {ON} some...    44   6e-04
Ecym_7289 Chr7 complement(608012..610132) [2121 bp, 706 aa] {ON}...    44   7e-04
KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {...    43   7e-04
AGL038C Chr7 complement(639306..641444) [2139 bp, 712 aa] {ON} S...    44   8e-04
KLTH0H00792g Chr8 (88079..90586) [2508 bp, 835 aa] {ON} some sim...    44   9e-04
Smik_3.71 Chr3 complement(100547..101833) [1287 bp, 428 aa] {ON}...    44   9e-04
TBLA0C04320 Chr3 (1040065..1040874) [810 bp, 269 aa] {ON} Anc_4....    43   9e-04
SAKL0G05258g Chr7 (432822..433937) [1116 bp, 371 aa] {ON} weakly...    43   0.001
Skud_3.48 Chr3 complement(80985..82274) [1290 bp, 429 aa] {ON} Y...    43   0.001
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...    44   0.001
Kpol_259.1 s259 (2949..3947) [999 bp, 332 aa] {ON} (2949..3947) ...    43   0.001
TBLA0J01830 Chr10 complement(418200..418622) [423 bp, 140 aa] {O...    41   0.001
KLTH0D09262g Chr4 (769384..770055) [672 bp, 223 aa] {ON} similar...    42   0.001
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...    43   0.001
TBLA0A08550 Chr1 (2112176..2114533) [2358 bp, 785 aa] {ON} Anc_4...    44   0.001
ZYRO0C08382g Chr3 (639267..640181) [915 bp, 304 aa] {ON} similar...    43   0.001
Ecym_5574 Chr5 complement(1175694..1178309) [2616 bp, 871 aa] {O...    43   0.001
YIR001C Chr9 complement(356143..356895) [753 bp, 250 aa] {ON}  S...    42   0.001
TDEL0F01220 Chr6 complement(216951..217589) [639 bp, 212 aa] {ON...    42   0.001
NDAI0G04190 Chr7 (1005539..1006618) [1080 bp, 359 aa] {ON} Anc_1...    43   0.001
Kwal_23.5864 s23 (1347244..1348080) [837 bp, 278 aa] {ON} YIL061...    42   0.001
Smik_16.57 Chr16 (103313..105661) [2349 bp, 782 aa] {ON} YGR250C...    43   0.001
SAKL0F04400g Chr6 complement(355542..356108) [567 bp, 188 aa] {O...    42   0.001
YPR112C Chr16 complement(749256..751919) [2664 bp, 887 aa] {ON} ...    43   0.001
NDAI0A04750 Chr1 (1085815..1088346) [2532 bp, 843 aa] {ON} Anc_3...    43   0.001
Suva_13.452 Chr13 complement(782217..783551) [1335 bp, 444 aa] {...    43   0.001
Smik_16.355 Chr16 complement(627408..630068) [2661 bp, 886 aa] {...    43   0.001
Kwal_0.250 s0 complement(122111..122758) [648 bp, 216 aa] {OFF} ...    42   0.001
TBLA0B03120 Chr2 complement(729579..730898) [1320 bp, 439 aa] {O...    43   0.001
Kwal_26.8458 s26 (793431..794090) [660 bp, 219 aa] {ON} YNL110C ...    42   0.001
Kwal_YGOB_0.250 s0 complement(122081..122758) [678 bp, 226 aa] {...    42   0.002
KLTH0E06226g Chr5 (568785..571112) [2328 bp, 775 aa] {ON} weakly...    43   0.002
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...    43   0.002
Smik_9.200 Chr9 complement(332149..332898) [750 bp, 249 aa] {ON}...    42   0.002
Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON} ...    42   0.002
Ecym_4071 Chr4 complement(153279..154091) [813 bp, 270 aa] {ON} ...    42   0.002
KAFR0E03240 Chr5 complement(645818..646963) [1146 bp, 381 aa] {O...    42   0.002
Skud_16.399 Chr16 complement(714087..716726) [2640 bp, 879 aa] {...    43   0.002
KNAG0A07610 Chr1 complement(1194108..1196711) [2604 bp, 867 aa] ...    43   0.002
KLLA0B00979g Chr2 (77439..78467) [1029 bp, 342 aa] {ON} weakly s...    42   0.002
Kwal_27.11096 s27 complement(635969..636574) [606 bp, 201 aa] {O...    41   0.002
TDEL0H03570 Chr8 (590287..591546) [1260 bp, 419 aa] {ON} Anc_7.9...    42   0.002
TPHA0C03940 Chr3 complement(844251..844688) [438 bp, 145 aa] {ON...    40   0.002
Smik_9.204 Chr9 (340893..341342) [450 bp, 149 aa] {ON} YIR005W (...    40   0.002
KLTH0H05214g Chr8 (465108..465710) [603 bp, 200 aa] {ON} highly ...    41   0.002
ZYRO0D12892g Chr4 (1087239..1088474) [1236 bp, 411 aa] {ON} weak...    42   0.003
TBLA0D04850 Chr4 (1191350..1192639) [1290 bp, 429 aa] {ON} Anc_1...    42   0.003
KLTH0D04158g Chr4 (394755..395537) [783 bp, 260 aa] {ON} similar...    41   0.003
NCAS0A02880 Chr1 complement(553819..555585) [1767 bp, 588 aa] {O...    42   0.003
KAFR0F03150 Chr6 complement(624522..625349) [828 bp, 275 aa] {ON...    41   0.003
KLLA0D08206g Chr4 (700152..701327) [1176 bp, 391 aa] {ON} simila...    42   0.003
SAKL0F06160g Chr6 complement(462236..464878) [2643 bp, 880 aa] {...    42   0.003
KLLA0F09383g Chr6 (865710..866486) [777 bp, 258 aa] {ON} similar...    41   0.003
Smik_9.126 Chr9 complement(219413..220315) [903 bp, 300 aa] {ON}...    41   0.003
CAGL0C01529g Chr3 (167802..168512) [711 bp, 236 aa] {ON} similar...    41   0.004
CAGL0E03630g Chr5 complement(335328..337568) [2241 bp, 746 aa] {...    42   0.004
KAFR0I02240 Chr9 complement(459158..460426) [1269 bp, 422 aa] {O...    41   0.004
TDEL0A03990 Chr1 complement(713693..714529) [837 bp, 278 aa] {ON...    41   0.004
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...    42   0.004
Kpol_1023.95 s1023 (221318..222142) [825 bp, 274 aa] {ON} (22131...    41   0.004
KAFR0L00970 Chr12 (181689..182546) [858 bp, 285 aa] {ON} Anc_7.2...    41   0.004
TBLA0A01040 Chr1 complement(235996..236433) [438 bp, 145 aa] {ON...    39   0.004
Ecym_4467 Chr4 complement(951838..952359) [522 bp, 173 aa] {ON} ...    40   0.004
SAKL0F08866g Chr6 (678049..678054,678125..679027) [909 bp, 302 a...    41   0.004
Kwal_26.7522 s26 (402305..403093) [789 bp, 262 aa] {ON} YGL044C ...    40   0.004
KNAG0F01320 Chr6 complement(237828..239075) [1248 bp, 415 aa] {O...    41   0.004
ZYRO0B00924g Chr2 complement(71856..74432) [2577 bp, 858 aa] {ON...    41   0.005
ADR035C Chr4 complement(768390..770906) [2517 bp, 838 aa] {ON} S...    41   0.005
KLTH0F11968g Chr6 (1008620..1011259) [2640 bp, 879 aa] {ON} simi...    41   0.005
AFL224W Chr6 (18862..19482) [621 bp, 206 aa] {ON} Syntenic homol...    40   0.006
KAFR0D01270 Chr4 complement(256417..257748) [1332 bp, 443 aa] {O...    41   0.006
SAKL0D01958g Chr4 (151411..154248) [2838 bp, 945 aa] {ON} some s...    41   0.006
KLTH0G03960g Chr7 complement(314167..315009) [843 bp, 280 aa] {O...    40   0.007
KNAG0I01230 Chr9 (230872..232332) [1461 bp, 486 aa] {ON} Anc_1.4...    40   0.007
KLLA0D14949g Chr4 complement(1259860..1262496) [2637 bp, 878 aa]...    41   0.007
TBLA0C02300 Chr3 (543570..546176) [2607 bp, 868 aa] {ON} Anc_3.4...    41   0.007
Suva_14.344 Chr14 (602901..602930,603310..604644) [1365 bp, 454 ...    40   0.007
SAKL0H25366g Chr8 complement(2212946..2214826) [1881 bp, 626 aa]...    40   0.008
Kwal_30.12890 s30 (3814..4656) [843 bp, 280 aa] {ON} YDR429C (TI...    40   0.008
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...    40   0.009
CAGL0B04169g Chr2 complement(404713..407298) [2586 bp, 861 aa] {...    40   0.010
NCAS0C00510 Chr3 (83308..84645) [1338 bp, 445 aa] {ON} Anc_8.822...    40   0.010
Smik_14.324 Chr14 (581702..582988) [1287 bp, 428 aa] {ON} YNL004...    40   0.010
AGR010C Chr7 complement(736603..737403) [801 bp, 266 aa] {ON} Sy...    39   0.011
ZYRO0D12782g Chr4 complement(1077736..1078557) [822 bp, 273 aa] ...    39   0.012
Kwal_23.3985 s23 (510995..513625) [2631 bp, 876 aa] {ON} YPR112C...    40   0.012
NDAI0D04810 Chr4 complement(1135992..1137872) [1881 bp, 626 aa] ...    40   0.012
Ecym_7344 Chr7 (717321..718130) [810 bp, 269 aa] {ON} similar to...    39   0.012
Smik_4.705 Chr4 (1249525..1250769) [1245 bp, 414 aa] {ON} YDR432...    40   0.013
Skud_4.706 Chr4 (1249139..1250398) [1260 bp, 419 aa] {ON} YDR432...    40   0.014
Smik_13.481 Chr13 complement(785925..787286) [1362 bp, 453 aa] {...    40   0.014
ADL063W Chr4 (569852..569854,569912..570871) [963 bp, 320 aa] {O...    39   0.014
Suva_16.440 Chr16 complement(757046..759706) [2661 bp, 886 aa] {...    40   0.015
Ecym_6416 Chr6 (811576..812748) [1173 bp, 390 aa] {ON} similar t...    39   0.016
TPHA0D02400 Chr4 complement(496366..497247) [882 bp, 293 aa] {ON...    39   0.016
Smik_8.17 Chr8 (40206..42356) [2151 bp, 716 aa] {ON} YHL024W (REAL)    40   0.017
Kpol_1040.23 s1040 complement(65741..67144) [1404 bp, 467 aa] {O...    39   0.017
KNAG0L00570 Chr12 complement(86604..87899) [1296 bp, 431 aa] {ON...    39   0.018
TDEL0A04050 Chr1 (722870..724075) [1206 bp, 401 aa] {ON} Anc_5.5...    39   0.018
KAFR0K01170 Chr11 complement(242500..242925) [426 bp, 141 aa] {O...    37   0.019
TDEL0H03080 Chr8 complement(508090..508917) [828 bp, 275 aa] {ON...    39   0.020
YHL024W Chr8 (56649..58790) [2142 bp, 713 aa] {ON}  RIM4Putative...    39   0.020
TPHA0O01260 Chr15 (250335..252413) [2079 bp, 692 aa] {ON} Anc_1....    39   0.020
KNAG0J00360 Chr10 (56847..58169) [1323 bp, 440 aa] {ON} Anc_8.82...    39   0.021
Skud_14.323 Chr14 (589699..589728,590087..591421) [1365 bp, 454 ...    39   0.021
Kpol_1002.79 s1002 (208736..209365) [630 bp, 209 aa] {ON} (20873...    38   0.021
NDAI0E04860 Chr5 (1103131..1104102) [972 bp, 323 aa] {ON} Anc_7....    39   0.021
TBLA0A01830 Chr1 complement(446153..446839) [687 bp, 228 aa] {ON...    38   0.022
Suva_8.27 Chr8 (58726..60849) [2124 bp, 707 aa] {ON} YHL024W (REAL)    39   0.024
Kpol_1066.35 s1066 complement(57266..58168) [903 bp, 300 aa] {ON...    39   0.024
Kwal_47.18572 s47 complement(878877..879968) [1092 bp, 363 aa] {...    39   0.024
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...    39   0.024
Suva_2.607 Chr2 (1081506..1082435) [930 bp, 309 aa] {ON} YDR432W...    39   0.025
KNAG0K00460 Chr11 (77388..79508) [2121 bp, 706 aa] {ON} Anc_5.76...    39   0.026
TBLA0F03500 Chr6 complement(861480..863774) [2295 bp, 764 aa] {O...    39   0.027
ADR183C Chr4 complement(1024790..1025752) [963 bp, 320 aa] {ON} ...    39   0.027
TPHA0O00720 Chr15 complement(136275..137711) [1437 bp, 478 aa] {...    39   0.027
Skud_8.20 Chr8 (44743..46833) [2091 bp, 696 aa] {ON} YHL024W (REAL)    39   0.029
CAGL0H04675g Chr8 complement(447256..448080) [825 bp, 274 aa] {O...    38   0.029
KNAG0F02200 Chr6 (422342..422980) [639 bp, 212 aa] {ON} Anc_6.17...    38   0.030
Kpol_1018.135 s1018 (361521..364112) [2592 bp, 863 aa] {ON} (361...    39   0.030
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...    39   0.031
TPHA0J00920 Chr10 (217471..218400) [930 bp, 309 aa] {ON} Anc_7.2...    38   0.032
KLLA0E11045g Chr5 (968674..969972) [1299 bp, 432 aa] {ON} simila...    38   0.034
NDAI0I01310 Chr9 (316912..317745) [834 bp, 277 aa] {ON} Anc_6.17...    38   0.036
TPHA0J02110 Chr10 complement(472245..473024) [780 bp, 259 aa] {O...    38   0.036
TDEL0E00830 Chr5 (169821..170693) [873 bp, 290 aa] {ON} Anc_3.74...    38   0.036
NCAS0A13220 Chr1 (2600885..2601400) [516 bp, 171 aa] {ON} Anc_7....    37   0.036
SAKL0G05126g Chr7 complement(423140..423985) [846 bp, 281 aa] {O...    38   0.036
KAFR0A05510 Chr1 (1098387..1100939) [2553 bp, 850 aa] {ON} Anc_3...    39   0.036
Ecym_4324 Chr4 complement(697762..698754,698828..698830) [996 bp...    38   0.037
CAGL0H04763g Chr8 (454589..455740) [1152 bp, 383 aa] {ON} highly...    38   0.037
ACR274W Chr3 (854587..855867) [1281 bp, 426 aa] {ON} Syntenic ho...    38   0.039
TDEL0B00750 Chr2 (139060..140316) [1257 bp, 418 aa] {ON} Anc_8.8...    38   0.039
YNL004W Chr14 (622915..622944,623287..624621) [1365 bp, 454 aa] ...    38   0.040
TDEL0F01800 Chr6 (337313..337972) [660 bp, 219 aa] {ON} Anc_6.17...    37   0.040
YDR432W Chr4 (1328783..1330027) [1245 bp, 414 aa] {ON}  NPL3RNA-...    38   0.043
TDEL0F01640 Chr6 complement(302376..304346) [1971 bp, 656 aa] {O...    38   0.047
Kwal_55.20718 s55 (528743..530527) [1785 bp, 594 aa] {ON} YHL024...    38   0.047
KLLA0B10472g Chr2 complement(914512..915108) [597 bp, 198 aa] {O...    37   0.051
Ecym_4077 Chr4 (162858..163817) [960 bp, 319 aa] {ON} similar to...    37   0.056
ZYRO0G19844g Chr7 (1642204..1642860) [657 bp, 218 aa] {ON} highl...    37   0.062
NCAS0D03580 Chr4 complement(665299..666036) [738 bp, 245 aa] {ON...    37   0.063
YMR268C Chr13 complement(802888..804222) [1335 bp, 444 aa] {ON} ...    37   0.073
NCAS0H02590 Chr8 complement(514898..515710) [813 bp, 270 aa] {ON...    37   0.076
KNAG0L01580 Chr12 (280914..281831) [918 bp, 305 aa] {ON} Anc_7.2...    37   0.082
KAFR0A04360 Chr1 (869776..870402) [627 bp, 208 aa] {ON} Anc_6.17...    36   0.082
KLTH0G04114g Chr7 (328845..330074) [1230 bp, 409 aa] {ON} weakly...    37   0.084
KLLA0F18216g Chr6 (1677731..1679857) [2127 bp, 708 aa] {ON} some...    37   0.085
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...    37   0.088
Kpol_529.20 s529 (59125..61998) [2874 bp, 957 aa] {ON} (59125..6...    37   0.090
TPHA0H02600 Chr8 (607962..609338) [1377 bp, 458 aa] {ON} Anc_7.9...    37   0.10 
AFL050W Chr6 (345624..346280) [657 bp, 218 aa] {ON} Syntenic hom...    36   0.11 
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...    37   0.11 
Kwal_55.20414 s55 (388156..389010) [855 bp, 284 aa] {ON} YFR032C...    36   0.11 
TBLA0A02650 Chr1 complement(642309..642773,643714..643995) [747 ...    36   0.11 
ZYRO0D05654g Chr4 complement(485258..486583) [1326 bp, 441 aa] {...    37   0.11 
CAGL0J02200g Chr10 complement(217645..218079) [435 bp, 144 aa] {...    35   0.11 
ZYRO0G13706g Chr7 complement(1097882..1099144) [1263 bp, 420 aa]...    37   0.12 
Smik_12.12 Chr12 complement(31593..32339) [747 bp, 248 aa] {ON} ...    36   0.12 
Skud_4.704 Chr4 complement(1244854..1245678) [825 bp, 274 aa] {O...    36   0.12 
YDR429C Chr4 complement(1324477..1325301) [825 bp, 274 aa] {ON} ...    36   0.12 
KLTH0D02640g Chr4 complement(261313..262701) [1389 bp, 462 aa] {...    37   0.12 
NCAS0E03280 Chr5 complement(650337..651302) [966 bp, 321 aa] {ON...    36   0.13 
TPHA0K00500 Chr11 (99226..100041) [816 bp, 271 aa] {ON} Anc_5.53...    36   0.13 
Smik_4.703 Chr4 complement(1245222..1246046) [825 bp, 274 aa] {O...    36   0.13 
Kpol_193.1 s193 (1..1776) [1776 bp, 591 aa] {ON} (1..1776) [1776...    37   0.15 
YIL061C Chr9 complement(244657..245559) [903 bp, 300 aa] {ON}  S...    36   0.15 
NCAS0A11540 Chr1 complement(2283352..2285961) [2610 bp, 869 aa] ...    37   0.15 
KNAG0B03650 Chr2 (702368..703207) [840 bp, 279 aa] {ON} Anc_5.53...    36   0.16 
Suva_2.605 Chr2 complement(1077179..1078003) [825 bp, 274 aa] {O...    36   0.16 
Ecym_2246 Chr2 (485381..486091) [711 bp, 236 aa] {ON} similar to...    35   0.17 
KLTH0E04730g Chr5 (423242..424117) [876 bp, 291 aa] {ON} weakly ...    36   0.17 
NCAS0I00520 Chr9 complement(83655..85001) [1347 bp, 448 aa] {ON}...    36   0.18 
TBLA0D01550 Chr4 complement(387300..388562) [1263 bp, 420 aa] {O...    36   0.18 
SAKL0A05588g Chr1 (505510..506133) [624 bp, 207 aa] {ON} highly ...    35   0.20 
CAGL0D01166g Chr4 complement(134536..135441) [906 bp, 301 aa] {O...    35   0.20 
YLL046C Chr12 complement(46714..47463) [750 bp, 249 aa] {ON}  RN...    35   0.23 
CAGL0F01023g Chr6 complement(108155..109345) [1191 bp, 396 aa] {...    35   0.24 
Suva_9.140 Chr9 complement(235080..235988) [909 bp, 302 aa] {ON}...    35   0.25 
SAKL0G12474g Chr7 complement(1060462..1061016) [555 bp, 184 aa] ...    35   0.26 
Kpol_1023.90 s1023 complement(213517..214764) [1248 bp, 415 aa] ...    35   0.27 
NDAI0C01030 Chr3 (199929..200780) [852 bp, 283 aa] {ON} Anc_5.53...    35   0.29 
TBLA0A04750 Chr1 complement(1177080..1178501) [1422 bp, 473 aa] ...    35   0.29 
ADL126C Chr4 complement(469989..471389) [1401 bp, 466 aa] {ON} S...    35   0.30 
CAGL0G05401g Chr7 complement(508557..510572) [2016 bp, 671 aa] {...    35   0.30 
KNAG0C03150 Chr3 complement(623367..624425) [1059 bp, 352 aa] {O...    35   0.31 
KLTH0D12540g Chr4 complement(1025489..1026407,1026476..1026555) ...    35   0.33 
TBLA0B02730 Chr2 complement(628543..629310) [768 bp, 255 aa] {ON...    35   0.34 
CAGL0G05511g Chr7 complement(522026..524050) [2025 bp, 674 aa] {...    35   0.35 
Suva_10.24 Chr10 complement(50291..51052) [762 bp, 253 aa] {ON} ...    35   0.36 
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...    35   0.36 
TBLA0G00910 Chr7 (221951..222784) [834 bp, 277 aa] {ON} Anc_5.53...    35   0.36 
KNAG0I03040 Chr9 complement(605783..607876) [2094 bp, 697 aa] {O...    35   0.37 
SAKL0F04774g Chr6 (381688..382542) [855 bp, 284 aa] {ON} similar...    35   0.39 
Smik_6.375 Chr6 complement(611206..611835) [630 bp, 209 aa] {ON}...    34   0.39 
TPHA0K00460 Chr11 complement(92204..93433) [1230 bp, 409 aa] {ON...    35   0.39 
Suva_15.128 Chr15 complement(223683..225089) [1407 bp, 468 aa] {...    35   0.42 
Skud_9.111 Chr9 complement(215540..216442) [903 bp, 300 aa] {ON}...    35   0.44 
Ecym_2633 Chr2 (1221858..1223150) [1293 bp, 430 aa] {ON} similar...    35   0.47 
KLLA0B00847g Chr2 complement(65983..66792) [810 bp, 269 aa] {ON}...    34   0.48 
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...    35   0.50 
KLTH0F13090g Chr6 complement(1079045..1079482) [438 bp, 145 aa] ...    33   0.51 
SAKL0H05192g Chr8 (466582..466661,466747..467632) [966 bp, 321 a...    34   0.54 
Suva_16.131 Chr16 (221470..222099) [630 bp, 209 aa] {ON} YPL178W...    34   0.55 
Kwal_26.7179 s26 complement(251330..252700) [1371 bp, 456 aa] {O...    34   0.66 
YPL178W Chr16 (212158..212784) [627 bp, 208 aa] {ON}  CBC2Small ...    33   0.73 
KAFR0E03720 Chr5 complement(744915..745358,746003..746269) [711 ...    33   0.80 
Kpol_365.5 s365 (9615..10148,10369..11028) [1194 bp, 397 aa] {ON...    34   0.83 
KLLA0E05237g Chr5 (460483..464460) [3978 bp, 1325 aa] {ON} highl...    34   0.83 
AFR636C Chr6 complement(1596821..1598614) [1794 bp, 597 aa] {ON}...    34   0.92 
KAFR0H01620 Chr8 complement(303924..304916) [993 bp, 330 aa] {ON...    33   0.96 
Ecym_1107 Chr1 complement(223755..225569) [1815 bp, 604 aa] {ON}...    34   1.0  
TPHA0I00420 Chr9 (82903..84300) [1398 bp, 465 aa] {ON} Anc_8.822...    33   1.2  
YOL041C Chr15 complement(251267..252646) [1380 bp, 459 aa] {ON} ...    33   1.2  
Skud_15.116 Chr15 complement(210151..211533) [1383 bp, 460 aa] {...    33   1.2  
Ecym_4483 Chr4 (978489..979556) [1068 bp, 355 aa] {ON} similar t...    33   1.3  
KLLA0C07194g Chr3 (624694..625587) [894 bp, 297 aa] {ON} conserv...    33   1.3  
ADR001C Chr4 complement(708435..709409) [975 bp, 324 aa] {ON} Sy...    33   1.3  
KLTH0F13816g Chr6 (1135521..1135895) [375 bp, 124 aa] {ON} simil...    32   1.7  
YLR226W Chr12 (589354..590541) [1188 bp, 395 aa] {ON}  BUR2Cycli...    33   1.7  
TPHA0F00350 Chr6 (75008..77479) [2472 bp, 823 aa] {ON} Anc_4.33 ...    33   1.9  
Ecym_7208 Chr7 complement(428003..429388) [1386 bp, 461 aa] {ON}...    33   1.9  
Skud_16.102 Chr16 (184532..185161) [630 bp, 209 aa] {ON} YPL178W...    32   2.2  
KAFR0A08250 Chr1 complement(1654902..1655720) [819 bp, 272 aa] {...    32   2.5  
ZYRO0D15224g Chr4 (1279820..1280080) [261 bp, 86 aa] {ON} weakly...    30   2.5  
Ecym_4325 Chr4 complement(699162..701096) [1935 bp, 644 aa] {ON}...    32   2.7  
CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly...    32   2.8  
KLLA0F07799g Chr6 complement(734889..736277) [1389 bp, 462 aa] {...    32   2.9  
Kpol_479.17 s479 (36215..37738) [1524 bp, 507 aa] {ON} (36215..3...    32   3.2  
Smik_12.284 Chr12 (536350..537537) [1188 bp, 395 aa] {ON} YLR226...    32   3.5  
Smik_15.126 Chr15 complement(217400..218782) [1383 bp, 460 aa] {...    32   3.6  
KAFR0A07700 Chr1 (1550013..1551728) [1716 bp, 571 aa] {ON} Anc_2...    32   3.6  
CAGL0A04213g Chr1 (416929..418848) [1920 bp, 639 aa] {ON} simila...    32   3.7  
NDAI0A08510 Chr1 (1960682..1962106) [1425 bp, 474 aa] {ON} Anc_7...    32   3.8  
Kwal_23.3650 s23 complement(376491..377390) [900 bp, 299 aa] {ON...    32   3.8  
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    31   6.1  
Kpol_1069.8 s1069 (14170..15519) [1350 bp, 449 aa] {ON} (14170.....    31   6.3  
Kpol_478.5 s478 (22217..24601) [2385 bp, 794 aa] {ON} (22217..24...    31   6.4  
NDAI0A01780 Chr1 complement(395250..397340) [2091 bp, 696 aa] {O...    31   6.9  
NDAI0F04010 Chr6 (952954..954828) [1875 bp, 624 aa] {ON} Anc_1.1...    31   6.9  
Skud_12.23 Chr12 complement(37510..38280) [771 bp, 256 aa] {ON} ...    30   7.1  
ZYRO0G19250g Chr7 (1595380..1596999) [1620 bp, 539 aa] {ON} high...    31   9.1  
SAKL0F03982g Chr6 complement(319563..319895) [333 bp, 110 aa] {O...    29   9.2  
TPHA0C04450 Chr3 complement(964539..965540) [1002 bp, 333 aa] {O...    30   9.9  

>TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/442 (73%), Positives = 324/442 (73%)

Query: 1   MSEQEHIVEDTVXXXXXXXXXXXXXXXIETPVAAXXXXXXXXXXXXXXXXXXSVGTAAED 60
           MSEQEHIVEDTV               IETPVAA                  SVGTAAED
Sbjct: 1   MSEQEHIVEDTVPAEELASSSPASPESIETPVAAESQENQEDENQDRQKDQESVGTAAED 60

Query: 61  DSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNY 120
           DSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNY
Sbjct: 61  DSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNY 120

Query: 121 AFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDE 180
           AFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDE
Sbjct: 121 AFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDE 180

Query: 181 TLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRIN 240
           TLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRIN
Sbjct: 181 TLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRIN 240

Query: 241 WASKRENATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXSXXXX 300
           WASKRENAT                               Y              S    
Sbjct: 241 WASKRENATNGNGNNNNRNMNNRRNNNNSNSNGPRGGFRSYNNNMPPLPMGNMPMSAPPA 300

Query: 301 XXXXXXXXXXQAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEK 360
                     QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEK
Sbjct: 301 GPAVLPPVNPQAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEK 360

Query: 361 GNCFIKYDTHEQAAVCIVVLANYPFQGRNLKTGWGKEKAVFIXXXXXXXXXXXXXXXXXX 420
           GNCFIKYDTHEQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI                  
Sbjct: 361 GNCFIKYDTHEQAAVCIVVLANYPFQGRNLKTGWGKEKAVFIPMGQQQGMMMSGMPPPPP 420

Query: 421 XXXXXXXXDASTPIPNEQQQQQ 442
                   DASTPIPNEQQQQQ
Sbjct: 421 QQQQQFQQDASTPIPNEQQQQQ 442

>Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {ON}
           complement(70168..71496) [1329 nt, 443 aa]
          Length = 442

 Score =  314 bits (804), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 146/183 (79%), Positives = 160/183 (87%)

Query: 64  VVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFV 123
           +VPANAINGGRETSDKILYVGNLDKSINE+ LKQYFQ+GGPI+NVKVINDKNN  NYAFV
Sbjct: 62  IVPANAINGGRETSDKILYVGNLDKSINEDILKQYFQVGGPITNVKVINDKNNEANYAFV 121

Query: 124 EYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLG 183
           EY QHHDA +A K LNGK IE   LKINWAFQSQQ T+ +  FNLF+GDLNVDVDDETL 
Sbjct: 122 EYSQHHDASIALKTLNGKQIENNTLKINWAFQSQQNTTSDETFNLFIGDLNVDVDDETLV 181

Query: 184 HAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWAS 243
            AF +F SF+QAHVMWDMQTGRSRGYGF+SFSN +DAQ AMD MQ +ELNGRQ+RINWAS
Sbjct: 182 AAFKDFKSFIQAHVMWDMQTGRSRGYGFVSFSNLDDAQVAMDTMQGSELNGRQLRINWAS 241

Query: 244 KRE 246
           KRE
Sbjct: 242 KRE 244

 Score =  193 bits (491), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 90/92 (97%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QAVDDMIRRAP RVTTVYIGNIPHFATEADLIPLLQNFGFILDFK+YPEKGNCFIKYDTH
Sbjct: 310 QAVDDMIRRAPQRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKHYPEKGNCFIKYDTH 369

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           EQAAVCIVVLAN+PFQGRNLKTGWGKEK+ F+
Sbjct: 370 EQAAVCIVVLANFPFQGRNLKTGWGKEKSTFM 401

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 37/82 (45%), Gaps = 2/82 (2%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           L+VG+L+  ++++ L   F          V+ D        Y F+ +S   DA  A+  +
Sbjct: 79  LYVGNLDKSINEDILKQYFQVGGPITNVKVIND--KNNEANYAFVEYSQHHDASIALKTL 136

Query: 228 QSTELNGRQIRINWASKRENAT 249
              ++    ++INWA + +  T
Sbjct: 137 NGKQIENNTLKINWAFQSQQNT 158

>TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa]
           {ON} Anc_2.306 YNL016W
          Length = 470

 Score =  306 bits (785), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 144/190 (75%), Positives = 169/190 (88%), Gaps = 2/190 (1%)

Query: 59  EDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNS- 117
           E+ ++VVPANAI GGRETSDKILYVGNLDKSINE++LKQYFQ+GGPI+NVK+I DKNN  
Sbjct: 63  EESANVVPANAIRGGRETSDKILYVGNLDKSINEDSLKQYFQVGGPIANVKIIVDKNNKY 122

Query: 118 VNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDV 177
            NYAFVEYL+HHDA+VA + LNGK IE K++KINWAFQSQQ+++D++ FNLF+GDLN+DV
Sbjct: 123 CNYAFVEYLKHHDANVALQTLNGKHIEKKIVKINWAFQSQQSSNDDT-FNLFIGDLNIDV 181

Query: 178 DDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
           +DE+L  AF +FPSFVQAHVMWDMQTGRSRGYGF SFS Q DAQ AMD+MQ  ELNGR I
Sbjct: 182 NDESLTAAFKDFPSFVQAHVMWDMQTGRSRGYGFASFSTQNDAQLAMDQMQGKELNGRPI 241

Query: 238 RINWASKREN 247
           RINWASKR+N
Sbjct: 242 RINWASKRDN 251

 Score =  176 bits (446), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 76/91 (83%), Positives = 83/91 (91%)

Query: 312 AVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHE 371
           AV+DMIRRAP RVTT YIGN+P FATEADLIPLLQNFGFILDFK+YP++G CFIKYDTHE
Sbjct: 326 AVEDMIRRAPPRVTTAYIGNLPRFATEADLIPLLQNFGFILDFKHYPDRGICFIKYDTHE 385

Query: 372 QAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           QAAVCIV LAN+P QGRNLKTGWGKEK  F+
Sbjct: 386 QAAVCIVALANFPLQGRNLKTGWGKEKPTFM 416

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 20/97 (20%), Positives = 47/97 (48%), Gaps = 4/97 (4%)

Query: 153 AFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFI 212
           A +  + TSD+ L+   VG+L+  +++++L   F          ++ D +  +   Y F+
Sbjct: 73  AIRGGRETSDKILY---VGNLDKSINEDSLKQYFQVGGPIANVKIIVD-KNNKYCNYAFV 128

Query: 213 SFSNQEDAQTAMDKMQSTELNGRQIRINWASKRENAT 249
            +    DA  A+  +    +  + ++INWA + + ++
Sbjct: 129 EYLKHHDANVALQTLNGKHIEKKIVKINWAFQSQQSS 165

>TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.306
           YNL016W
          Length = 402

 Score =  295 bits (756), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 137/186 (73%), Positives = 158/186 (84%), Gaps = 1/186 (0%)

Query: 60  DDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNS-V 118
           ++  VVPANAI GGRETSDK+LYVGNLD SINEE LKQYFQ+GGPI+NVK++ DKNNS  
Sbjct: 25  EEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA 84

Query: 119 NYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVD 178
           NYAFVEY Q HDA++A + LNGK IE  V+KINWAFQSQQ + DE+ FNLFVGDLNVDVD
Sbjct: 85  NYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVD 144

Query: 179 DETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIR 238
           DETL +AF EFP+++Q HVMWDMQTG SRGYGF+SF +QE+AQ AMD MQ  ELNGR +R
Sbjct: 145 DETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLR 204

Query: 239 INWASK 244
           INWASK
Sbjct: 205 INWASK 210

 Score =  179 bits (455), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 78/92 (84%), Positives = 84/92 (91%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QAVD MIRRAP RVTT YIGNIPHFA EADLIPLLQNFGFI+DFK+YPEKG CFIKYDTH
Sbjct: 279 QAVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 338

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           EQAAVCIV LAN+PFQGRNL+TGWGKE+  F+
Sbjct: 339 EQAAVCIVALANFPFQGRNLRTGWGKERTSFV 370

>NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa]
           {ON} Anc_2.306
          Length = 443

 Score =  290 bits (743), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 134/192 (69%), Positives = 163/192 (84%), Gaps = 1/192 (0%)

Query: 56  TAAEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK- 114
           +A   +S VVPA+A  GGRETSD++LYVGNLDKSINE+ LKQYFQ+GG I++VK++ DK 
Sbjct: 60  SAENQESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKK 119

Query: 115 NNSVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLN 174
           NN+VNYAF+EYL+ HDA+VA + LNG  IE K ++INWAFQSQQTT+ +  FNLFVGDLN
Sbjct: 120 NNNVNYAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLN 179

Query: 175 VDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNG 234
           VDVDDETL HAF +FPS+VQAHVMWDMQTGRSRGYGF+SF++QE AQ AM+ MQ   +NG
Sbjct: 180 VDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPING 239

Query: 235 RQIRINWASKRE 246
           R +RINWA+KRE
Sbjct: 240 RAVRINWATKRE 251

 Score =  185 bits (469), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 80/92 (86%), Positives = 85/92 (92%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QA+DDMIRRAP RVTT YIGNIPHFATEADLIPLLQNFGFILDF +YPEKG CFIKYDTH
Sbjct: 311 QAIDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDFSHYPEKGCCFIKYDTH 370

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           EQAAVCIV LAN+PFQGRNL+TGWGKE+  FI
Sbjct: 371 EQAAVCIVALANFPFQGRNLRTGWGKERNTFI 402

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 4/97 (4%)

Query: 153 AFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFI 212
           A Q  + TSD  L+   VG+L+  ++++ L   F          +M D +   +  Y FI
Sbjct: 73  ATQGGRETSDRVLY---VGNLDKSINEDLLKQYFQVGGQITDVKIMVD-KKNNNVNYAFI 128

Query: 213 SFSNQEDAQTAMDKMQSTELNGRQIRINWASKRENAT 249
            +    DA  A+  +   ++ G+ +RINWA + +  T
Sbjct: 129 EYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTT 165

>ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 410

 Score =  289 bits (740), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 157/190 (82%), Gaps = 1/190 (0%)

Query: 59  EDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNS- 117
            + + VVPANA  GGRETSD++LYVGNLDKSI EE L+QYFQ+GG ISNVKV+ DKNN+ 
Sbjct: 36  RETTPVVPANATKGGRETSDRVLYVGNLDKSITEEVLRQYFQVGGQISNVKVMIDKNNAR 95

Query: 118 VNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDV 177
            NYAFVEY + HDA++A + LNGK IE  V++INWAFQSQQ   DE+ +NLFVGDL+VDV
Sbjct: 96  ANYAFVEYFKSHDANIALQTLNGKQIENNVVRINWAFQSQQALPDENTYNLFVGDLSVDV 155

Query: 178 DDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
           DDETL +AF  FPSF+Q HVMWDMQTG SRGYGF+SF +QE AQ AMD MQS ELNGR +
Sbjct: 156 DDETLCNAFRSFPSFIQGHVMWDMQTGGSRGYGFVSFGDQEQAQLAMDSMQSQELNGRPL 215

Query: 238 RINWASKREN 247
           RINWASKREN
Sbjct: 216 RINWASKREN 225

 Score =  172 bits (437), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 75/92 (81%), Positives = 84/92 (91%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QAV+ MIRRAP RVTT YIGNIPHFAT++DLIPLLQNFGFILDFK+YPEKG CF+KYDTH
Sbjct: 298 QAVEAMIRRAPPRVTTSYIGNIPHFATDSDLIPLLQNFGFILDFKHYPEKGCCFVKYDTH 357

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           EQAAVCIV LAN+ FQGRNL+TGWGKE+  F+
Sbjct: 358 EQAAVCIVALANFFFQGRNLRTGWGKERTTFV 389

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 47/104 (45%), Gaps = 5/104 (4%)

Query: 145 TKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTG 204
           T V+  N A +  + TSD  L+   VG+L+  + +E L   F          VM D    
Sbjct: 39  TPVVPAN-ATKGGRETSDRVLY---VGNLDKSITEEVLRQYFQVGGQISNVKVMIDKNNA 94

Query: 205 RSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKRENA 248
           R+  Y F+ +    DA  A+  +   ++    +RINWA + + A
Sbjct: 95  RAN-YAFVEYFKSHDANIALQTLNGKQIENNVVRINWAFQSQQA 137

>Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 aa]
           {ON} YNL016W (REAL)
          Length = 457

 Score =  290 bits (742), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 166/191 (86%), Gaps = 2/191 (1%)

Query: 58  AEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN- 116
            E+D  VVPANAI GGRETSD++LYVGNLDK+I E+ LKQYFQ+GGPI+N+K++ DKNN 
Sbjct: 55  GENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNK 114

Query: 117 SVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVD 176
           +VNYAFVEY Q HDA++A + LNGK IE  V+KINWAFQSQQ++SD++ FNLFVGDLNV+
Sbjct: 115 NVNYAFVEYHQSHDANIALQTLNGKQIENNVVKINWAFQSQQSSSDDT-FNLFVGDLNVN 173

Query: 177 VDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQ 236
           VDDETL +AF +FPS++  HVMWDMQTG SRGYGF+SF++Q+DAQTAMD MQ  +LNGR 
Sbjct: 174 VDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRP 233

Query: 237 IRINWASKREN 247
           +RINWA+KR+N
Sbjct: 234 LRINWAAKRDN 244

 Score =  176 bits (445), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 77/92 (83%), Positives = 84/92 (91%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QAVD +IR AP RVTT YIGNIPHFATEADLIPL QNFGFILDFK+YPEKG CFIKYDTH
Sbjct: 329 QAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTH 388

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           EQAAVCIV LAN+PFQGRNL+TGWGKE++ F+
Sbjct: 389 EQAAVCIVALANFPFQGRNLRTGWGKERSNFM 420

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           L+VG+L+  + ++ L   F          +M D +  ++  Y F+ +    DA  A+  +
Sbjct: 78  LYVGNLDKAITEDILKQYFQVGGPIANIKIMID-KNNKNVNYAFVEYHQSHDANIALQTL 136

Query: 228 QSTELNGRQIRINWASKRENAT 249
              ++    ++INWA + + ++
Sbjct: 137 NGKQIENNVVKINWAFQSQQSS 158

>Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016W
           (REAL)
          Length = 451

 Score =  288 bits (738), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 165/190 (86%), Gaps = 2/190 (1%)

Query: 58  AEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN- 116
            E+D  VVPANAI GGRETSDK+LYVGNLDK+I E+ LKQYFQ+GGPI+N+K++ DKNN 
Sbjct: 52  GENDPSVVPANAITGGRETSDKVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNK 111

Query: 117 SVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVD 176
           +VNYAFVEY Q HDA++A + LNGK IE  ++KINWAFQSQQ++SD++ FNLFVGDLNV+
Sbjct: 112 NVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDT-FNLFVGDLNVN 170

Query: 177 VDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQ 236
           VDDETL +AF +FPS++  HVMWDMQTG SRGYGF+SF++Q+DAQTAMD MQ  +LNGR 
Sbjct: 171 VDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRP 230

Query: 237 IRINWASKRE 246
           +RINWA+KR+
Sbjct: 231 LRINWAAKRD 240

 Score =  176 bits (445), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 77/92 (83%), Positives = 84/92 (91%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QAVD +IR AP RVTT YIGNIPHFATEADLIPL QNFGFILDFK+YPEKG CFIKYDTH
Sbjct: 327 QAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTH 386

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           EQAAVCIV LAN+PFQGRNL+TGWGKE++ F+
Sbjct: 387 EQAAVCIVALANFPFQGRNLRTGWGKERSNFM 418

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 45/97 (46%), Gaps = 4/97 (4%)

Query: 153 AFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFI 212
           A    + TSD+ L+   VG+L+  + ++ L   F          +M D +  ++  Y F+
Sbjct: 63  AITGGRETSDKVLY---VGNLDKAITEDILKQYFQVGGPIANIKIMID-KNNKNVNYAFV 118

Query: 213 SFSNQEDAQTAMDKMQSTELNGRQIRINWASKRENAT 249
            +    DA  A+  +   ++    ++INWA + + ++
Sbjct: 119 EYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSS 155

>CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]
           {ON} similar to uniprot|P32588 Saccharomyces cerevisiae
           YNL016w PUB1
          Length = 416

 Score =  287 bits (734), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 134/189 (70%), Positives = 156/189 (82%), Gaps = 1/189 (0%)

Query: 59  EDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVIND-KNNS 117
           +D   VVPA+A  GGRETSD++LYVGNLDKSI E+ LKQYFQ GGPI NVK+I D KN  
Sbjct: 38  DDKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEY 97

Query: 118 VNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDV 177
           VNYAFVEY++ HDA+VA + LNG  +E K LKINWAF++QQ   ++  FNLFVGDLNVDV
Sbjct: 98  VNYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDV 157

Query: 178 DDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
           DDETL   F EFP+F+QAHVMWDMQTGRSRGYGF+SFSNQE+AQ AMD MQ  +L+GRQI
Sbjct: 158 DDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217

Query: 238 RINWASKRE 246
           RINWA+KRE
Sbjct: 218 RINWATKRE 226

 Score =  178 bits (452), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 77/92 (83%), Positives = 85/92 (92%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QA++DMIRRAP RVTT YIGNIPH+ATEADLIPLLQNFGFILDF +YPEKG CFIKYDTH
Sbjct: 301 QAIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 360

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           EQAAVCIV LAN+PFQGRNL+TGWGKE+  F+
Sbjct: 361 EQAAVCIVALANFPFQGRNLRTGWGKERTNFM 392

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 2/84 (2%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYLQHHDADVAFKNL 138
           L+VG+L+  +++ETL   F+         V+ D     S  Y FV +    +A  A   +
Sbjct: 148 LFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAM 207

Query: 139 NGKTIETKVLKINWAFQSQQTTSD 162
            GK +  + ++INWA + ++   +
Sbjct: 208 QGKDLSGRQIRINWATKRERNMGN 231

 Score = 37.0 bits (84), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           L+VG+L+  + ++ L   F          ++ DM+      Y F+ +    DA  A+  +
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKN-EYVNYAFVEYIRSHDANVALQTL 118

Query: 228 QSTELNGRQIRINWASKRENA 248
              +L  + ++INWA + + A
Sbjct: 119 NGVQLENKTLKINWAFETQQA 139

>Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016W
           (REAL)
          Length = 459

 Score =  287 bits (734), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 164/190 (86%), Gaps = 2/190 (1%)

Query: 58  AEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN- 116
            E D  VVPANAI GGRETSD++LYVGNLDK+I E+ LKQYFQ+GGPI+N+K++ DKNN 
Sbjct: 54  GESDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNK 113

Query: 117 SVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVD 176
           +VNYAFVEY Q HDA++A + LNGK IE  ++KINWAFQSQQ++SD++ FNLFVGDLNV+
Sbjct: 114 NVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDT-FNLFVGDLNVN 172

Query: 177 VDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQ 236
           VDDETL +AF +FPS++  HVMWDMQTG SRGYGF+SF++Q+DAQTAMD MQ  +LNGR 
Sbjct: 173 VDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDTMQGQDLNGRP 232

Query: 237 IRINWASKRE 246
           +RINWA+KR+
Sbjct: 233 LRINWAAKRD 242

 Score =  176 bits (445), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 77/92 (83%), Positives = 84/92 (91%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QAVD +IR AP RVTT YIGNIPHFATEADLIPL QNFGFILDFK+YPEKG CFIKYDTH
Sbjct: 333 QAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTH 392

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           EQAAVCIV LAN+PFQGRNL+TGWGKE++ F+
Sbjct: 393 EQAAVCIVALANFPFQGRNLRTGWGKERSNFM 424

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           L+VG+L+  + ++ L   F          +M D +  ++  Y F+ +    DA  A+  +
Sbjct: 77  LYVGNLDKAITEDILKQYFQVGGPIANIKIMID-KNNKNVNYAFVEYHQSHDANIALQTL 135

Query: 228 QSTELNGRQIRINWASKRENAT 249
              ++    ++INWA + + ++
Sbjct: 136 NGKQIENNIVKINWAFQSQQSS 157

>YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly
           (A)+ RNA-binding protein, abundant mRNP-component
           protein that binds mRNA and is required for stability of
           many mRNAs; component of glucose deprivation induced
           stress granules, involved in P-body-dependent granule
           assembly
          Length = 453

 Score =  286 bits (731), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 131/190 (68%), Positives = 164/190 (86%), Gaps = 2/190 (1%)

Query: 58  AEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN- 116
            E+D  VVPANAI GGRETSD++LYVGNLDK+I E+ LKQYFQ+GGPI+N+K++ DKNN 
Sbjct: 54  GENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNK 113

Query: 117 SVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVD 176
           +VNYAFVEY Q HDA++A + LNGK IE  ++KINWAFQSQQ++SD++ FNLFVGDLNV+
Sbjct: 114 NVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDT-FNLFVGDLNVN 172

Query: 177 VDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQ 236
           VDDETL +AF +FPS++  HVMWDMQTG SRGYGF+SF++Q+DAQ AMD MQ  +LNGR 
Sbjct: 173 VDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRP 232

Query: 237 IRINWASKRE 246
           +RINWA+KR+
Sbjct: 233 LRINWAAKRD 242

 Score =  176 bits (446), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 77/92 (83%), Positives = 84/92 (91%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QAVD +IR AP RVTT YIGNIPHFATEADLIPL QNFGFILDFK+YPEKG CFIKYDTH
Sbjct: 327 QAVDHIIRSAPPRVTTAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTH 386

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           EQAAVCIV LAN+PFQGRNL+TGWGKE++ F+
Sbjct: 387 EQAAVCIVALANFPFQGRNLRTGWGKERSNFM 418

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           L+VG+L+  + ++ L   F          +M D +  ++  Y F+ +    DA  A+  +
Sbjct: 77  LYVGNLDKAITEDILKQYFQVGGPIANIKIMID-KNNKNVNYAFVEYHQSHDANIALQTL 135

Query: 228 QSTELNGRQIRINWASKRENAT 249
              ++    ++INWA + + ++
Sbjct: 136 NGKQIENNIVKINWAFQSQQSS 157

>SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {ON}
           some similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 401

 Score =  283 bits (725), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 156/192 (81%), Gaps = 2/192 (1%)

Query: 56  TAAEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN 115
           T  E+   + PAN   GGRETSDKILYVGNLDKSI E+ LKQYFQ+GGP++NVK++ DKN
Sbjct: 21  TPVEEQPQITPANVARGGRETSDKILYVGNLDKSITEDLLKQYFQVGGPVANVKILVDKN 80

Query: 116 N-SVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLN 174
           N   NYAFVEY + HDA+VAF+ L+GKTIE   +KINWAFQS Q  SDES FNLFVGDLN
Sbjct: 81  NQEANYAFVEYHKPHDANVAFQTLDGKTIENNQIKINWAFQSHQVASDES-FNLFVGDLN 139

Query: 175 VDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNG 234
           VDVDDETL +AFSEF +F+QAHVMWDMQ+GRSRGYGF+SF  QE AQ AM+  Q  ELNG
Sbjct: 140 VDVDDETLANAFSEFSAFIQAHVMWDMQSGRSRGYGFVSFGEQEQAQKAMETKQGFELNG 199

Query: 235 RQIRINWASKRE 246
           R IRINWASKRE
Sbjct: 200 RAIRINWASKRE 211

 Score =  173 bits (439), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 80/87 (91%)

Query: 316 MIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAV 375
           MIRRAP R+TT YIGNIPHFATE DLIPLLQNFGFI+DFK+YPEKG CFIKYDTHEQAAV
Sbjct: 289 MIRRAPPRITTAYIGNIPHFATEPDLIPLLQNFGFIVDFKHYPEKGCCFIKYDTHEQAAV 348

Query: 376 CIVVLANYPFQGRNLKTGWGKEKAVFI 402
           CIV LAN+PFQGRNL+TGWGKEK  FI
Sbjct: 349 CIVALANFPFQGRNLRTGWGKEKPTFI 375

>AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL016W
           (PUB1)
          Length = 378

 Score =  277 bits (708), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 132/184 (71%), Positives = 152/184 (82%), Gaps = 2/184 (1%)

Query: 65  VPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNS-VNYAFV 123
            P  A  GGRETSD+ILYVGNLDK+INE TLKQYFQ+GGPI+NVKV+ DKNN   NYAFV
Sbjct: 21  TPVLATKGGRETSDRILYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFV 80

Query: 124 EYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLG 183
           EY Q  DA+VAF+ L+GK IE  V+KINWAFQSQQ +SD++ FNLFVGDLNVDVDDETL 
Sbjct: 81  EYRQPRDANVAFQTLDGKQIENNVIKINWAFQSQQVSSDDT-FNLFVGDLNVDVDDETLS 139

Query: 184 HAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWAS 243
             F EFP+F+QAHVMWDMQ+GRSRGYGF+SF  QE+AQ AMD  Q   LNGR IR+NWA+
Sbjct: 140 STFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAA 199

Query: 244 KREN 247
           KRE+
Sbjct: 200 KRES 203

 Score =  167 bits (424), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QAV+ MIRRAP RVTT YIGNIPHFA E DLIPLLQNFGFI+DFK+Y EKG CFIKYDTH
Sbjct: 257 QAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYAEKGCCFIKYDTH 316

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           +QAA+CIV LAN+PFQGR L+TGWGKEK  F+
Sbjct: 317 DQAALCIVALANFPFQGRTLRTGWGKEKPSFV 348

>Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar to
           Ashbya gossypii AGR390C
          Length = 421

 Score =  278 bits (711), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 154/188 (81%), Gaps = 2/188 (1%)

Query: 60  DDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNS-V 118
           D S V P  A  GGRETSD+ILYVGNLDK+INE+TLKQYFQ+GGPI+NVKV+ DKNN   
Sbjct: 44  DQSQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA 103

Query: 119 NYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVD 178
           NYAFVEY Q HDA+VAF+ L+GK IE  V+KINWAFQSQ  +SD++ FNLFVGDLNVDVD
Sbjct: 104 NYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDT-FNLFVGDLNVDVD 162

Query: 179 DETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIR 238
           DETL   F EFPSF+QAHVMWDM +GRSRGYGF+SFS Q+ AQ AM+  Q   LNGR IR
Sbjct: 163 DETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIR 222

Query: 239 INWASKRE 246
           INWASKRE
Sbjct: 223 INWASKRE 230

 Score =  172 bits (437), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 79/87 (90%)

Query: 316 MIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAV 375
           MIRRAP RVTT YIGNIPHFA E DLIPLLQNFGFI+DFK+YPEKG CFIKYDTHEQAAV
Sbjct: 305 MIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAV 364

Query: 376 CIVVLANYPFQGRNLKTGWGKEKAVFI 402
           CIV LAN+PFQGRNL+TGWGKEK  FI
Sbjct: 365 CIVALANFPFQGRNLRTGWGKEKPAFI 391

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           L+VG+L+  ++++TL   F          V+ D +      Y F+ +    DA  A   +
Sbjct: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQTL 123

Query: 228 QSTELNGRQIRINWASKRENAT 249
              ++ G  I+INWA + ++ +
Sbjct: 124 DGKQIEGNVIKINWAFQSQHVS 145

>NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {ON}
           Anc_6.104 YBR212W
          Length = 499

 Score =  279 bits (714), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 129/193 (66%), Positives = 159/193 (82%), Gaps = 1/193 (0%)

Query: 55  GTAAEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK 114
           G   E++ +VVPA+A +GGRETSD++LYVGNLDKSINE+ LKQYFQ+GG I++VK++ DK
Sbjct: 63  GEEQEEEPNVVPASATHGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK 122

Query: 115 NN-SVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDL 173
            N +VNYAFVEYL+ HDA+VA + LNG  IE K++KINWAFQSQQ  +    FNLFVGDL
Sbjct: 123 KNQNVNYAFVEYLKSHDANVALQTLNGIQIENKIIKINWAFQSQQNLNSNDTFNLFVGDL 182

Query: 174 NVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELN 233
           N+DVDDETL   F  FPS++QAHVMWDMQT RSRGYGF+SF++++ AQ AMD MQ  E+N
Sbjct: 183 NIDVDDETLSSNFKNFPSYIQAHVMWDMQTSRSRGYGFVSFADRDQAQNAMDTMQGKEIN 242

Query: 234 GRQIRINWASKRE 246
           GR IRINWA+KRE
Sbjct: 243 GRPIRINWATKRE 255

 Score =  184 bits (466), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 80/92 (86%), Positives = 84/92 (91%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QAVDDMIRRAP RVTT YIGNIPHFATEADLIPLLQ FGFILDF +YPEKG CFIKYDTH
Sbjct: 352 QAVDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQTFGFILDFSHYPEKGCCFIKYDTH 411

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           EQAAVCIV LAN+PFQGRNL+TGWGKE+  FI
Sbjct: 412 EQAAVCIVALANFPFQGRNLRTGWGKERTTFI 443

>KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  276 bits (706), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 129/191 (67%), Positives = 158/191 (82%), Gaps = 1/191 (0%)

Query: 58  AEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKV-INDKNN 116
           A  +  VVPANA +GGRETSD++LYVGNLDKSI E+ LKQYFQ+ G I +VKV I+ K+N
Sbjct: 58  ANKEPPVVPANATHGGRETSDRVLYVGNLDKSITEDILKQYFQVAGQIVDVKVMIDKKSN 117

Query: 117 SVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVD 176
            VNYAFVEY + HDA VA + LNG  IE   +KIN AFQSQQ+T+D+S FNLFVGDLN+D
Sbjct: 118 YVNYAFVEYAKAHDASVALQTLNGIQIENNKVKINRAFQSQQSTTDDSTFNLFVGDLNID 177

Query: 177 VDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQ 236
           +DD+TL  +F +FPS++QAHVMWDMQTGRSRGYGF+SF++QE AQ AM++MQ  ELNGR 
Sbjct: 178 IDDDTLSRSFKDFPSYIQAHVMWDMQTGRSRGYGFVSFADQEQAQKAMEEMQGKELNGRP 237

Query: 237 IRINWASKREN 247
           IRINWA+KR+N
Sbjct: 238 IRINWATKRDN 248

 Score =  176 bits (447), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 77/91 (84%), Positives = 83/91 (91%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QAVDDMIRRAP RV+T YIGNIPHFATEADLIPLLQ+FGFILDF +YPEKG CFIKYDTH
Sbjct: 325 QAVDDMIRRAPPRVSTAYIGNIPHFATEADLIPLLQSFGFILDFTHYPEKGCCFIKYDTH 384

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVF 401
           EQAAVCIV LAN+ FQGRNL+TGWGKE+  F
Sbjct: 385 EQAAVCIVALANFNFQGRNLRTGWGKERNTF 415

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 54/120 (45%), Gaps = 5/120 (4%)

Query: 130 DADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEF 189
           +ADV  +       E  V+  N A    + TSD  L+   VG+L+  + ++ L   F   
Sbjct: 47  EADVVPEENEEANKEPPVVPAN-ATHGGRETSDRVLY---VGNLDKSITEDILKQYFQVA 102

Query: 190 PSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKRENAT 249
              V   VM D ++     Y F+ ++   DA  A+  +   ++   +++IN A + + +T
Sbjct: 103 GQIVDVKVMIDKKSNYVN-YAFVEYAKAHDASVALQTLNGIQIENNKVKINRAFQSQQST 161

>KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 475

 Score =  274 bits (701), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 132/189 (69%), Positives = 151/189 (79%), Gaps = 2/189 (1%)

Query: 59  EDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN-S 117
           E+D    P  A  GGRE SDKILYVGNL KSI+++ LKQYFQIGG IS+VK+I DKN+  
Sbjct: 77  EEDDSAAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQE 136

Query: 118 VNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDV 177
            NYAFVEY + HDA+VA++ LNGK +E KVLKINWAFQSQQ  SDE+ FNLFVGDLNVDV
Sbjct: 137 CNYAFVEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDET-FNLFVGDLNVDV 195

Query: 178 DDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
           DD TL   F EFPSF+QAHVMWDMQ+GRSRGYGF+SF  Q+ AQ AM+  Q  ELNGR +
Sbjct: 196 DDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRAL 255

Query: 238 RINWASKRE 246
           RINWASKRE
Sbjct: 256 RINWASKRE 264

 Score =  176 bits (445), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 75/92 (81%), Positives = 83/92 (90%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           +AV+DM+RRAP RVTT YIGNIPHFA E DLIPLLQNFGFI+DFK+YPEKG CFIKYDTH
Sbjct: 345 EAVEDMMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH 404

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           EQAA+CIV L N+PFQGRNL+TGWGKEK  FI
Sbjct: 405 EQAALCIVALTNFPFQGRNLRTGWGKEKPTFI 436

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 4/91 (4%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYLQHHDADVAFKNL 138
           L+VG+L+  +++ TL   F+         V+ D     S  Y FV + +   A VA +  
Sbjct: 186 LFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETK 245

Query: 139 NGKTIETKVLKINWAF--QSQQTTSDESLFN 167
            G  +  + L+INWA   + QQ+   +  FN
Sbjct: 246 QGFELNGRALRINWASKREPQQSQQGQRRFN 276

>KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some
           similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 436

 Score =  270 bits (691), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 152/189 (80%), Gaps = 2/189 (1%)

Query: 60  DDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNS-V 118
           ++  V PANA  GGRETSD+ILYVGNLD ++ EE LKQYFQ+GG I+NVK++ DKNN   
Sbjct: 48  EEPTVTPANASRGGRETSDRILYVGNLDLAVTEEMLKQYFQVGGSIANVKILMDKNNKQA 107

Query: 119 NYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVD 178
           NYAFVE+ Q HDA+VAF+ L+GK IE  V+KINWAFQSQQ +S+++ FNLFVGDLNVDVD
Sbjct: 108 NYAFVEFHQPHDANVAFQTLDGKQIENHVIKINWAFQSQQVSSEDT-FNLFVGDLNVDVD 166

Query: 179 DETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIR 238
           DETL   F + P+F+QAHVMWDMQTGRSRGYGF+SF  Q  AQ AM+  Q   +NGR IR
Sbjct: 167 DETLARTFKDIPTFIQAHVMWDMQTGRSRGYGFVSFGEQTQAQKAMEDNQGAVVNGRAIR 226

Query: 239 INWASKREN 247
           INWASKRE+
Sbjct: 227 INWASKREH 235

 Score =  169 bits (428), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 82/92 (89%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QAV+ M+R AP RVTTVYIGNIPHFATE DLIPLLQNFGFI+DFK+YP++G CFIKY TH
Sbjct: 307 QAVEAMMRSAPPRVTTVYIGNIPHFATEQDLIPLLQNFGFIVDFKHYPDRGCCFIKYGTH 366

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           EQAAVCI+ L N+PFQGRNL+TGWGKEK  +I
Sbjct: 367 EQAAVCILTLGNFPFQGRNLRTGWGKEKPSYI 398

>Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {ON}
           YNL016W (PUB1) - poly(A)+ RNA-binding protein [contig
           27] FULL
          Length = 439

 Score =  269 bits (687), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 156/196 (79%), Gaps = 4/196 (2%)

Query: 53  SVGTAAEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVIN 112
           + G AAE    V PANA  GGRETSD+ILYVGNLD ++ E+ LKQYFQ+GG I+NVK++ 
Sbjct: 38  TAGKAAE--PAVTPANATRGGRETSDRILYVGNLDLAVTEDMLKQYFQVGGAIANVKILM 95

Query: 113 DKNNS-VNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVG 171
           DKNN   NYAFVE+ Q HDA VAF+ L+GK IE  V+KIN+AFQSQQ +S+++ FNLFVG
Sbjct: 96  DKNNKEANYAFVEFHQPHDASVAFQTLDGKQIENHVIKINYAFQSQQVSSEDT-FNLFVG 154

Query: 172 DLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTE 231
           DLNVDVDDETL + F   P+F+QAHVMWDMQTGRSRGYGF+SF  Q  AQ AM++ Q T 
Sbjct: 155 DLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTV 214

Query: 232 LNGRQIRINWASKREN 247
           +NGR IRINWASKRE+
Sbjct: 215 VNGRAIRINWASKREH 230

 Score =  168 bits (425), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 82/92 (89%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QA++ MIR AP RVTTVYIGNIPHFA+E DLIPLLQNFGFI+DFK+YP++G CFIKY TH
Sbjct: 310 QAIEAMIRSAPSRVTTVYIGNIPHFASEQDLIPLLQNFGFIVDFKHYPDRGCCFIKYGTH 369

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           EQAA+CI+ L N+PFQGRNL+TGWGKEK  ++
Sbjct: 370 EQAAICILTLGNFPFQGRNLRTGWGKEKPTYV 401

>KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {ON}
           Anc_2.306 YNL016W
          Length = 365

 Score =  263 bits (673), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 150/185 (81%), Gaps = 1/185 (0%)

Query: 63  DVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK-NNSVNYA 121
           +V+PA+A  GGRETSDK+LY+GNLDKSINE+ LKQYFQ+ G I +VKV+ DK NN VNYA
Sbjct: 15  NVIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIVDVKVMVDKKNNHVNYA 74

Query: 122 FVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDET 181
           F+EY  +HDA+VA + LNG  IE K +KINWAFQSQ   +D++ FNLF+GDLNV+VDD T
Sbjct: 75  FIEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTT 134

Query: 182 LGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINW 241
           L +AF   P F+QAHVMWDMQT RSRGYGF+SF   E+AQ AMD+MQ  E+NGR IRINW
Sbjct: 135 LANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINW 194

Query: 242 ASKRE 246
           A+KRE
Sbjct: 195 ATKRE 199

 Score =  176 bits (447), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 77/92 (83%), Positives = 84/92 (91%)

Query: 311 QAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTH 370
           QAV+DMIRRAP RVTT YIGNIPHFATE DLIPLLQNFGFILDF +YPEKG CFIKYDTH
Sbjct: 246 QAVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTH 305

Query: 371 EQAAVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           EQAAVCIV L+N+ FQGRNL+TGWGKE++ FI
Sbjct: 306 EQAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 33/74 (44%), Gaps = 5/74 (6%)

Query: 327 VYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGN-----CFIKYDTHEQAAVCIVVLA 381
           +YIGN+     E  L    Q  G I+D K   +K N      FI+Y T+  A V +  L 
Sbjct: 33  LYIGNLDKSINEDALKQYFQVAGQIVDVKVMVDKKNNHVNYAFIEYSTNHDANVALQTLN 92

Query: 382 NYPFQGRNLKTGWG 395
               + +N+K  W 
Sbjct: 93  GIQIENKNIKINWA 106

>Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON}
           (111076..112818) [1743 nt, 581 aa]
          Length = 580

 Score = 99.8 bits (247), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 97/189 (51%), Gaps = 7/189 (3%)

Query: 53  SVGTAAEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVIN 112
           S G+AAE  S    +N  N G       LYVG LD S++E  L   F   GP+S+++V  
Sbjct: 28  SSGSAAEVSS---ASNGGNSGTAVDSASLYVGELDPSVSEALLYDIFSPIGPVSSIRVCR 84

Query: 113 DK--NNSVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFV 170
           D     S+ YA+V +  H    VA + LN   I+ K  +I W+ Q   +       N+F+
Sbjct: 85  DAVTKTSLGYAYVNFNDHDSGKVAIEKLNYTPIKGKPCRIMWS-QRDPSMRKNGSGNIFI 143

Query: 171 GDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQST 230
            +L+ D+D++ L   FS F + +   +  D +TG+S+G+GF+ F     A  A+D +   
Sbjct: 144 KNLHADIDNKALHDTFSVFGNILSCKIATD-ETGKSKGFGFVHFEEDTAASEAIDAINGM 202

Query: 231 ELNGRQIRI 239
            LNG ++ +
Sbjct: 203 MLNGLEVYV 211

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 87/182 (47%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFKNLN 139
           +YV N+D    EE  ++ F+  GPI+++ +  D       + FV Y  H  A  A   LN
Sbjct: 234 VYVKNVDLEATEEEFEELFKKFGPITSISMEKDSEGKFRGFGFVNYENHESAAKAVDELN 293

Query: 140 GKTIETKVLKINWA------FQSQQTTSDESLF---------NLFVGDLNVDVDDETLGH 184
               +++ L +  A       Q  +   +E+           NLFV +L+  +DDE L  
Sbjct: 294 DLEFKSQKLYVGRAQKKYERLQELKKQYEEAKLEKMAKYQGVNLFVKNLDDTIDDELLKK 353

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F  F +     VM + +TG+S+G+GF+ FS+ E+A  A+ +     + G+ + +  A +
Sbjct: 354 EFESFGTITSVKVMRN-ETGKSKGFGFVCFSSPEEATRAITEKNQQIVAGKPLYVALAQR 412

Query: 245 RE 246
           ++
Sbjct: 413 KD 414

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 41/78 (52%)

Query: 167 NLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDK 226
           +L+VG+L+  V +  L   FS         V  D  T  S GY +++F++ +  + A++K
Sbjct: 52  SLYVGELDPSVSEALLYDIFSPIGPVSSIRVCRDAVTKTSLGYAYVNFNDHDSGKVAIEK 111

Query: 227 MQSTELNGRQIRINWASK 244
           +  T + G+  RI W+ +
Sbjct: 112 LNYTPIKGKPCRIMWSQR 129

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 84/180 (46%), Gaps = 11/180 (6%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK-NNSVNYAFVEYLQHHDAD 132
           R+     +++ NL   I+ + L   F + G I + K+  D+   S  + FV + +   A 
Sbjct: 134 RKNGSGNIFIKNLHADIDNKALHDTFSVFGNILSCKIATDETGKSKGFGFVHFEEDTAAS 193

Query: 133 VAFKNLNGKTIETKVLKINWAF-------QSQQTTSDESLFNLFVGDLNVDVDDETLGHA 185
            A   +NG  +    L++  A        +S+   +  +  N++V +++++  +E     
Sbjct: 194 EAIDAINGMMLNG--LEVYVAAHVSRKDRESKFEAAKANFTNVYVKNVDLEATEEEFEEL 251

Query: 186 FSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           F +F       +  D + G+ RG+GF+++ N E A  A+D++   E   +++ +  A K+
Sbjct: 252 FKKFGPITSISMEKDSE-GKFRGFGFVNYENHESAAKAVDELNDLEFKSQKLYVGRAQKK 310

>Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to
           Ashbya gossypii ADR307W
          Length = 602

 Score = 98.2 bits (243), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 100/181 (55%), Gaps = 9/181 (4%)

Query: 73  GRETSDKILYVGNLDKSINEETLKQ-YFQIGGPISNVKVINDKN--NSVNYAFVEYLQHH 129
           G ET+   LY+G+LD S  E  +KQ +  +G P   VK+I +    N+  Y FVE+  + 
Sbjct: 47  GPETTSTQLYMGDLDASWTENDIKQIWATLGEPNVQVKLIKNSGPMNNSGYCFVEFPSNL 106

Query: 130 DADVAF--KNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAF- 186
            A  A     L      ++ LK+NWA      T+  + F++FVGDL  +V +  L   F 
Sbjct: 107 SATNALLKTGLPIPVDPSRSLKLNWA---SFATAPGTEFSIFVGDLAPNVSESQLFELFI 163

Query: 187 SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKRE 246
           S + S + A +++D  TG S+GYGF+ F N+ + Q ++ +MQ   LNGR IR++  SK +
Sbjct: 164 SRYSSTLNAKIVFDQVTGVSKGYGFVKFGNEAEQQRSLVEMQGVFLNGRAIRVSTTSKNK 223

Query: 247 N 247
           +
Sbjct: 224 S 224

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 43/91 (47%), Gaps = 4/91 (4%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKN 137
           +  +++G L   + EE L+ YFQ  G I  VK+   K       FV+Y+    A+ A   
Sbjct: 285 NTTVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVGK----GCGFVQYVDRSSAENAIAK 340

Query: 138 LNGKTIETKVLKINWAFQSQQTTSDESLFNL 168
           + G  I    ++++W   ++Q    + +F +
Sbjct: 341 MQGFPIGNSRIRLSWGRSAKQAAGMQQVFAM 371

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    TE +L    Q FG I+  K    KG  F++Y     A   I  +  +P
Sbjct: 286 TTVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAKMQGFP 345

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 346 IGNSRIRLSWGRS 358

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 6/81 (7%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+G L+  V +E L   F  F   V   +         +G GF+ + ++  A+ A+ KM
Sbjct: 288 VFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVG------KGCGFVQYVDRSSAENAIAKM 341

Query: 228 QSTELNGRQIRINWASKRENA 248
           Q   +   +IR++W    + A
Sbjct: 342 QGFPIGNSRIRLSWGRSAKQA 362

>TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {ON}
           Anc_8.229 YER165W
          Length = 579

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 98/191 (51%), Gaps = 8/191 (4%)

Query: 55  GTAAEDDSDVVPA----NAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKV 110
           G  A  +++  PA     A N   +T+   LYVG LD S++E  L   F   GP+++++V
Sbjct: 22  GAPAASETEGTPAASETEANNSNVDTTSASLYVGELDPSVSEALLYDIFSPIGPVTSIRV 81

Query: 111 INDK--NNSVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNL 168
             D     S+ YA+V +  H     A + LN   I+ K  +I W+ Q       +   N+
Sbjct: 82  CRDAITKTSLGYAYVNFNDHESGRTAIEKLNYSPIKGKPCRIMWS-QRDPALRKKGAGNI 140

Query: 169 FVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQ 228
           F+ +L+ D+D++ L   FS F + +   +  D +TG+S+G+GF+ F     A  A+D + 
Sbjct: 141 FIKNLHPDIDNKALHDTFSVFGNILSCKIATD-ETGKSKGFGFVHFEEDNAAVEAVDAIN 199

Query: 229 STELNGRQIRI 239
              LNGR++ +
Sbjct: 200 GMMLNGREVYV 210

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 84/182 (46%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFKNLN 139
           +YV N+D    E+     F   GPI+++ +  D       + F+ +  H DA  A + LN
Sbjct: 233 VYVKNVDVDTPEDEFTALFSKYGPITSIAMEKDSEGKFRGFGFINFENHDDAAKAVEELN 292

Query: 140 GKTIETKVLKINWAFQSQQTTSD----------ESL-----FNLFVGDLNVDVDDETLGH 184
               + + L +  A +  +   +          E L      NLFV +L+  +DDE L  
Sbjct: 293 DLEFKGQKLYVGRAQKKYERLQELKKQYEASRLEKLAKYQGVNLFVKNLDDSIDDEKLEA 352

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ F S   A VM + + G+S+ +GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 353 EFAPFGSITSAKVMRN-EEGKSKNFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 411

Query: 245 RE 246
           ++
Sbjct: 412 KD 413

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 83/171 (48%), Gaps = 7/171 (4%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK-NNSVNYAFVEYLQHHDADVAFKNLN 139
           +++ NL   I+ + L   F + G I + K+  D+   S  + FV + + + A  A   +N
Sbjct: 140 IFIKNLHPDIDNKALHDTFSVFGNILSCKIATDETGKSKGFGFVHFEEDNAAVEAVDAIN 199

Query: 140 GKTIETKVLKINWAFQSQQTTSD-----ESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQ 194
           G  +  + + +      +   S       +  N++V +++VD  ++     FS++     
Sbjct: 200 GMMLNGREVYVAQHVSKKDRESKLEEVKANFTNVYVKNVDVDTPEDEFTALFSKYGPITS 259

Query: 195 AHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
             +  D + G+ RG+GFI+F N +DA  A++++   E  G+++ +  A K+
Sbjct: 260 IAMEKDSE-GKFRGFGFINFENHDDAAKAVEELNDLEFKGQKLYVGRAQKK 309

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 44/83 (53%)

Query: 162 DESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQ 221
           D +  +L+VG+L+  V +  L   FS         V  D  T  S GY +++F++ E  +
Sbjct: 46  DTTSASLYVGELDPSVSEALLYDIFSPIGPVTSIRVCRDAITKTSLGYAYVNFNDHESGR 105

Query: 222 TAMDKMQSTELNGRQIRINWASK 244
           TA++K+  + + G+  RI W+ +
Sbjct: 106 TAIEKLNYSPIKGKPCRIMWSQR 128

>CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165w PAB1 mRNA polyadenylate-binding protein
          Length = 579

 Score = 97.1 bits (240), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 97/175 (55%), Gaps = 5/175 (2%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDAD 132
           ET    LYVG+LD S++E  L   F   G +S+++V  D     S+ YA+V +  H  A 
Sbjct: 31  ETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAK 90

Query: 133 VAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
            A + LN   I+ K+ +I W+ Q   +   +   N+F+ +L+ D+D++ L   FS F + 
Sbjct: 91  TAIEKLNFTPIKGKLCRIMWS-QRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNI 149

Query: 193 VQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRIN-WASKRE 246
           + + V  D +TG+S+G+G++ F   E A  A+D +    LNG++I +    SK+E
Sbjct: 150 LSSKVATD-ETGKSKGFGYVHFEEDESASEAIDALNGMLLNGQEIYVGPHLSKKE 203

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 82/171 (47%), Gaps = 7/171 (4%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK-NNSVNYAFVEYLQHHDADVAFKNLN 139
           +++ NL   I+ + L   F + G I + KV  D+   S  + +V + +   A  A   LN
Sbjct: 125 IFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESASEAIDALN 184

Query: 140 GKTIETKVLKINWAFQSQQTTSD-----ESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQ 194
           G  +  + + +      ++  S       +  N+++ ++N +  D+      ++F     
Sbjct: 185 GMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGK-TD 243

Query: 195 AHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           + V+     G ++G+GF++F N EDA   ++++ +TE  G+ + +N A K+
Sbjct: 244 SVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKK 294

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 84/179 (46%), Gaps = 21/179 (11%)

Query: 88  KSINEETLKQYFQ-----IGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNGKT 142
           K+IN ET  + F+      G   S V     +  +  + FV ++ H DA    + LN   
Sbjct: 221 KNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTE 280

Query: 143 IETKVLKINWA---FQSQQ-------TTSDESL-----FNLFVGDLNVDVDDETLGHAFS 187
            + + L +N A   ++ QQ        T  E +      NLF+ +L+  +DD+ L   F+
Sbjct: 281 FKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFA 340

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKRE 246
            + +   A VM   + G+S+G+GF+ FS  E+A  A+ +     + G+ + +  A +++
Sbjct: 341 PYGTITSAKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKD 398

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 52/100 (52%), Gaps = 6/100 (6%)

Query: 151 NWAFQSQQTTSDES------LFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTG 204
           N + Q +Q  ++E         +L+VGDL+  V +  L   FS   +     V  D  T 
Sbjct: 14  NLSLQDKQEGTNEENQSETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITK 73

Query: 205 RSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            S GY +++F++ + A+TA++K+  T + G+  RI W+ +
Sbjct: 74  TSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQR 113

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFI--LDFKYYPE---KGNCFIKYDTHEQAAVCIVV 379
           T VYI NI    T+ +   L+  FG    +  +  PE   KG  F+ +  HE A  C+  
Sbjct: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275

Query: 380 LANYPFQGRNLKTGWGKEK 398
           L N  F+G+ L     ++K
Sbjct: 276 LNNTEFKGQPLYVNRAQKK 294

>TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.229
           YER165W
          Length = 577

 Score = 96.7 bits (239), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 91/161 (56%), Gaps = 4/161 (2%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           LYVG LD S++E  L   F   G +S+++V  D     S+ YA+V +  H     A + L
Sbjct: 45  LYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKTAIEKL 104

Query: 139 NGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVM 198
           N   I+ +  +I W+ Q   +   +   N+F+ +L+ D+D++TL   FS F + +   + 
Sbjct: 105 NYTAIKGRPCRIMWS-QRDPSMRKKGSGNIFIKNLHPDIDNKTLYETFSVFGNILSCKIA 163

Query: 199 WDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
            D +TG+S+G+GF+ F N+E A+ A+D +    LNG+++ +
Sbjct: 164 ND-ETGKSKGFGFVHFENEEAAREAIDAINGMLLNGQEVYV 203

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 91/182 (50%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND-KNNSVNYAFVEYLQHHDADVAFKNLN 139
           +YV NLD    EE  +  F+  G I++V +  D +  S  + FV++  H DA  A + LN
Sbjct: 226 VYVKNLDLEATEEDFENLFKPYGTITSVALEKDAEGKSRGFGFVDFENHEDAVKAVEALN 285

Query: 140 -----GKTI-----ETKVLKINWAFQSQQTTSDESL-----FNLFVGDLNVDVDDETLGH 184
                G+T+     + K  ++    +  Q +  E L      NLF+ +L+  +DDE L  
Sbjct: 286 DTEYKGQTLYVGRAQKKYERLQELKKQYQASKLEKLAKYQGINLFIKNLDDSIDDEKLKE 345

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ F +   A VM   + G+S+G+GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 346 EFAPFGTITSARVMR-TENGKSKGFGFVCFSTPEEATRAITEKNQQIVAGKPLYVAIAQR 404

Query: 245 RE 246
           ++
Sbjct: 405 KD 406

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 91/178 (51%), Gaps = 7/178 (3%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK-NNSVNYAFVEYLQHHDAD 132
           R+     +++ NL   I+ +TL + F + G I + K+ ND+   S  + FV +     A 
Sbjct: 126 RKKGSGNIFIKNLHPDIDNKTLYETFSVFGNILSCKIANDETGKSKGFGFVHFENEEAAR 185

Query: 133 VAFKNLNGKTIETKVLKI--NWAFQSQQTTSDES---LFNLFVGDLNVDVDDETLGHAFS 187
            A   +NG  +  + + +  + + + +Q+  DE+     N++V +L+++  +E   + F 
Sbjct: 186 EAIDAINGMLLNGQEVYVAPHVSKKDRQSKLDEARANFTNVYVKNLDLEATEEDFENLFK 245

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
            + +     +  D + G+SRG+GF+ F N EDA  A++ +  TE  G+ + +  A K+
Sbjct: 246 PYGTITSVALEKDAE-GKSRGFGFVDFENHEDAVKAVEALNDTEYKGQTLYVGRAQKK 302

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%)

Query: 167 NLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDK 226
           +L+VG+L+  V +  L   FS   S     V  D  T  S GY +++F++ E  +TA++K
Sbjct: 44  SLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKTAIEK 103

Query: 227 MQSTELNGRQIRINWASK 244
           +  T + GR  RI W+ +
Sbjct: 104 LNYTAIKGRPCRIMWSQR 121

 Score = 33.9 bits (76), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPE-----KGNCFIKYDTHEQAAVCIVV 379
           T VY+ N+   ATE D   L + +G I       +     +G  F+ ++ HE A   +  
Sbjct: 224 TNVYVKNLDLEATEEDFENLFKPYGTITSVALEKDAEGKSRGFGFVDFENHEDAVKAVEA 283

Query: 380 LANYPFQGRNLKTGWGKEK 398
           L +  ++G+ L  G  ++K
Sbjct: 284 LNDTEYKGQTLYVGRAQKK 302

>ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR086W (NAM8)
          Length = 566

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 100/182 (54%), Gaps = 11/182 (6%)

Query: 73  GRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNS----VNYAFVEYLQH 128
           G +TS   LY+G+LD S  E  +KQ +   G  +NV+V   KN+S      Y FVE+  +
Sbjct: 46  GADTSSTQLYMGDLDPSWTEGDIKQIWATLGE-ANVQVKLIKNSSGGGNSGYCFVEFPSN 104

Query: 129 HDADVAF--KNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAF 186
             A  A     L      ++ LK+NWA      T+  S F++FVGDL  +V +  L   F
Sbjct: 105 LAATNALLKTGLPIPVDASRTLKLNWA---SFATTPGSEFSIFVGDLAPNVTESQLFELF 161

Query: 187 -SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
            S + S + A +++D  TG S+GYGF+ F N+ + Q ++ +MQ   LNGR IR++  SK 
Sbjct: 162 ISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKN 221

Query: 246 EN 247
           ++
Sbjct: 222 KS 223

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    TE +L    Q FG I+  K    KG  F++Y     A   I  +  +P
Sbjct: 282 TTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAKMQGFP 341

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 342 IGNSRVRLSWGRS 354

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 4/84 (4%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKN 137
           +  +++G L   + E+ L+ YFQ  G I  VK+   K       FV+Y+    A+ A   
Sbjct: 281 NTTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGK----GCGFVQYVDRSSAENAIAK 336

Query: 138 LNGKTIETKVLKINWAFQSQQTTS 161
           + G  I    ++++W   ++QT +
Sbjct: 337 MQGFPIGNSRVRLSWGRSAKQTAA 360

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+G L+  V ++ L   F  F   V   +         +G GF+ + ++  A+ A+ KM
Sbjct: 284 VFIGGLSSLVTEDELRAYFQPFGQIVYVKIP------VGKGCGFVQYVDRSSAENAIAKM 337

Query: 228 QSTELNGRQIRINWA 242
           Q   +   ++R++W 
Sbjct: 338 QGFPIGNSRVRLSWG 352

>TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {ON}
           Anc_5.382 YHR086W
          Length = 472

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 96/181 (53%), Gaps = 13/181 (7%)

Query: 73  GRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKV---INDKNNSV----NYAFVEY 125
           G ++ +  LY+G+LD S +E  ++  +   G  SNV++    N++N  V     Y FV++
Sbjct: 42  GSQSRNNQLYMGDLDPSWDENVIRSIWNSLGE-SNVEIKLMWNNRNAGVRTHLGYCFVQF 100

Query: 126 LQHHDADVAFKNLNGKTIE---TKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETL 182
                A  A    NG  I    +K L++NW+  S  +    +  ++FVGDL  +V +  L
Sbjct: 101 SSRSQASNALLK-NGMAIPGYPSKTLRLNWSSASGNSADGSNEISVFVGDLAPNVTESDL 159

Query: 183 GHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINW 241
              F S+ PS   A VM+D  TG S+GY F+ F NQED Q A+ +M  T L GR IR+  
Sbjct: 160 FELFISKCPSTSNAKVMYDQVTGVSKGYAFVRFGNQEDQQRALQEMTGTFLKGRAIRVGS 219

Query: 242 A 242
           A
Sbjct: 220 A 220

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNC-FIKYDTHEQAAVCIVVLANY 383
           TT+++ ++ H  TE +L    Q FG ++ +   PE   C F++Y     A + I+ L  +
Sbjct: 279 TTLFVSSLSHMVTENELKAFFQPFGNVI-YAKLPENKQCGFVQYVDRASAEMAILKLQGF 337

Query: 384 PFQGRNLKTGWGK 396
           P +G  +K  WG+
Sbjct: 338 PIRGSRIKISWGR 350

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 87/225 (38%), Gaps = 58/225 (25%)

Query: 67  ANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGP-ISNVKVINDKNNSVN--YAFV 123
            N+ +G  E S   ++VG+L  ++ E  L + F    P  SN KV+ D+   V+  YAFV
Sbjct: 134 GNSADGSNEIS---VFVGDLAPNVTESDLFELFISKCPSTSNAKVMYDQVTGVSKGYAFV 190

Query: 124 EYLQHHDADVAF-----------------------KNLNGKTIETKVLKINWAFQSQQTT 160
            +    D   A                        +N NG  +E K+  +N    S +  
Sbjct: 191 RFGNQEDQQRALQEMTGTFLKGRAIRVGSAGHQNQRNRNGPGLENKLKGLNATVSSPKPA 250

Query: 161 -----------------------SDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHV 197
                                  +D +   LFV  L+  V +  L   F  F + + A +
Sbjct: 251 NISSTNFSQFILPTQQLPPLNSFTDRNNTTLFVSSLSHMVTENELKAFFQPFGNVIYAKL 310

Query: 198 MWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWA 242
             + Q G      F+ + ++  A+ A+ K+Q   + G +I+I+W 
Sbjct: 311 PENKQCG------FVQYVDRASAEMAILKLQGFPIRGSRIKISWG 349

>Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar to
           Ashbya gossypii AGR122C
          Length = 580

 Score = 93.6 bits (231), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 91/169 (53%), Gaps = 4/169 (2%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDAD 132
           ETS   LYVG LD S++E  L   F   G +S+++V  D   N S+ YA+V +  H    
Sbjct: 34  ETSGASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGR 93

Query: 133 VAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
            A + LN   I+ K  +I W+ Q   +   +   N+++ +L+  +D+++L   FS F + 
Sbjct: 94  KAIEQLNYTLIKGKPCRIMWS-QRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNI 152

Query: 193 VQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINW 241
           +   V  D   G SRG+GF+ F N+ DA+ A++ +    +N +++ + W
Sbjct: 153 LSCKVATD-DNGVSRGFGFVHFENESDARDAIEAVNGMLMNDQEVYVAW 200

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 86/178 (48%), Gaps = 7/178 (3%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN-SVNYAFVEYLQHHDAD 132
           R+     +Y+ NL  +I+ ++L + F   G I + KV  D N  S  + FV +    DA 
Sbjct: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDDNGVSRGFGFVHFENESDAR 180

Query: 133 VAFKNLNGKTIETKVLKINWAF-----QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFS 187
            A + +NG  +  + + + W       QS+         N++V +++++   E     FS
Sbjct: 181 DAIEAVNGMLMNDQEVYVAWHVSKKDRQSKLEEVKAKFTNIYVKNIDLETSQEEFEQLFS 240

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           ++     A +  D + G+ RG+GFI+F +   A  A+D++  ++  G+ + +  A K+
Sbjct: 241 KYGKITSAVLEKDSE-GKLRGFGFINFEDHSTAARAVDELNESDFRGQTLYVGRAQKK 297

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 82/182 (45%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFKNLN 139
           +YV N+D   ++E  +Q F   G I++  +  D    +  + F+ +  H  A  A   LN
Sbjct: 221 IYVKNIDLETSQEEFEQLFSKYGKITSAVLEKDSEGKLRGFGFINFEDHSTAARAVDELN 280

Query: 140 GKTIETKVLKINWAFQSQQ----------TTSDESL-----FNLFVGDLNVDVDDETLGH 184
                 + L +  A +  +          T   E L      NLF+ +L+  +DDE L  
Sbjct: 281 ESDFRGQTLYVGRAQKKHERQQELKKQYETARLEKLAKYQGVNLFIKNLDDSIDDEKLKD 340

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ F +     VM D + G SRG+GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 341 EFAPFGTITSVKVMKD-EAGSSRGFGFVCFSTPEEATKAITEKNQQLVAGKPLYVAIAQR 399

Query: 245 RE 246
           +E
Sbjct: 400 KE 401

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 46/90 (51%)

Query: 155 QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISF 214
           +S+    + S  +L+VG+L+  V +  L   FS   S     V  D  T  S GY +++F
Sbjct: 27  ESETPKVETSGASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNF 86

Query: 215 SNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            + E  + A++++  T + G+  RI W+ +
Sbjct: 87  HDHEAGRKAIEQLNYTLIKGKPCRIMWSQR 116

>KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.229
           YER165W
          Length = 596

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 92/170 (54%), Gaps = 4/170 (2%)

Query: 72  GGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHH 129
           G  + +   LYVG LD S++E  L   F   G +++++V  D     S+ YA+V +  H 
Sbjct: 40  GDNDVTSTSLYVGELDPSVSEALLYDLFSPIGSVASIRVCRDAITKTSLGYAYVNFSDHE 99

Query: 130 DADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEF 189
               A + LN   I+ K+ +I W+ Q   +   +   N+F+ +LN D+D++ L   FS F
Sbjct: 100 AGKQAIEKLNYTPIKGKLCRIMWS-QRDPSLRKKGHGNIFIKNLNQDIDNKALFDTFSVF 158

Query: 190 PSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
            + + + +  D +TG+S+G+GF+ F  +  A  A+D +    LNG++I +
Sbjct: 159 GNILSSKIATD-ETGKSKGFGFVHFEEESAANEAIDALNGMLLNGQEIYV 207

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 90/182 (49%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFKNLN 139
           +YV N+D    +E  K++F   G +++V +    +  +  + FV Y  H+DA  A + LN
Sbjct: 230 VYVKNIDLETTDEEFKEFFGKIGTVTSVALERGPDGKLKGFGFVNYEDHNDAVKAVEELN 289

Query: 140 GKTIETKVL----------KINWAFQSQQTTSDESL-----FNLFVGDLNVDVDDETLGH 184
           G   + + L          +I    +  ++T  E +      NLFV +L+  +DDE L  
Sbjct: 290 GAEFKDQELFVGRAQKKYERIQSLKKQYESTRLEKMAKYQGVNLFVKNLDDSIDDEKLQE 349

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ F +     VM   + G+S+G+GF+ FS+ E+A  A+ +     + G+ + +  A +
Sbjct: 350 EFAPFGNITSVKVMR-TENGKSKGFGFVCFSSPEEATKAITEKNQQIVAGKPLYVAIAQR 408

Query: 245 RE 246
           ++
Sbjct: 409 KD 410

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 49/91 (53%), Gaps = 1/91 (1%)

Query: 155 QSQQTT-SDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFIS 213
           +SQQ   +D +  +L+VG+L+  V +  L   FS   S     V  D  T  S GY +++
Sbjct: 35  ESQQAGDNDVTSTSLYVGELDPSVSEALLYDLFSPIGSVASIRVCRDAITKTSLGYAYVN 94

Query: 214 FSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
           FS+ E  + A++K+  T + G+  RI W+ +
Sbjct: 95  FSDHEAGKQAIEKLNYTPIKGKLCRIMWSQR 125

>NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 91/165 (55%), Gaps = 4/165 (2%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDAD 132
           E S   LYVG+LD S++E  L   F   G +S+++V  D     S+ YA+V +  H    
Sbjct: 36  ENSSASLYVGDLDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGK 95

Query: 133 VAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
            A + LN   I+ ++ +I W+ Q       +   N+F+ +L+ D+D++ L   FS F + 
Sbjct: 96  KAIEKLNYTPIKGRLCRIMWS-QRDPALRKKGSANIFIKNLHSDIDNKALYDTFSVFGNI 154

Query: 193 VQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
           + + +  D +TG+S+G+GF+ F +   A+ A+D +    LNG++I
Sbjct: 155 LSSKIATD-ETGKSKGFGFVHFEDDTAAKEAIDALNGMLLNGQEI 198

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 85/178 (47%), Gaps = 7/178 (3%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK-NNSVNYAFVEYLQHHDAD 132
           R+     +++ NL   I+ + L   F + G I + K+  D+   S  + FV +     A 
Sbjct: 123 RKKGSANIFIKNLHSDIDNKALYDTFSVFGNILSSKIATDETGKSKGFGFVHFEDDTAAK 182

Query: 133 VAFKNLNGKTIETKVLKINWAFQ-----SQQTTSDESLFNLFVGDLNVDVDDETLGHAFS 187
            A   LNG  +  + + +          SQ   S  +  N++V ++N++  DE     FS
Sbjct: 183 EAIDALNGMLLNGQEIFVGPHLSRKERDSQLEESKANFTNIYVKNINLETTDEEFTELFS 242

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           ++   + A  +   + G+ +G+GF+ F N EDA  A++++  ++   +++ ++ A K+
Sbjct: 243 KYGKVLSA-ALEKTEDGKLKGFGFVDFENHEDAAKAVEELNGSQFKDQELFVSRAQKK 299

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 85/182 (46%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFKNLN 139
           +YV N++    +E   + F   G + +  +   ++  +  + FV++  H DA  A + LN
Sbjct: 223 IYVKNINLETTDEEFTELFSKYGKVLSAALEKTEDGKLKGFGFVDFENHEDAAKAVEELN 282

Query: 140 GKTIETKVLKINWA------FQSQQTTSDESLF---------NLFVGDLNVDVDDETLGH 184
           G   + + L ++ A       Q  +   + S           NLF+ +L+  +DDE L  
Sbjct: 283 GSQFKDQELFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFIKNLDDSIDDEKLKE 342

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ + +     VM   + G+SRG+GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 343 EFAPYGNITSVRVMR-TENGKSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 245 RE 246
           ++
Sbjct: 402 KD 403

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 55/105 (52%), Gaps = 9/105 (8%)

Query: 148 LKINWAFQSQQT--------TSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMW 199
           LKI+ + Q QQT        T++ S  +L+VGDL+  V +  L   FS   S     V  
Sbjct: 15  LKIDDS-QEQQTATSTPSSATTENSSASLYVGDLDPSVSEALLYDIFSPIGSVSSIRVCR 73

Query: 200 DMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
           D  T  S GY +++F++ E  + A++K+  T + GR  RI W+ +
Sbjct: 74  DAITKTSLGYAYVNFNDHEAGKKAIEKLNYTPIKGRLCRIMWSQR 118

>TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {ON}
           Anc_8.229 YER165W
          Length = 588

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 89/167 (53%), Gaps = 4/167 (2%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDAD 132
           ETS   LYVG LD S++E  L   F   G +S+++V  D     S+ YA+V +  H    
Sbjct: 38  ETSSASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGK 97

Query: 133 VAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
            A + LN   I+    +I W+ Q   +   +   N+F+ +L+ D+D++ L   FS F + 
Sbjct: 98  TAIEKLNYAPIKGVPCRIMWS-QRDPSMRKKGSGNIFIKNLHPDIDNKALHDTFSVFGNI 156

Query: 193 VQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           +   +  D + G SRG+GF+ F + E A+ A+D +    LNG+++ +
Sbjct: 157 LSCKIATD-EAGNSRGFGFVHFEDDEAAKEAIDAINGMLLNGQEVYV 202

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 86/182 (47%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFKNLN 139
           +YV N+     +E  +++F   GPI++  +  D    +  + FV Y  H+DA  A + LN
Sbjct: 225 VYVKNIHPDTGDEEFEEFFTKVGPITSAHLEKDNEGKLRGFGFVNYENHNDAAKAVEELN 284

Query: 140 GKTIETKVLKINWAFQSQQTTSD----------ESL-----FNLFVGDLNVDVDDETLGH 184
               + + L +  A +  +   +          E L      NLFV +L+  +DD+ L  
Sbjct: 285 ETDFKGQTLHVGRAQKKHERLQELKKQYEAFRLEKLEKYQGVNLFVKNLDDTIDDQKLEE 344

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ + +     VM   + G+S+G+GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 345 EFAPYGTITSVKVMRS-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 403

Query: 245 RE 246
           ++
Sbjct: 404 KD 405

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 89/178 (50%), Gaps = 7/178 (3%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK-NNSVNYAFVEYLQHHDAD 132
           R+     +++ NL   I+ + L   F + G I + K+  D+  NS  + FV +     A 
Sbjct: 125 RKKGSGNIFIKNLHPDIDNKALHDTFSVFGNILSCKIATDEAGNSRGFGFVHFEDDEAAK 184

Query: 133 VAFKNLNGKTIETKVLKI--NWAFQSQQTTSDES---LFNLFVGDLNVDVDDETLGHAFS 187
            A   +NG  +  + + +  + + + +Q+  DE+     N++V +++ D  DE     F+
Sbjct: 185 EAIDAINGMLLNGQEVYVAQHVSKKDRQSKLDEAKANFTNVYVKNIHPDTGDEEFEEFFT 244

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           +      AH+  D + G+ RG+GF+++ N  DA  A++++  T+  G+ + +  A K+
Sbjct: 245 KVGPITSAHLEKDNE-GKLRGFGFVNYENHNDAAKAVEELNETDFKGQTLHVGRAQKK 301

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%)

Query: 167 NLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDK 226
           +L+VG+L+  V +  L   FS   S     V  D  T  S GY +++F++ E  +TA++K
Sbjct: 43  SLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKTAIEK 102

Query: 227 MQSTELNGRQIRINWASK 244
           +    + G   RI W+ +
Sbjct: 103 LNYAPIKGVPCRIMWSQR 120

>NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {ON}
           Anc_8.229
          Length = 575

 Score = 91.3 bits (225), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 90/161 (55%), Gaps = 4/161 (2%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           LYVG LD +++E  L   F   G +S+++V  D     S+ YA+V +  H     A + L
Sbjct: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96

Query: 139 NGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVM 198
           N   I+ ++ +I W+ Q       +   N+F+ +L+ D+D++ L   FS F + + + + 
Sbjct: 97  NYTPIKGRLCRIMWS-QRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIA 155

Query: 199 WDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
            D +TG+S+G+GF+ F ++  A+ A+D +    LNG++I +
Sbjct: 156 TD-ETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 84/182 (46%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYF-QIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLN 139
           +YV N++    +E   + F + G  +S+     +      + FV++ +H DA  A + LN
Sbjct: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277

Query: 140 GKTIETKVLKINWA------FQSQQTTSDESLF---------NLFVGDLNVDVDDETLGH 184
           G   + + L ++ A       Q  +   + S           NLFV +L+  +DDE L  
Sbjct: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKE 337

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ + +     VM     G+S+G+GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 338 EFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

Query: 245 RE 246
           ++
Sbjct: 397 KD 398

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 84/178 (47%), Gaps = 7/178 (3%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK-NNSVNYAFVEYLQHHDAD 132
           R+     +++ NL   I+ + L + F + G I + K+  D+   S  + FV +     A 
Sbjct: 118 RKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAK 177

Query: 133 VAFKNLNGKTIETKVLKINWAF-----QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFS 187
            A   LNG  +  + + +          SQ   +     N++V ++N++  DE     F+
Sbjct: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFA 237

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           ++ + V +  +   + G+ +G+GF+ F   EDA  A++++  TE   + + ++ A K+
Sbjct: 238 KYGN-VLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKK 294

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%)

Query: 167 NLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDK 226
           +L+VG+L+  V +  L   FS   S     V  D  T  S GY +++F++ E  + A+++
Sbjct: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95

Query: 227 MQSTELNGRQIRINWASK 244
           +  T + GR  RI W+ +
Sbjct: 96  LNYTPIKGRLCRIMWSQR 113

>KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {ON}
           Anc_5.382 YHR086W
          Length = 397

 Score = 90.1 bits (222), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 102/186 (54%), Gaps = 18/186 (9%)

Query: 81  LYVGNLDKSINEETLKQ-YFQIGGPISNVKVINDKNNSVN---------YAFVEYLQHHD 130
           LY+G+L+ S +E  +K+ +  IG    +VK++   NN +          Y F+++  H +
Sbjct: 56  LYMGDLEPSWDENVIKRIWSSIGEDNISVKMMWQNNNYMGNESGPRNQGYCFIDFPTHFN 115

Query: 131 ADVAF-KN-LNGKTIETKVLKINWAFQSQQTTSDESL-----FNLFVGDLNVDVDDETLG 183
           A  A  KN ++      K LK+NWA  S  +T+  S      F++FVGDL  +V +  L 
Sbjct: 116 ASNALLKNKMSIPGHPHKKLKLNWASSSAPSTAGVSTTGGNNFSIFVGDLAPNVTEAQLF 175

Query: 184 HAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWA 242
             F S +PS   A V+ D+ TG S+GYGFI F +  D QTA+ +MQ   LNGR +++  +
Sbjct: 176 DLFISRYPSTEHAKVVIDLSTGVSKGYGFIRFRDPADQQTALAEMQGVFLNGRALKVGMS 235

Query: 243 SKRENA 248
           S + N+
Sbjct: 236 SGQSNS 241

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 4/90 (4%)

Query: 69  AINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQH 128
           A+N   + ++  +++G L   + EE L+QYFQ  G I  VK+   K       FV+Y+  
Sbjct: 284 ALNHFTDPNNTTVFIGGLSPLVKEEELRQYFQPFGEIVYVKIPVGK----GCGFVQYIDR 339

Query: 129 HDADVAFKNLNGKTIETKVLKINWAFQSQQ 158
             A+ A   + G  I    ++++W   ++Q
Sbjct: 340 ISAETAISQMQGFPISNSRVRLSWGRSAKQ 369

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +     E +L    Q FG I+  K    KG  F++Y     A   I  +  +P
Sbjct: 294 TTVFIGGLSPLVKEEELRQYFQPFGEIVYVKIPVGKGCGFVQYIDRISAETAISQMQGFP 353

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 354 ISNSRVRLSWGRS 366

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 43/211 (20%), Positives = 82/211 (38%), Gaps = 55/211 (26%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPIS-NVKVINDKNNSVN--YAFVEYLQHHDADVAFKN 137
           ++VG+L  ++ E  L   F    P + + KV+ D +  V+  Y F+ +    D   A   
Sbjct: 160 IFVGDLAPNVTEAQLFDLFISRYPSTEHAKVVIDLSTGVSKGYGFIRFRDPADQQTALAE 219

Query: 138 LNGKTIETKVLKINW--------AFQSQQT----------------TSDESLFN------ 167
           + G  +  + LK+          A  S+Q                 T + +LF+      
Sbjct: 220 MQGVFLNGRALKVGMSSGQSNSGAGGSRQVGHDRYGGSKPAGGKSNTPNSALFSQFMYPI 279

Query: 168 ----------------LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGF 211
                           +F+G L+  V +E L   F  F   V   +         +G GF
Sbjct: 280 QQQPALNHFTDPNNTTVFIGGLSPLVKEEELRQYFQPFGEIVYVKIP------VGKGCGF 333

Query: 212 ISFSNQEDAQTAMDKMQSTELNGRQIRINWA 242
           + + ++  A+TA+ +MQ   ++  ++R++W 
Sbjct: 334 VQYIDRISAETAISQMQGFPISNSRVRLSWG 364

>ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 90.9 bits (224), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 90/167 (53%), Gaps = 3/167 (1%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDAD 132
           ETS   LYVG LD +++E  L   F   G +S+++V  D     S+ YA+V +  +    
Sbjct: 36  ETSTASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDYEAGR 95

Query: 133 VAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
            A + LN   I+ +  +I W+ Q   +   +   N+F+ +L+ D+D++ L   FS F + 
Sbjct: 96  QAIEKLNYTPIKGQPCRIMWS-QRDPSLRKKGSGNIFIKNLHADIDNKALHDTFSVFGNI 154

Query: 193 VQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           +   +  D  TG S+G+GF+ F + E A+ A+D +    LNG+++ +
Sbjct: 155 LSCKIATDEVTGNSKGFGFVHFESDEAAREAIDAINGMLLNGQEVYV 201

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 85/182 (46%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFKNLN 139
           +Y+ N+     E+  +++F+   P+++V +  D    +  + FV Y  H  A  A + LN
Sbjct: 224 VYIKNISLETPEQEFEEFFKKVAPVTSVHLEKDSEGKLRGFGFVNYETHAGAAKAVEELN 283

Query: 140 GKTIETKVLKINWA---FQSQQTTSDE------------SLFNLFVGDLNVDVDDETLGH 184
           G     + L +  A   ++ QQ    +               NLF+ +L+  +DDE L  
Sbjct: 284 GVEFHGQQLHVGRAQKKYERQQELRRQYEQSKLEKMEKYQGVNLFIKNLDDSIDDERLRE 343

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            FS F +     VM   + G+S+G+GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 344 EFSPFGTITSVKVMT-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 402

Query: 245 RE 246
           ++
Sbjct: 403 KD 404

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 87/179 (48%), Gaps = 8/179 (4%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDA 131
           R+     +++ NL   I+ + L   F + G I + K+  D+   NS  + FV +     A
Sbjct: 123 RKKGSGNIFIKNLHADIDNKALHDTFSVFGNILSCKIATDEVTGNSKGFGFVHFESDEAA 182

Query: 132 DVAFKNLNGKTIETKVLKI--NWAFQSQQTTSDES---LFNLFVGDLNVDVDDETLGHAF 186
             A   +NG  +  + + +  + + + +Q+  +E+     N+++ +++++  ++     F
Sbjct: 183 REAIDAINGMLLNGQEVYVAPHVSRKDRQSKLEEAKANFTNVYIKNISLETPEQEFEEFF 242

Query: 187 SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
            +       H+  D + G+ RG+GF+++     A  A++++   E +G+Q+ +  A K+
Sbjct: 243 KKVAPVTSVHLEKDSE-GKLRGFGFVNYETHAGAAKAVEELNGVEFHGQQLHVGRAQKK 300

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 52/104 (50%), Gaps = 7/104 (6%)

Query: 148 LKINWAFQSQQTTSDE-------SLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWD 200
           L +  A Q+  T++D        S  +L+VG+L+  V +  L   FS   S     V  D
Sbjct: 15  LNLQEAPQTAPTSTDSDSQKVETSTASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRD 74

Query: 201 MQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
             T  S GY +++F++ E  + A++K+  T + G+  RI W+ +
Sbjct: 75  AITKTSLGYAYVNFNDYEAGRQAIEKLNYTPIKGQPCRIMWSQR 118

>Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 96/183 (52%), Gaps = 4/183 (2%)

Query: 59  EDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NN 116
           +DD     A +     E S   LYVG+L+ S++E  L   F   G +S+++V  D     
Sbjct: 18  QDDQKQATAGSEGQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKT 77

Query: 117 SVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVD 176
           S+ YA+V +  H     A + LN   I+ ++ +I W+ Q   +   +   N+F+ +L+ D
Sbjct: 78  SLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPD 136

Query: 177 VDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQ 236
           +D++ L   FS F   + + +  D + G+S+G+GF+ F  +  A+ A+D +    LNG++
Sbjct: 137 IDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQE 195

Query: 237 IRI 239
           I +
Sbjct: 196 IYV 198

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 86/178 (48%), Gaps = 7/178 (3%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDAD 132
           R+     +++ NL   I+ + L   F + G I + K+  D+N  S  + FV + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 133 VAFKNLNGKTIETKVLKINWAFQ-----SQQTTSDESLFNLFVGDLNVDVDDETLGHAFS 187
            A   LNG  +  + + +          SQ   +     NL+V ++N +  DE     F+
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHFTNLYVKNINSETTDEQFQELFA 240

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           +F   V A +  D   G+ +G+GF+++ N EDA  A++ +  +ELNG ++ +  A K+
Sbjct: 241 QFGPIVSASLEKDA-DGKLKGFGFVNYENHEDAVKAVETLNDSELNGEKLYVGRAQKK 297

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 83/182 (45%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFKNLN 139
           LYV N++    +E  ++ F   GPI +  +  D +  +  + FV Y  H DA  A + LN
Sbjct: 221 LYVKNINSETTDEQFQELFAQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVETLN 280

Query: 140 ---------------GKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGH 184
                           K     VLK  +     +  +     NLFV +L+  VDDE L  
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ + +   A VM   + G+S+G+GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 245 RE 246
           ++
Sbjct: 400 KD 401

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 46/89 (51%)

Query: 156 SQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFS 215
           S+  + + S  +L+VGDL   V +  L   FS   S     V  D  T  S GY +++F+
Sbjct: 28  SEGQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFN 87

Query: 216 NQEDAQTAMDKMQSTELNGRQIRINWASK 244
           + E  + A++++  T + GR  RI W+ +
Sbjct: 88  DHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 5/90 (5%)

Query: 314 DDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPE-----KGNCFIKYD 368
           D  +       T +Y+ NI    T+     L   FG I+      +     KG  F+ Y+
Sbjct: 208 DSQLEETKAHFTNLYVKNINSETTDEQFQELFAQFGPIVSASLEKDADGKLKGFGFVNYE 267

Query: 369 THEQAAVCIVVLANYPFQGRNLKTGWGKEK 398
            HE A   +  L +    G  L  G  ++K
Sbjct: 268 NHEDAVKAVETLNDSELNGEKLYVGRAQKK 297

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 94/184 (51%), Gaps = 6/184 (3%)

Query: 60  DDSDVVPAN--AINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--N 115
           DD    P +  + N   +TS   LYVG LD ++ E  L   F   G +S+++V  D    
Sbjct: 19  DDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITK 78

Query: 116 NSVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNV 175
            S+ YA+V +  H     A + LN  TI+ +  +I W+ Q   +   +   N+F+ +L+ 
Sbjct: 79  TSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWS-QRDPSLRKKGSGNIFIKNLHP 137

Query: 176 DVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGR 235
            +D++ L   FS F + +   +  D + G S+G+GF+ F  +  A+ A+D +    LNG+
Sbjct: 138 AIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQ 196

Query: 236 QIRI 239
           ++ +
Sbjct: 197 EVYV 200

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 88/178 (49%), Gaps = 7/178 (3%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK-NNSVNYAFVEYLQHHDAD 132
           R+     +++ NL  +I+ + L   F + G I + K+  D+  NS  + FV + + + A 
Sbjct: 123 RKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAK 182

Query: 133 VAFKNLNGKTIETKVLKINWAF-----QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFS 187
            A   +NG  +  + + +         QS+   +  +  N++V +++++   E     F+
Sbjct: 183 EAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFT 242

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           +F     A +  D + G+ RG+GFI+F + E A  A+D++  T+   +++ +  A K+
Sbjct: 243 QFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKK 299

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 81/182 (44%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYF-QIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLN 139
           +YV N+D    +E  +  F Q G   S V   + +     + F+ +  H  A  A   LN
Sbjct: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282

Query: 140 GKTIETKVLKINWAFQSQQTTSD----------ESL-----FNLFVGDLNVDVDDETLGH 184
               +++ L +  A +  +   +          E L      NLFV +L+  +DDE L  
Sbjct: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD 342

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ F +   A VM D   G S+G+GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 343 EFAPFGAITSAKVMRD-DAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 245 RE 246
           ++
Sbjct: 402 KD 403

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 52/104 (50%), Gaps = 7/104 (6%)

Query: 148 LKINWAFQSQQTTS-------DESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWD 200
           LKIN   Q+  T++       D S  +L+VG+L+  V +  L   FS   S     V  D
Sbjct: 15  LKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRD 74

Query: 201 MQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
             T  S GY +++F + +  +TA+ K+  T + GR  RI W+ +
Sbjct: 75  AITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQR 118

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 7/80 (8%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFIL------DFKYYPEKGNCFIKYDTHEQAAVCIV 378
           T +Y+ NI    T+ +   L   FG I       D +  P +G  FI ++ HE AA  + 
Sbjct: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKP-RGFGFINFEDHESAAKAVD 279

Query: 379 VLANYPFQGRNLKTGWGKEK 398
            L +  F+ + L  G  ++K
Sbjct: 280 ELNDTDFKSQRLYVGRAQKK 299

>KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some
           similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein
          Length = 589

 Score = 88.2 bits (217), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 89/177 (50%), Gaps = 14/177 (7%)

Query: 81  LYVGNLDKSINEETLKQ-YFQIGGPISNVKVINDKN-------NSVNYAFVEYLQHHDAD 132
           LY+G+L+    E  +K  +  +G P   VK+I   N       N+  Y FVE+     A 
Sbjct: 58  LYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQMAAS 117

Query: 133 VAF--KNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAF-SEF 189
            A     L         LK+NWA      T+  S F LFVGDL  +V +  L   F S +
Sbjct: 118 NALMKSGLRVPMDSNYALKLNWA---SFATAPGSEFTLFVGDLAPNVTEAQLFELFISRY 174

Query: 190 PSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKRE 246
            S + A +++D  TG S+GYGF+ F N+ + Q A+ +MQ T LNGR IR+   SK +
Sbjct: 175 SSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVGTTSKNK 231

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    TE +L    Q FG I+  K    KG  F++Y     A   I  +  +P
Sbjct: 316 TTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGKGCGFVQYVDRISAETAISKMQGFP 375

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 376 IGNSRIRLSWGRS 388

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKN 137
           +  +++G L   I E+ L+ YFQ  G I  VK+   K       FV+Y+    A+ A   
Sbjct: 315 NTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGK----GCGFVQYVDRISAETAISK 370

Query: 138 LNGKTIETKVLKINWA 153
           + G  I    ++++W 
Sbjct: 371 MQGFPIGNSRIRLSWG 386

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+G L+  + ++ L   F  F   V   +         +G GF+ + ++  A+TA+ KM
Sbjct: 318 VFIGGLSTLITEDELRSYFQPFGQIVYVKI------PVGKGCGFVQYVDRISAETAISKM 371

Query: 228 QSTELNGRQIRINWA 242
           Q   +   +IR++W 
Sbjct: 372 QGFPIGNSRIRLSWG 386

>AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER165W
           (PAB1)
          Length = 585

 Score = 87.8 bits (216), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 91/167 (54%), Gaps = 4/167 (2%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDAD 132
           ETS   LYVG L+ +++E  L   F   G +S+++V  D   N S+ YA+V +  H    
Sbjct: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93

Query: 133 VAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
            A + LN   I+ K  +I W+ Q   +   +   N+++ +L+  +D+++L   FS F + 
Sbjct: 94  KAIEQLNYTLIKGKPCRIMWS-QRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNI 152

Query: 193 VQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           +   V  D + G SRG+GF+ F N+ DA+ A++ +    +N +++ +
Sbjct: 153 LSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYV 198

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 86/182 (47%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFKNLN 139
           +YV N+D+  ++E  ++ F   G I++  +  D    +  + FV +  H  A  A   LN
Sbjct: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280

Query: 140 GKTIETKVLKINWAFQSQQTTSD----------ESL-----FNLFVGDLNVDVDDETLGH 184
               + + L +  A +  +   +          E L      NLFV +L+  +DDE L  
Sbjct: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE 340

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ F +   A VM D +TG SRG+GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 341 EFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 245 RE 246
           +E
Sbjct: 400 KE 401

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%)

Query: 155 QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISF 214
           +S+    + S  +L+VG+L   V +  L   FS   S     V  D  T  S GY +++F
Sbjct: 27  ESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNF 86

Query: 215 SNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            + E    A++++  T + G+  RI W+ +
Sbjct: 87  HDHEAGPKAIEQLNYTLIKGKPCRIMWSQR 116

>Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 87.8 bits (216), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 91/167 (54%), Gaps = 4/167 (2%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDAD 132
           E S   LYVG+L+ S++E  L   F   G +S+++V  D     S+ YA+V +  H    
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 133 VAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
            A + LN   I+ ++ +I W+ Q   +   +   N+F+ +L+ D+D++ L   FS F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 193 VQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           + + +  D + G+S+G+GF+ F  +  A+ A+D +    LNG++I +
Sbjct: 153 LSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 85/178 (47%), Gaps = 7/178 (3%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDAD 132
           R+     +++ NL   I+ + L   F + G I + K+  D+N  S  + FV + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 133 VAFKNLNGKTIETKVLKINWAFQ-----SQQTTSDESLFNLFVGDLNVDVDDETLGHAFS 187
            A   LNG  +  + + +          SQ   +     NL+V ++N +  DE     F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQDLFI 240

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           +F   V A +  D   G+ +G+GF+++ N EDA  A++ +  ++LNG ++ +  A K+
Sbjct: 241 QFGPIVSASLEKDA-DGKLKGFGFVNYENHEDAVKAVEALNESDLNGEKLYVGRAQKK 297

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 85/182 (46%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFK--- 136
           LYV N++    +E  +  F   GPI +  +  D +  +  + FV Y  H DA  A +   
Sbjct: 221 LYVKNINSETTDEQFQDLFIQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVEALN 280

Query: 137 --NLNGKTI----------ETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGH 184
             +LNG+ +             VLK  +     +  +     NLFV +L+  VDDE L  
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ + +   A VM   + G+S+G+GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 341 EFTPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 245 RE 246
           ++
Sbjct: 400 KD 401

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 46/89 (51%)

Query: 156 SQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFS 215
           S+  + + S  +L+VGDL   V +  L   FS   S     V  D  T  S GY +++F+
Sbjct: 28  SEGQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFN 87

Query: 216 NQEDAQTAMDKMQSTELNGRQIRINWASK 244
           + E  + A++++  T + GR  RI W+ +
Sbjct: 88  DHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A)
           binding protein, part of the 3'-end RNA-processing
           complex, mediates interactions between the 5' cap
           structure and the 3' mRNA poly(A) tail, involved in
           control of poly(A) tail length, interacts with
           translation factor eIF-4G
          Length = 577

 Score = 87.8 bits (216), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 91/167 (54%), Gaps = 4/167 (2%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDAD 132
           E S   LYVG+L+ S++E  L   F   G +S+++V  D     S+ YA+V +  H    
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 133 VAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
            A + LN   I+ ++ +I W+ Q   +   +   N+F+ +L+ D+D++ L   FS F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 193 VQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           + + +  D + G+S+G+GF+ F  +  A+ A+D +    LNG++I +
Sbjct: 153 LSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 84/182 (46%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFKNLN 139
           LYV N++    +E  ++ F   GPI +  +  D +  +  + FV Y +H DA  A + LN
Sbjct: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280

Query: 140 ---------------GKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGH 184
                           K     VLK  +     +  +     NLFV +L+  VDDE L  
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ + +   A VM   + G+S+G+GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 245 RE 246
           ++
Sbjct: 400 KD 401

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 85/178 (47%), Gaps = 7/178 (3%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDAD 132
           R+     +++ NL   I+ + L   F + G I + K+  D+N  S  + FV + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 133 VAFKNLNGKTIETKVLKINWAFQ-----SQQTTSDESLFNLFVGDLNVDVDDETLGHAFS 187
            A   LNG  +  + + +          SQ   +     NL+V ++N +  DE     F+
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           +F   V A +  D   G+ +G+GF+++   EDA  A++ +  +ELNG ++ +  A K+
Sbjct: 241 KFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKK 297

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 46/89 (51%)

Query: 156 SQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFS 215
           S+  + + S  +L+VGDL   V +  L   FS   S     V  D  T  S GY +++F+
Sbjct: 28  SESQSVENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFN 87

Query: 216 NQEDAQTAMDKMQSTELNGRQIRINWASK 244
           + E  + A++++  T + GR  RI W+ +
Sbjct: 88  DHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 34/90 (37%), Gaps = 5/90 (5%)

Query: 314 DDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPE-----KGNCFIKYD 368
           D  +       T +Y+ NI    T+     L   FG I+      +     KG  F+ Y+
Sbjct: 208 DSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYE 267

Query: 369 THEQAAVCIVVLANYPFQGRNLKTGWGKEK 398
            HE A   +  L +    G  L  G  ++K
Sbjct: 268 KHEDAVKAVEALNDSELNGEKLYVGRAQKK 297

>Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {ON}
           YHR086W (NAM8) - putative RNA binding protein, involved
           in meiosis-specific splicing of the REC107 transcripts
           in cooperation with the Mer1 protein [contig 153] FULL
          Length = 522

 Score = 87.8 bits (216), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 96/178 (53%), Gaps = 12/178 (6%)

Query: 75  ETSDKILYVGNLDKSINEETLKQ-YFQIGGPISNVKVINDKN---NSVNYAFVEYLQHHD 130
            T    LY+G+LD + +E  ++  +  +G P   +K+I       ++  Y FVE+  H +
Sbjct: 41  STRSNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHNSGYCFVEFPSHTN 100

Query: 131 ADVAFKNLNGKTIET---KVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAF- 186
           A  A    NG  I     ++LK+NWA      T+  + +++FVGD+  +V +  L   F 
Sbjct: 101 ASNALLK-NGLVIPNTGNRILKLNWA---SFATTPGNEYSVFVGDVAPNVTEAQLFELFI 156

Query: 187 SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
           S + S + A +++D  TG S+GYGF+ F  + + Q ++ +MQ   LNGR IR++  SK
Sbjct: 157 SRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRAIRVSTTSK 214

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    TE +L    Q FG I+  K    KG  F++Y     A   I  +  +P
Sbjct: 273 TTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGKGCGFVQYVDRLSAETAIAKMQGFP 332

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 333 IGNSRIRLSWGRS 345

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 39/81 (48%), Gaps = 4/81 (4%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKN 137
           +  +++G L   + E+ L+ +FQ  G I  VK+   K       FV+Y+    A+ A   
Sbjct: 272 NTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGK----GCGFVQYVDRLSAETAIAK 327

Query: 138 LNGKTIETKVLKINWAFQSQQ 158
           + G  I    ++++W   ++Q
Sbjct: 328 MQGFPIGNSRIRLSWGRSAKQ 348

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 6/81 (7%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+G L+  V ++ L   F  F S V   +         +G GF+ + ++  A+TA+ KM
Sbjct: 275 VFIGGLSSLVTEDELRAFFQPFGSIVYVKIP------VGKGCGFVQYVDRLSAETAIAKM 328

Query: 228 QSTELNGRQIRINWASKRENA 248
           Q   +   +IR++W    + A
Sbjct: 329 QGFPIGNSRIRLSWGRSAKQA 349

>KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.229
           YER165W
          Length = 582

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 89/161 (55%), Gaps = 4/161 (2%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           LYVG+LD S++E  L   F   G +++++V  D     S+ YA+V +  H    VA + L
Sbjct: 42  LYVGDLDPSVSEALLYDIFSPIGSVTSIRVCRDAITKTSLGYAYVNFADHEAGKVAIERL 101

Query: 139 NGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVM 198
           N   I+ ++ +I W+ Q       +   N+F+ +LN D+D++ L   FS F + + + + 
Sbjct: 102 NYTPIKGRLCRIMWS-QRDPALRKKGNGNIFIKNLNADIDNKALYDTFSVFGNILSSKIA 160

Query: 199 WDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
            D + G S+G+GF+ F  +  A+ A+D +    LNG++I +
Sbjct: 161 TD-ENGNSKGFGFVHFEEEAAAKEAIDALNGMLLNGQEIYV 200

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 67/142 (47%), Gaps = 16/142 (11%)

Query: 120 YAFVEYLQHHDADVAFKNLNGKTIETKVLKINWA----------FQSQQTTSDESL---- 165
           + FV Y  H DA  A + LN    + + L +  A           Q  + T  E +    
Sbjct: 263 FGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKKYERMQALKQQYEATRLEKMAKYQ 322

Query: 166 -FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAM 224
             NLF+ +L+  +DDE L   F+ F +     VM   + G+S+G+GF+ FS+ E+A  A+
Sbjct: 323 GVNLFIKNLDDSIDDEKLKEEFAPFGTITSTKVMR-TENGKSKGFGFVCFSSPEEATKAI 381

Query: 225 DKMQSTELNGRQIRINWASKRE 246
            +     + G+ + +  A ++E
Sbjct: 382 TEKNQQIVAGKPLYVAIAQRKE 403

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 89/178 (50%), Gaps = 7/178 (3%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDAD 132
           R+  +  +++ NL+  I+ + L   F + G I + K+  D+N NS  + FV + +   A 
Sbjct: 123 RKKGNGNIFIKNLNADIDNKALYDTFSVFGNILSSKIATDENGNSKGFGFVHFEEEAAAK 182

Query: 133 VAFKNLNGKTIETKVLKINWAFQ-----SQQTTSDESLFNLFVGDLNVDVDDETLGHAFS 187
            A   LNG  +  + + +          SQ   +  +  N++V ++ +D  +E       
Sbjct: 183 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEKTRANFTNVYVKNVPLDTTEEEF-KELF 241

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           E P    + V+   + G+ +G+GF+++ N EDA  A++++ +TE  G+++ +  A K+
Sbjct: 242 EKPGKTSSIVLEKGEDGKLKGFGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKK 299

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 47/89 (52%)

Query: 156 SQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFS 215
           S+   SD +  +L+VGDL+  V +  L   FS   S     V  D  T  S GY +++F+
Sbjct: 30  SEGQQSDSNSTSLYVGDLDPSVSEALLYDIFSPIGSVTSIRVCRDAITKTSLGYAYVNFA 89

Query: 216 NQEDAQTAMDKMQSTELNGRQIRINWASK 244
           + E  + A++++  T + GR  RI W+ +
Sbjct: 90  DHEAGKVAIERLNYTPIKGRLCRIMWSQR 118

>KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} similar
           to uniprot|P04147 Saccharomyces cerevisiae YER165W PAB1
           Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 592

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 85/167 (50%), Gaps = 4/167 (2%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDAD 132
           E ++  LYVG LD +I E  L   F   GPIS+++V  D     S+ YA+V Y  +    
Sbjct: 46  ENNNASLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGK 105

Query: 133 VAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
            A + LN   I  +  +I W+ +       +   N+F+ +L+  +D++ L   FS F   
Sbjct: 106 KAIQELNYAEINGRPCRIMWS-ERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEV 164

Query: 193 VQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           +   V  D + G SRG+GF+ F  + DA+ A++ +    +NG ++ +
Sbjct: 165 LSCKVALD-ENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGLEVYV 210

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 89/182 (48%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND-KNNSVNYAFVEYLQHHDADVAFKNLN 139
           +YV N+D    +E  +Q F   G I +  +  D +     + FV ++ H+ A  A + LN
Sbjct: 233 IYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELN 292

Query: 140 GKTIETKVLKINWAFQSQQTTSD----------ESL-----FNLFVGDLNVDVDDETLGH 184
           GK  +++ L +  A +  +   +          E L      NLF+ +L+  +DDE L  
Sbjct: 293 GKEFKSQALYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKE 352

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ + +   A VM D Q G S+G+GF+ FS+ E+A  AM +     + G+ + +  A +
Sbjct: 353 EFAPYGTITSARVMRD-QEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQR 411

Query: 245 RE 246
           ++
Sbjct: 412 KD 413

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 89/180 (49%), Gaps = 11/180 (6%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDAD 132
           R+     +++ NL  +I+ + L + F   G + + KV  D+N NS  + FV + +  DA 
Sbjct: 133 RKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGNSRGFGFVHFKEESDAK 192

Query: 133 VAFKNLNGKTIETKVLKINWAFQ-------SQQTTSDESLFNLFVGDLNVDVDDETLGHA 185
            A + +NG  +    L++  A         S+   +  +  N++V +++V+  DE     
Sbjct: 193 DAIEAVNGMLMNG--LEVYVAMHVPKKDRISKLEEAKANFTNIYVKNIDVETTDEEFEQL 250

Query: 186 FSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           FS++   V A +  D + G+ +G+GF++F +   A  A++++   E   + + +  A K+
Sbjct: 251 FSQYGEIVSAALEKDAE-GKPKGFGFVNFVDHNAAAKAVEELNGKEFKSQALYVGRAQKK 309

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 42/78 (53%)

Query: 167 NLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDK 226
           +L+VG+L+ ++ +  L   FS         V  D  T  S GY ++++++ E  + A+ +
Sbjct: 51  SLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQE 110

Query: 227 MQSTELNGRQIRINWASK 244
           +   E+NGR  RI W+ +
Sbjct: 111 LNYAEINGRPCRIMWSER 128

>KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086W NAM8 RNA binding protein component of the U1
           snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 516

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/172 (33%), Positives = 94/172 (54%), Gaps = 12/172 (6%)

Query: 81  LYVGNLDKSINEETLKQ-YFQIGGPISNVKVINDKNNSVN---YAFVEYLQHHDADVAFK 136
           LY+G+LD S +E  ++  +  +G P   VK+I +  ++     Y FVE+  H +A  A  
Sbjct: 45  LYMGDLDPSWDENAIRAVWANLGEPNVQVKLIRNSGSTGGSSGYCFVEFPSHLNASNALL 104

Query: 137 NLNGKTI---ETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAF-SEFPSF 192
             NG  I     + LK+NWA  +    ++ S+F   VGD+  +V +  L   F S + S 
Sbjct: 105 K-NGLLIPNARNRYLKLNWASFATAPGNEHSVF---VGDIAPNVSEAQLFELFISRYAST 160

Query: 193 VQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
           + A +++D  TG S+GYGF+ F  + + Q A+ +MQ   LNGR +R++  SK
Sbjct: 161 LNAKIVFDQMTGVSKGYGFVKFGQESEQQRALLEMQGVFLNGRAVRVSTTSK 212

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    +E +L    Q FG I+  K    KG  F++Y     A   I  +  YP
Sbjct: 273 TTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGKGCGFVQYVDRISAETAIAKMQGYP 332

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 333 IGNSRIRLSWGRS 345

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 44/92 (47%), Gaps = 4/92 (4%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVA 134
           + ++  +++G L   ++E+ L+ YFQ  G I  VK+   K       FV+Y+    A+ A
Sbjct: 269 DPNNTTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGK----GCGFVQYVDRISAETA 324

Query: 135 FKNLNGKTIETKVLKINWAFQSQQTTSDESLF 166
              + G  I    ++++W   ++Q    +  F
Sbjct: 325 IAKMQGYPIGNSRIRLSWGRSAKQAAVMQQAF 356

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+G L+  V ++ L   F  F S V   +         +G GF+ + ++  A+TA+ KM
Sbjct: 275 VFIGGLSSLVSEDELRAYFQPFGSIVYVKIP------VGKGCGFVQYVDRISAETAIAKM 328

Query: 228 QSTELNGRQIRINWASKRENAT 249
           Q   +   +IR++W    + A 
Sbjct: 329 QGYPIGNSRIRLSWGRSAKQAA 350

>SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q759G9 Ashbya gossypii ADR307W
           ADR307Wp and some similarites with YHR086W
           uniprot|Q00539 Saccharomyces cerevisiae YHR086W NAM8 RNA
           binding protein component of the U1 snRNP protein
           mutants are defective in meiotic recombination and in
           formation of viable spores involved in the formation of
           DSBs through meiosis-specific splicing of MER2 pre-mRNA
          Length = 545

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 96/174 (55%), Gaps = 12/174 (6%)

Query: 81  LYVGNLDKSINEETLKQ-YFQIGGPISNVKVINDKNNSVN---YAFVEYLQHHDADVAFK 136
           LY+G+LD S +E ++K  +  +G     VK+I +   +     + FVE+  H +A  A  
Sbjct: 57  LYMGDLDPSWDESSIKSIWSSLGEQNILVKLIRNAGTTTTNSGFCFVEFPSHLNASNALL 116

Query: 137 NLNGKTIET---KVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAF-SEFPSF 192
             NG  +     K LK+NWA     +T+  + +++FVGDL  +V +  L   F S + S 
Sbjct: 117 K-NGLPVPNAVNKFLKLNWA---SISTTPGNEYSIFVGDLAPNVTEAQLFELFISRYSST 172

Query: 193 VQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKRE 246
           + + +++D  TG S+GYGF+ F N+ +   A+ +MQ   LNGR IR++  SK +
Sbjct: 173 LNSKIVFDQLTGVSKGYGFVKFGNEAEQHRALLEMQGVFLNGRAIRVSTTSKNK 226

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 69  AINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQH 128
           +IN   + ++  +++G L   + E+ L+ YFQ  G I  VK+   K       FV+Y+  
Sbjct: 271 SINQFTDPNNTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGK----GCGFVQYIDR 326

Query: 129 HDADVAFKNLNGKTIETKVLKINWAFQSQQT 159
             A+ A   + G  I    ++++W   ++QT
Sbjct: 327 ISAETAIAKMQGFPIGNSRIRLSWGRSAKQT 357

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    TE +L    Q FG I+  K    KG  F++Y     A   I  +  +P
Sbjct: 281 TTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGKGCGFVQYIDRISAETAIAKMQGFP 340

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 341 IGNSRIRLSWGRS 353

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 48/100 (48%), Gaps = 11/100 (11%)

Query: 148 LKINWAFQSQQTTS-----DESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQ 202
           L+  + F  QQT S     D +   +F+G L+  V ++ L   F  F S V   +     
Sbjct: 258 LQSQFVFPVQQTPSINQFTDPNNTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVG-- 315

Query: 203 TGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWA 242
               +G GF+ + ++  A+TA+ KMQ   +   +IR++W 
Sbjct: 316 ----KGCGFVQYIDRISAETAIAKMQGFPIGNSRIRLSWG 351

>KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.382
           YHR086W
          Length = 406

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 94/165 (56%), Gaps = 15/165 (9%)

Query: 80  ILYVGNLDKSINEETLKQ-YFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNL 138
           +LY+G+LD S +E  + Q +  +G P  +VK++N       Y F+ +L    A  A    
Sbjct: 33  VLYMGDLDLSWDERVVSQIWASLGEPNVSVKMMN------RYCFITFLDSLTASNALLK- 85

Query: 139 NGKTIET---KVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAF-SEFPSFVQ 194
           NG  I     K LK+NWA   Q +++  + +++FVGDL+ +V +  L   F +++ S   
Sbjct: 86  NGMLIPGYGGKRLKLNWA---QASSNASNGYSIFVGDLSPNVTEAQLFDLFINKYASTDH 142

Query: 195 AHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           A +++D  TG SRGYGF+ F++  D Q A+ +MQ   LNGR I+I
Sbjct: 143 AKIVYDQATGVSRGYGFVRFNSLMDQQHALLEMQGIFLNGRAIKI 187

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 33/73 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV++G +    TE +L    + FG I+  K    KG  F++Y     A   I  +  +P
Sbjct: 244 TTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGKGCGFVQYIDRVSAENAISKMQGFP 303

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 304 IANSRIRLSWGRS 316

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 4/84 (4%)

Query: 70  INGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHH 129
           +N   + ++  ++VG L   + E+ L++YF+  G I  VK+   K       FV+Y+   
Sbjct: 235 LNHFTDPNNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGK----GCGFVQYIDRV 290

Query: 130 DADVAFKNLNGKTIETKVLKINWA 153
            A+ A   + G  I    ++++W 
Sbjct: 291 SAENAISKMQGFPIANSRIRLSWG 314

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +FVG L+  V ++ L   F  F + V   +         +G GF+ + ++  A+ A+ KM
Sbjct: 246 VFVGGLSSLVTEDELREYFKPFGTIVYVKI------PVGKGCGFVQYIDRVSAENAISKM 299

Query: 228 QSTELNGRQIRINWA 242
           Q   +   +IR++W 
Sbjct: 300 QGFPIANSRIRLSWG 314

>TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {ON}
           Anc_5.382 YHR086W
          Length = 674

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 63/187 (33%), Positives = 99/187 (52%), Gaps = 31/187 (16%)

Query: 81  LYVGNLDKSINEETLKQYF-QIGGPISNVKVINDKN------NSVNYAFVEYLQHHDADV 133
           LY+G+LD   +E T+KQ +  +G     VK+I + N      N+  Y F+E+  +++A  
Sbjct: 64  LYMGDLDPMWDESTIKQIWNSLGENNIVVKIITNSNMTSMGRNNPGYCFIEFSNYNNASN 123

Query: 134 AFKNLNGKTI---ETKVLKINWAFQSQQTTSDESL-----------------FNLFVGDL 173
           A    NG  I    +KVLK+NWA  S  T S+ +                  F++FVGDL
Sbjct: 124 ALLK-NGLVIPGYNSKVLKLNWA--SMHTRSNGNTNCTANNNTSSNNSTNNDFSVFVGDL 180

Query: 174 NVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTEL 232
             +V +  L   F + + S + A +++D  T  S+GYGF+ F+N  D Q ++++MQ   L
Sbjct: 181 APNVTEAQLFDLFINRYSSTIHAKIVYDQMTNVSKGYGFVRFNNSADQQRSLNEMQGVFL 240

Query: 233 NGRQIRI 239
           NGR IR+
Sbjct: 241 NGRSIRV 247

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    +E +L    Q FG I+  K    KG  F++Y     A   I  +  +P
Sbjct: 340 TTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGKGCGFVQYVDRSAAETAISKMQGFP 399

Query: 385 FQGRNLKTGWGK 396
                ++  WG+
Sbjct: 400 IGNSRIRLSWGR 411

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 4/95 (4%)

Query: 69  AINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQH 128
           A+N   + ++  +++G L   ++E  L+ YFQ  G I  VK+   K       FV+Y+  
Sbjct: 330 ALNQFTDPNNTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGK----GCGFVQYVDR 385

Query: 129 HDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDE 163
             A+ A   + G  I    ++++W   ++Q+   E
Sbjct: 386 SAAETAISKMQGFPIGNSRIRLSWGRFAKQSAQVE 420

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+G L+  V +  L   F  F + V   +         +G GF+ + ++  A+TA+ KM
Sbjct: 342 VFIGGLSSLVSEGELRSYFQPFGTIVYVKI------PVGKGCGFVQYVDRSAAETAISKM 395

Query: 228 QSTELNGRQIRINWA 242
           Q   +   +IR++W 
Sbjct: 396 QGFPIGNSRIRLSWG 410

>Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 90/167 (53%), Gaps = 4/167 (2%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDAD 132
           E S   LYVG+L+ +++E  L   F   G +S+++V  D     S+ YA+V +  H    
Sbjct: 34  ENSSASLYVGDLEPAVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 133 VAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
            A + LN   I+ ++ +I W+ Q   +   +   N+F+ +L+ D+D++ L   FS F   
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWS-QRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDI 152

Query: 193 VQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           + + +  D + G S+G+GF+ F  +  A+ A+D +    LNG++I +
Sbjct: 153 LSSKIATD-ENGNSKGFGFVHFEEEVAAKEAIDALNGMLLNGQEIYV 198

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 86/178 (48%), Gaps = 7/178 (3%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDAD 132
           R+     +++ NL   I+ + L   F + G I + K+  D+N NS  + FV + +   A 
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGNSKGFGFVHFEEEVAAK 180

Query: 133 VAFKNLNGKTIETKVLKINWAFQ-----SQQTTSDESLFNLFVGDLNVDVDDETLGHAFS 187
            A   LNG  +  + + +          SQ   +     NL+V ++N +  DE     F 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQEMFV 240

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           +F   V A +  D   G+ +G+GF+++ N EDA  A++ +  ++LNG ++ +  A K+
Sbjct: 241 KFGPIVSASLEKDA-DGQLKGFGFVNYENHEDAVKAVEALNESDLNGEKLYVGRAQKK 297

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 86/182 (47%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFK--- 136
           LYV N++    +E  ++ F   GPI +  +  D +  +  + FV Y  H DA  A +   
Sbjct: 221 LYVKNINSETTDEQFQEMFVKFGPIVSASLEKDADGQLKGFGFVNYENHEDAVKAVEALN 280

Query: 137 --NLNGKTI----------ETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGH 184
             +LNG+ +             VLK  +     +  +     NLFV +L+  VDDE L  
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDTVDDEKLEE 340

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ + +   A VM   + G+S+G+GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 341 EFAPYGTITSAKVMRS-ENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 245 RE 246
           ++
Sbjct: 400 KD 401

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 46/89 (51%)

Query: 156 SQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFS 215
           S+  + + S  +L+VGDL   V +  L   FS   S     V  D  T  S GY +++F+
Sbjct: 28  SEGQSVENSSASLYVGDLEPAVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFN 87

Query: 216 NQEDAQTAMDKMQSTELNGRQIRINWASK 244
           + E  + A++++  T + GR  RI W+ +
Sbjct: 88  DHEAGRKAIEQLNYTPIKGRLCRIMWSQR 116

>CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086w NAM8 meiotic recombination protein
          Length = 555

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 69/194 (35%), Positives = 93/194 (47%), Gaps = 28/194 (14%)

Query: 73  GRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKV---------INDKNNSVNYAFV 123
           G  T    LY+G+LD S +E  +K  +   G   N+ V          + KN  + Y FV
Sbjct: 78  GASTPGSQLYMGDLDPSWDEAVVKGIWAALGE-ENIGVRMMWGGDADFHRKN--LGYCFV 134

Query: 124 EYLQHHDADVAFKNLNGKTIET---KVLKINWAFQSQQTTSDESLFN-----------LF 169
           E+     A  A    NG  I     K LK+NW+ QS    S  S+ N           +F
Sbjct: 135 EFPSPAHASNALMK-NGMEIPGFVHKKLKLNWSAQSVNNGSGASVANGAVANQQTNNSIF 193

Query: 170 VGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQ 228
           VGDL   V +  L   F +++PS V A VM+D  TG S+GYGF+ F +  D Q A+ +MQ
Sbjct: 194 VGDLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQ 253

Query: 229 STELNGRQIRINWA 242
              LNGR I+I  A
Sbjct: 254 GCFLNGRAIKIGIA 267

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 33/73 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV++G +    TE +L    + FG I+  K    KG  F++Y     A   I  +  +P
Sbjct: 327 TTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGKGCGFVQYVERSSAETAITKMQGFP 386

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 387 IANSRVRLSWGRS 399

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 4/85 (4%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVA 134
           + ++  ++VG L   + E+ L+ YF+  G I  VK+   K       FV+Y++   A+ A
Sbjct: 323 DPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGK----GCGFVQYVERSSAETA 378

Query: 135 FKNLNGKTIETKVLKINWAFQSQQT 159
              + G  I    ++++W   +++T
Sbjct: 379 ITKMQGFPIANSRVRLSWGRSAKKT 403

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +FVG L+  V ++ L   F  F + +   +         +G GF+ +  +  A+TA+ KM
Sbjct: 329 VFVGGLSPLVTEDELRSYFEPFGTIIYVKIP------AGKGCGFVQYVERSSAETAITKM 382

Query: 228 QSTELNGRQIRINWA 242
           Q   +   ++R++W 
Sbjct: 383 QGFPIANSRVRLSWG 397

>NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382
          Length = 443

 Score = 84.0 bits (206), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 94/178 (52%), Gaps = 8/178 (4%)

Query: 76  TSDKILYVGNLDKSINEETLKQYFQ-IGGPISNVKVINDKNNSVN--YAFVEY--LQHHD 130
           T    LY+G+LD + +E  ++Q ++ +G    +VK++ + N  VN  Y FVE+  ++H +
Sbjct: 44  TGSSQLYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGYCFVEFPSMEHGN 103

Query: 131 ADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAF-SEF 189
             +    +       + LK+NWA  S     + S F++FVGDL+ +V +  L   F   +
Sbjct: 104 NALLKNGIVIPGFPQRRLKLNWA--SAGANGNNSGFSVFVGDLSPNVTEAQLFELFIGRY 161

Query: 190 PSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKREN 247
           PS   A V+ D  TG S+ YGF+ F++  D Q  + +MQ   LNGR I++       N
Sbjct: 162 PSTCHAKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKVGLTGGAHN 219

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 44/84 (52%), Gaps = 4/84 (4%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVA 134
           + ++  +++G L   ++E+ L+QYFQ  G I  VK+   K       FV+Y+    A++A
Sbjct: 279 DPNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGK----GCGFVQYVDRLSAELA 334

Query: 135 FKNLNGKTIETKVLKINWAFQSQQ 158
              + G  +    ++++W   S+Q
Sbjct: 335 ISKMQGFPLANSRIRLSWGRSSKQ 358

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    +E DL    Q FG I+  K    KG  F++Y     A + I  +  +P
Sbjct: 283 TTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGKGCGFVQYVDRLSAELAISKMQGFP 342

Query: 385 FQGRNLKTGWGKEK 398
                ++  WG+  
Sbjct: 343 LANSRIRLSWGRSS 356

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+G L+  V ++ L   F  F   +   +     TG+  G GF+ + ++  A+ A+ KM
Sbjct: 285 VFIGGLSSLVSEDDLRQYFQPFGDIIYVKI----PTGK--GCGFVQYVDRLSAELAISKM 338

Query: 228 QSTELNGRQIRINWA 242
           Q   L   +IR++W 
Sbjct: 339 QGFPLANSRIRLSWG 353

>NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {ON}
           Anc_5.382
          Length = 498

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 93/175 (53%), Gaps = 16/175 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQ-IGGPISNVKVINDKNNSVN--YAFVEYL-QHHDADVAFK 136
           +Y+G LD +  E T+K  ++ +G  + NVK+I +KN  +N  Y F+E+  + H ++   K
Sbjct: 72  IYMGELDPTWTEATIKSIWKSLGEELINVKLIWNKNLGLNQGYCFIEFPSEQHASNALLK 131

Query: 137 N-LNGKTIETKVLKINWAF----------QSQQTTSDESLFNLFVGDLNVDVDDETLGHA 185
           N +N      K +K+NW             S Q  S  + +++FVGDL  +V +  L   
Sbjct: 132 NGINIPEFPRKKVKLNWTSSSSASLQGSSNSGQVPSTSTNYSVFVGDLAANVTEGQLFDL 191

Query: 186 F-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           F S F S   A ++ D  T  S+ YGF+ F++  D Q A+ +MQ   LNGR I+I
Sbjct: 192 FISRFQSTCHAKIVHDPVTRASKCYGFVKFNDLRDQQRALVEMQGIFLNGRAIKI 246

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +FVG L+  V +E L H F  F + +   +         +G GF+ + ++  A+TA+ +M
Sbjct: 328 VFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPI------GKGCGFVQYFDRISAETAILRM 381

Query: 228 QSTELNGRQIRINWA 242
           Q   +   +IR++W 
Sbjct: 382 QGFPIGNSRIRLSWG 396

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 33/73 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV++G +    TE  L    Q FG I+  K    KG  F++Y     A   I+ +  +P
Sbjct: 326 TTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGKGCGFVQYFDRISAETAILRMQGFP 385

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 386 IGNSRIRLSWGRS 398

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVA 134
           + ++  ++VG L   + EE L+  FQ  G I  VK+   K       FV+Y     A+ A
Sbjct: 322 DPNNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGK----GCGFVQYFDRISAETA 377

Query: 135 FKNLNGKTIETKVLKINWAFQSQQ 158
              + G  I    ++++W   S+Q
Sbjct: 378 ILRMQGFPIGNSRIRLSWGRSSRQ 401

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 88/167 (52%), Gaps = 4/167 (2%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDAD 132
           E S   LYVG LD S+ E  L   F   G +S+++V  D     S+ YA+V +  H+   
Sbjct: 36  EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGT 95

Query: 133 VAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
            A + LN   I+ +  +I W+ Q   +   +   N+F+ +L+  +D++ L   FS F + 
Sbjct: 96  TAIEKLNYTPIKGRPCRIMWS-QRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNI 154

Query: 193 VQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           +   +  D +TG+SR +GF+ F  +E A+ A+D +    LNG ++ +
Sbjct: 155 LSCKIATD-ETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNGLEVYV 200

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 83/182 (45%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFKNLN 139
           +YV N+D    ++  ++ F   G I++  +  D    +  + FV +  H+ A  A + LN
Sbjct: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELN 282

Query: 140 GKTIETKVLKINWA---------FQSQQTTSD-ESL-----FNLFVGDLNVDVDDETLGH 184
                 + L +  A          + Q  +S  E L      NLFV +L+  +DDE L  
Sbjct: 283 DTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQE 342

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ F +     VM D   G S+G+GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 343 EFAPFGTITSVKVMRD-DAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 245 RE 246
           +E
Sbjct: 402 KE 403

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 90/178 (50%), Gaps = 7/178 (3%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK-NNSVNYAFVEYLQHHDAD 132
           R+     +++ NL  +I+ + L   F + G I + K+  D+   S  + FV + +   A 
Sbjct: 123 RKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEAAK 182

Query: 133 VAFKNLNGKTIETKVLKI--NWAFQSQQTTSDE---SLFNLFVGDLNVDVDDETLGHAFS 187
            A   +NG  +    + +  + + + +Q+  DE   +  N++V +++ +   +     FS
Sbjct: 183 EAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFS 242

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           ++ +   A +  D + G+ RG+GF++F +   A  A++++  T+ NG+++ +  A K+
Sbjct: 243 QYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKK 299

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (50%)

Query: 156 SQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFS 215
           S+ T  + S  +L+VG+L+  V +  L   FS   S     V  D  T  S GY +++F 
Sbjct: 30  SESTKGEASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFH 89

Query: 216 NQEDAQTAMDKMQSTELNGRQIRINWASK 244
           +     TA++K+  T + GR  RI W+ +
Sbjct: 90  DHNAGTTAIEKLNYTPIKGRPCRIMWSQR 118

>Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W
           (REAL)
          Length = 524

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 103/204 (50%), Gaps = 33/204 (16%)

Query: 71  NGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN----------- 119
           N G  T+   LY+G+LD + ++ T++Q +   G  +N+ V    NNS+N           
Sbjct: 46  NVGSGTTGNQLYMGDLDPTWDKNTVRQIWASLGE-ANINVRMMWNNSLNNGSRSPMGSKN 104

Query: 120 ---YAFVEYLQH-HDADVAFKNLNGKTIET---KVLKINWAFQSQQTTSDESLFN----- 167
              Y FV++    H A+   KN  G  I     + LK+NWA  S   +S  S FN     
Sbjct: 105 NQGYCFVDFPSSTHAANALLKN--GMLIPNFPNRKLKLNWATSSY--SSGNSTFNNVKSS 160

Query: 168 ----LFVGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQT 222
               +FVGDL  +V +  L   F + + S   A V+ D  TG S+GYGF+ F+N ++ Q+
Sbjct: 161 NNCSVFVGDLAPNVTESQLFELFINRYASVAHAKVVHDQVTGISKGYGFVKFANSDEQQS 220

Query: 223 AMDKMQSTELNGRQIRINWASKRE 246
           A+ +MQ   LNGR I++   S ++
Sbjct: 221 ALLEMQGVFLNGRAIKVGPTSGQQ 244

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    TE +L    Q FG I+  K    KG  F++Y     A   I  +  +P
Sbjct: 313 TTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAETAIARMQGFP 372

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 373 IANSRVRLSWGRS 385

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 69  AINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQH 128
           ++N   + ++  +++G L   + E+ L+ YFQ  G I  VK+   K       FV+Y+  
Sbjct: 303 SLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGK----GCGFVQYVDR 358

Query: 129 HDADVAFKNLNGKTIETKVLKINWAFQSQQT 159
             A+ A   + G  I    ++++W   ++QT
Sbjct: 359 LSAETAIARMQGFPIANSRVRLSWGRSAKQT 389

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+G L+  V ++ L   F  F + V   +         +G GF+ + ++  A+TA+ +M
Sbjct: 315 VFIGGLSSLVTEDELRAYFQPFGTIVYVKIP------VGKGCGFVQYVDRLSAETAIARM 368

Query: 228 QSTELNGRQIRINWA 242
           Q   +   ++R++W 
Sbjct: 369 QGFPIANSRVRLSWG 383

>TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.382
           YHR086W
          Length = 494

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 96/188 (51%), Gaps = 27/188 (14%)

Query: 78  DKILYVGNLDKSINEETLKQYF-QIGGPISNVKVI------------NDKNNSVNYAFVE 124
           + +LY+G LD S NE  +K  + ++G P +NV+++             +  +++ Y FVE
Sbjct: 42  NNVLYMGGLDYSWNEAVIKDIWNKVGEPATNVRMMWNMQFQHNNAGPTEGKSNLGYCFVE 101

Query: 125 YLQHHDADVAFKNLNGKTI---ETKVLKINW---------AFQSQQTTSDESLFNLFVGD 172
           +  H  A  A    NG  I   + +  K+NW         A  ++      + +++FVGD
Sbjct: 102 FSTHETASNAIMK-NGTMIPGYKGRYFKLNWSSGSSLSSSATHTENQGPQSNDYSVFVGD 160

Query: 173 LNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTE 231
           L  +V +  L + F S + S + + ++ D  T  S+GYGFI F +Q D   A+ KMQ+  
Sbjct: 161 LGQNVTESQLYNLFKSHYASTLSSKIIHDPLTYISKGYGFIKFHDQNDYNDALSKMQNKI 220

Query: 232 LNGRQIRI 239
           LNGR I++
Sbjct: 221 LNGRGIKV 228

>KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.61
           YGR159C
          Length = 399

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 92/179 (51%), Gaps = 14/179 (7%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           L+VG L  S+++E LK  F   G + + +VI ++  + S  Y +V++     A+ A K +
Sbjct: 151 LFVGRLSWSVDDEWLKNEFAPIGGVVSARVIMERGTDRSRGYGYVDFEDISYAEKALKEM 210

Query: 139 NGKTIETKVLKINWAFQSQQTTSD------------ESLFNLFVGDLNVDVDDETLGHAF 186
            GK I+ + + ++ +       +             E    LF+G+L+ D D + L   F
Sbjct: 211 QGKEIDGRPINVDMSTSKPAGGASNDRAKKFGDVPSEPSDTLFLGNLSFDADRDNLYEIF 270

Query: 187 SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
            +F   +   +    +T + +G+G++ ++N EDA+ A+D +Q   +N R +R+++++ R
Sbjct: 271 GKFGEIISVRIPTHPETEQPKGFGYVQYTNTEDAKKALDALQGESINDRPVRLDFSTPR 329

>KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 86/161 (53%), Gaps = 4/161 (2%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           LYVG LD S+ E  L   F   G +S+++V  D     S+ YA+V +  H+    A + L
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 139 NGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVM 198
           N   I+ +  +I W+ Q   +   +   N+F+ +L+  +D++ L   FS F + +   + 
Sbjct: 102 NYTPIKGRPCRIMWS-QRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIA 160

Query: 199 WDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
            D +TG+SR +GF+ F  +E A+ A+D +    LNG ++ +
Sbjct: 161 TD-ETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNGLEVYV 200

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 85/182 (46%), Gaps = 17/182 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN-YAFVEYLQHHDADVAFKNLN 139
           +YV N+D    +E  ++ F   G I++  +  D    +  + FV +  H+ A  A + LN
Sbjct: 223 VYVKNIDSETTQEEFEKMFSNYGAITSAVLERDNEGKLRGFGFVNFEDHNAALKACEELN 282

Query: 140 GKTIETKVLKINWA---------FQSQQTTSD-ESL-----FNLFVGDLNVDVDDETLGH 184
               + + L +  A          + Q  +S  E L      NLFV +L+  VDD+ L  
Sbjct: 283 DTDFKGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSVDDQKLEE 342

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+ F +     VM D + G S+G+GF+ FS  E+A  A+ +     + G+ + +  A +
Sbjct: 343 EFAPFGTITSVKVMRD-EAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 245 RE 246
           +E
Sbjct: 402 KE 403

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 87/178 (48%), Gaps = 7/178 (3%)

Query: 74  RETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK-NNSVNYAFVEYLQHHDAD 132
           R+     +++ NL  +I+ + L   F + G I + K+  D+   S  + FV + +   A 
Sbjct: 123 RKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEAAK 182

Query: 133 VAFKNLNGKTIETKVLKI--NWAFQSQQTTSDE---SLFNLFVGDLNVDVDDETLGHAFS 187
            A   +NG  +    + +  + + + +Q+  DE   +  N++V +++ +   E     FS
Sbjct: 183 EAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDSETTQEEFEKMFS 242

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
            + +   A +  D + G+ RG+GF++F +   A  A +++  T+  G+++ +  A K+
Sbjct: 243 NYGAITSAVLERDNE-GKLRGFGFVNFEDHNAALKACEELNDTDFKGQKLYVGRAQKK 299

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (51%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           L+VG+L+  V +  L   FS   S     V  D  T  S GY +++F +    +TA++K+
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 228 QSTELNGRQIRINWASK 244
             T + GR  RI W+ +
Sbjct: 102 NYTPIKGRPCRIMWSQR 118

>NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 95/177 (53%), Gaps = 12/177 (6%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           ++VG L  SI++E LK+ F+  G +   +VI ++  + S  Y +V++     A+ A + +
Sbjct: 173 IFVGRLSWSIDDEWLKKEFEHIGGVVGARVIYERGTDRSRGYGYVDFEDKSYAEKAIQEM 232

Query: 139 NGKTIETKVLKINWAFQSQQTTSD----------ESLFNLFVGDLNVDVDDETLGHAFSE 188
            GK I+ + + ++ +       +D          E    LF+G+L+ + D + +   FS+
Sbjct: 233 QGKEIDGRPINVDMSTSKPAGGNDRAKKFGDVPSEPSDTLFLGNLSFNADKDNIYETFSK 292

Query: 189 FPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           +   +   +    +T + +G+G++ FSN EDA+ A++ +Q   ++ R +R+++++ R
Sbjct: 293 YGEIISVRIPTHPETEQPKGFGYVQFSNIEDAKKALEGLQGEYIDNRAVRLDYSTPR 349

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 51/88 (57%)

Query: 158 QTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQ 217
           Q TS      +FVG L+  +DDE L   F      V A V+++  T RSRGYG++ F ++
Sbjct: 163 QKTSGGEPATIFVGRLSWSIDDEWLKKEFEHIGGVVGARVIYERGTDRSRGYGYVDFEDK 222

Query: 218 EDAQTAMDKMQSTELNGRQIRINWASKR 245
             A+ A+ +MQ  E++GR I ++ ++ +
Sbjct: 223 SYAEKAIQEMQGKEIDGRPINVDMSTSK 250

>Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON}
           YGR159C (REAL)
          Length = 395

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 97/183 (53%), Gaps = 16/183 (8%)

Query: 80  ILYVGNLDKSINEETLKQYFQ-IGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFK 136
            ++VG L  SI++E LK+ F+ IGG IS  +VI ++  + S  Y +V++     A+ A +
Sbjct: 148 TIFVGRLSWSIDDEWLKKEFEHIGGVIS-ARVIYERGTDRSRGYGYVDFENKSYAEKAIQ 206

Query: 137 NLNGKTIETKVLKINWAFQSQQT------------TSDESLFNLFVGDLNVDVDDETLGH 184
            + GK I+ + +  + +     +            T  E    LF+G+L+ + D + +  
Sbjct: 207 EMQGKEIDGRPINCDMSTSKPASNNNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDVIFE 266

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F++    V   +    +T + +G+G++ FSN EDA+ A+D +Q   ++ R +R++++S 
Sbjct: 267 LFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSP 326

Query: 245 REN 247
           R N
Sbjct: 327 RPN 329

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 51/91 (56%)

Query: 155 QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISF 214
           + Q+    E    +FVG L+  +DDE L   F      + A V+++  T RSRGYG++ F
Sbjct: 136 KKQKNEESEEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVIYERGTDRSRGYGYVDF 195

Query: 215 SNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
            N+  A+ A+ +MQ  E++GR I  + ++ +
Sbjct: 196 ENKSYAEKAIQEMQGKEIDGRPINCDMSTSK 226

>YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}
           NSR1Nucleolar protein that binds nuclear localization
           sequences, required for pre-rRNA processing and ribosome
           biogenesis
          Length = 414

 Score = 78.2 bits (191), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 94/179 (52%), Gaps = 12/179 (6%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           ++VG L  SI++E LK+ F+  G +   +VI ++  + S  Y +V++     A+ A + +
Sbjct: 170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEM 229

Query: 139 NGKTIETKVLKINWAFQSQQTTSD----------ESLFNLFVGDLNVDVDDETLGHAFSE 188
            GK I+ + +  + +       +D          E    LF+G+L+ + D + +   F++
Sbjct: 230 QGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAK 289

Query: 189 FPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKREN 247
               V   +    +T + +G+G++ FSN EDA+ A+D +Q   ++ R +R++++S R N
Sbjct: 290 HGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPRPN 348

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 51/91 (56%)

Query: 155 QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISF 214
           + Q+    E    +FVG L+  +DDE L   F      + A V+++  T RSRGYG++ F
Sbjct: 157 KKQKNEETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDF 216

Query: 215 SNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
            N+  A+ A+ +MQ  E++GR I  + ++ +
Sbjct: 217 ENKSYAEKAIQEMQGKEIDGRPINCDMSTSK 247

>ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {ON}
           some similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 558

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 101/200 (50%), Gaps = 24/200 (12%)

Query: 66  PANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGP------------ISNVKVIND 113
           P NA+ G R +    LY+G+LD S +E T++Q +   G             +S    +  
Sbjct: 36  PVNAV-GNRGSQ---LYMGDLDPSWDENTIRQIWGSLGESNVVIRLMLHNNVSGSGTMGP 91

Query: 114 KNNSVNYAFVEYLQH-HDADVAFKNLNGKTIET---KVLKINWAFQSQQTTSDESLFNLF 169
           +NN + Y F+E+    H ++   KN  G  I     K LK+NWA  S  +    + +++F
Sbjct: 92  RNN-LGYCFLEFPSTVHASNALLKN--GMQIPNFVHKRLKLNWASSSHSSAGAFNEYSVF 148

Query: 170 VGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQ 228
           VGDL  +V +  L   F S F S     +++D  TG S+GY F+ F+N    Q A+ +MQ
Sbjct: 149 VGDLAPNVTESQLFELFISRFNSTSHVKIVYDQLTGVSKGYAFVKFTNPAHQQRALLEMQ 208

Query: 229 STELNGRQIRINWASKRENA 248
              L+GR IR++ A   +N+
Sbjct: 209 GIFLSGRAIRVSNAGHLQNS 228

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 51/105 (48%), Gaps = 5/105 (4%)

Query: 64  VVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFV 123
           V P  A+N   + ++  ++VG L   + E+ L+ YFQ  G I  VK+   K       FV
Sbjct: 268 VQPQPALNSFTDPNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGK----GCGFV 323

Query: 124 EYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQ-TTSDESLFN 167
           +Y+    A+ A   + G  I    ++++W   ++Q  T  ++L N
Sbjct: 324 QYVDRISAETAIAKMQGFPIGNSRVRLSWGRSAKQAATVQQALIN 368

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 32/73 (43%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV++G +     E +L    Q FG I+  K    KG  F++Y     A   I  +  +P
Sbjct: 283 TTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRISAETAIAKMQGFP 342

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 343 IGNSRVRLSWGRS 355

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 7/83 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +FVG L+  V ++ L   F  F + V   +         +G GF+ + ++  A+TA+ KM
Sbjct: 285 VFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVG------KGCGFVQYVDRISAETAIAKM 338

Query: 228 QSTELNGRQIRINWA-SKRENAT 249
           Q   +   ++R++W  S ++ AT
Sbjct: 339 QGFPIGNSRVRLSWGRSAKQAAT 361

>Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar to
           Ashbya gossypii AFR107W
          Length = 448

 Score = 78.2 bits (191), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 97/185 (52%), Gaps = 16/185 (8%)

Query: 76  TSDKILYVGNLDKSINEETLKQYFQ-IGGPISNVKVINDKN--NSVNYAFVEYLQHHDAD 132
           T    ++VG L  SI++E LK  F+ IGG IS  +VI ++    S  Y +V++     A+
Sbjct: 208 TEPATIFVGRLSWSIDDEWLKTEFEHIGGVIS-ARVIYERGTERSRGYGYVDFEDKSYAE 266

Query: 133 VAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFN------------LFVGDLNVDVDDE 180
            A K + GK I+ + + ++ +     +   E                LF+G+L+ + D +
Sbjct: 267 KAIKEMQGKEIDGRPINVDMSTSKPASNPKEDRAKKFGDVPSQPSDTLFLGNLSFNADRD 326

Query: 181 TLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRIN 240
            +   F ++ S +   +    +T + +G+G++ +++ E+AQ A+DK+Q   ++ R +R++
Sbjct: 327 NIFELFKDYGSIISVRIPTHPETNQPKGFGYVQYASIEEAQKALDKLQGEYIDNRPVRLD 386

Query: 241 WASKR 245
           ++S R
Sbjct: 387 FSSPR 391

>TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa]
           {ON} Anc_4.61 YGR159C
          Length = 403

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 92/178 (51%), Gaps = 13/178 (7%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           ++VG L  SI++E LK  F+  G + + +VI +K  + S  Y +V++     A+ A K +
Sbjct: 163 IFVGRLSWSIDDEWLKTEFEPIGGVLSARVIYEKGTDRSRGYGYVDFKNKTFAEKAIKEM 222

Query: 139 NGKTIETKVLKINWAFQSQQT-----------TSDESLFNLFVGDLNVDVDDETLGHAFS 187
            GK I+ + +  + +     +           T  E    LF+G+L+ D D + +   FS
Sbjct: 223 QGKEIDGRPINCDMSTSKPASNGGDRAKKFGDTPSEPSETLFLGNLSFDADRDNIYEVFS 282

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           ++   +   +    +T + +G+G++ + + E A+ A+D +Q   +N R +R+++++ R
Sbjct: 283 KYGEIISVRIPTHPETEQPKGFGYVQYGDVESAKKALDALQGEYINNRPVRLDFSTPR 340

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 51/91 (56%)

Query: 155 QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISF 214
           + Q+    E    +FVG L+  +DDE L   F      + A V+++  T RSRGYG++ F
Sbjct: 150 KKQKPDESEEPATIFVGRLSWSIDDEWLKTEFEPIGGVLSARVIYEKGTDRSRGYGYVDF 209

Query: 215 SNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
            N+  A+ A+ +MQ  E++GR I  + ++ +
Sbjct: 210 KNKTFAEKAIKEMQGKEIDGRPINCDMSTSK 240

>Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON}
           YGR159C (REAL)
          Length = 393

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 98/183 (53%), Gaps = 16/183 (8%)

Query: 80  ILYVGNLDKSINEETLKQYFQ-IGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFK 136
            ++VG L  SI++E LK+ F+ IGG IS  +VIN++  + S  Y +V++     A+ A +
Sbjct: 142 TIFVGRLSWSIDDEWLKKEFEHIGGVIS-ARVINERGTDRSRGYGYVDFENKSYAEKAIQ 200

Query: 137 NLNGKTIETKVLKINWAFQSQQT------------TSDESLFNLFVGDLNVDVDDETLGH 184
            + GK I+ + +  + +                  T  E    LF+G+L+ + D +T+  
Sbjct: 201 EMQGKEIDGRPINCDLSTSKPAGNNTNDRAKKFGDTPSEPSDTLFLGNLSFNADRDTIFE 260

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F++    V   +    +T + +G+G++ FS+ ED++ A++ +Q   ++ R +R++++S 
Sbjct: 261 LFAKHGEVVSVRIPTHPETEQPKGFGYVQFSSLEDSKKALESLQGEYIDNRPVRLDYSSP 320

Query: 245 REN 247
           R N
Sbjct: 321 RPN 323

>KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.61
           YGR159C
          Length = 412

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 94/178 (52%), Gaps = 13/178 (7%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           ++VG L  SI++E LK  F+  G +   +VI ++  + S  Y +V++     A+ A K +
Sbjct: 167 IFVGRLSWSIDDEWLKNEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKEYAEKAVKEM 226

Query: 139 NGKTIETKVLKINWAFQSQQTTSD-----------ESLFNLFVGDLNVDVDDETLGHAFS 187
           +GK I+ + +  + +       ++           E    LF+G+L+ + D + +   FS
Sbjct: 227 HGKEIDGREINCDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDNISEMFS 286

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           +F   V   +    +T + +G+G++ ++N EDA+ A+D +Q   ++ R +R+++++ R
Sbjct: 287 KFGEIVSVRIPTHPETEQPKGFGYVQYTNVEDAKKALDALQGEYIDNRPVRLDFSTPR 344

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 50/81 (61%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +FVG L+  +DDE L + F      + A V+++  T RSRGYG++ F N+E A+ A+ +M
Sbjct: 167 IFVGRLSWSIDDEWLKNEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKEYAEKAVKEM 226

Query: 228 QSTELNGRQIRINWASKRENA 248
              E++GR+I  + ++ +  A
Sbjct: 227 HGKEIDGREINCDMSTSKPAA 247

>Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 55/77 (71%)

Query: 163 ESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQT 222
           + L  LF+GDL+  V +ETL   F +FPSFV A V  D  T +S G+G+++F ++E+A+ 
Sbjct: 88  KKLIPLFIGDLHETVTEETLKGIFGKFPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAER 147

Query: 223 AMDKMQSTELNGRQIRI 239
           AM+++  T++NGR+IRI
Sbjct: 148 AMEELNYTDVNGREIRI 164

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 73/160 (45%), Gaps = 8/160 (5%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           L++G+L +++ EETLK  F       + KV  D     S+ + ++ +    +A+ A + L
Sbjct: 93  LFIGDLHETVTEETLKGIFGKFPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAERAMEEL 152

Query: 139 NGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETL-GHAFSEFPSFVQAHV 197
           N   +  + ++I     S + T+    F   V   N+ +++  L    F  + +F +   
Sbjct: 153 NYTDVNGREIRI---MPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVF--YDTFSRYGK 207

Query: 198 MWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
           +   +    +  GF+ F N++ A+  +    +T   G++I
Sbjct: 208 ILSCKLDSRKDIGFVYFENEKTARNVIKMYNNTSFFGKKI 247

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 72/177 (40%), Gaps = 5/177 (2%)

Query: 69  AINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQH 128
           A    + +S   +++ NL      + +  +F   GPI ++ + N       +AFV Y  +
Sbjct: 293 ASKNNQSSSQNSIFIKNLPIITTRDDVLNFFSEVGPIKSIYLSNATKVKYLWAFVTYKSN 352

Query: 129 HDADVAFKNLNGKTIETKVLKINWAFQSQQTTS---DESLFNLFVGDLNVDVDDETLGHA 185
            D++ A K  N      K L ++ A   ++       + +  LF+ +L+   + E L + 
Sbjct: 353 EDSEKAIKRYNNFYFRGKKLLVSRAQDKEERAKFIESQKMSTLFLENLSAVCNKEFLKYL 412

Query: 186 FSEFPSFVQAHVMWDMQTGRSRGY-GFISFSNQEDAQTAMDKMQSTELNGRQIRINW 241
             +  +     +  D     S  Y G I F N EDA    + + +  + G  +  +W
Sbjct: 413 CHQ-ENIRPFKIQIDGYNESSATYSGHIKFRNFEDATRIFNFLNNRLVGGSIVMTSW 468

>KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {ON}
           Anc_3.49 YOL123W
          Length = 479

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 86/173 (49%), Gaps = 20/173 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN--NSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    EETL+ YF   G ++++K++ D N   S  + F+ +      D   K  
Sbjct: 96  MFIGGLNWETTEETLRDYFNKYGHVTDLKIMKDSNTGRSRGFGFLTFEHPSSVDEVVKTQ 155

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        +S      +    +FVG +  DV  +     FS++ + + A
Sbjct: 156 HILDGKVIDPK--------RSIPREEQDKTGKIFVGGIGADVRPKEFEEFFSQYGNIIDA 207

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQST---ELNGRQIRINWASKR 245
            +M D  TGRSRG+GF+++    D+  A+D++  +   E  G+QI I  A  R
Sbjct: 208 QLMLDKDTGRSRGFGFVTY----DSPDAVDRVCQSKYIEFKGKQIEIKRAQPR 256

>NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON} 
          Length = 415

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 96/178 (53%), Gaps = 13/178 (7%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           ++VG L  SI++E LK+ F+  G + + +VI ++  + S  Y +V++     A+ A K +
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEM 223

Query: 139 NGKTIETKVLKINWAFQSQQTTSD-----------ESLFNLFVGDLNVDVDDETLGHAFS 187
            GK I+ + + ++ +       ++           E    LF+G+L+ + D + +   FS
Sbjct: 224 QGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELFS 283

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           ++   +   +    +T + +G+G++ ++N EDA+ A++ +Q   ++ R +R+++++ R
Sbjct: 284 KYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPVRLDYSTPR 341

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 49/81 (60%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +FVG L+  +DDE L   F      V A V+ +  T RSRGYG++ F ++  A+ A+ +M
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEM 223

Query: 228 QSTELNGRQIRINWASKRENA 248
           Q  E++GR+I ++ ++ +  A
Sbjct: 224 QGKEIDGREINVDMSTSKPAA 244

>TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {ON}
           Anc_4.61 YGR159C
          Length = 436

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 96/184 (52%), Gaps = 20/184 (10%)

Query: 81  LYVGNLDKSINEETLKQYF-QIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKN 137
           ++VG L  SI++E LK  F  IGG +S  +VI ++  + S  Y +V++     A+ A K 
Sbjct: 189 IFVGRLSWSIDDEWLKNEFDHIGGVVS-ARVIYERGTDRSRGYGYVDFEDKSYAEKAVKE 247

Query: 138 LNGKTIETKVLKINWAFQSQQTTSD--------------ESLFNLFVGDLNVDVDDETLG 183
           ++GK I+ +   IN    + +   +              E    LF+G+L+ + D + + 
Sbjct: 248 MHGKEIDGR--PINCDLSTSKPAGNPRDDRAKKFGDLPSEPSETLFLGNLSFNADRDNIY 305

Query: 184 HAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWAS 243
             FS+F   V   +    +T + +G+G++ + N +DA+ A+D +Q   ++ R +R+++++
Sbjct: 306 EMFSKFGEIVSVRIPTHPETEQPKGFGYVQYGNVDDAKKALDALQGEYIDNRPVRLDYST 365

Query: 244 KREN 247
            R N
Sbjct: 366 PRPN 369

>Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W
           (REAL)
          Length = 513

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 101/195 (51%), Gaps = 26/195 (13%)

Query: 76  TSDKILYVGNLDKSINEETLKQ-YFQIGGPISNVKVI-NDKNNSVN-----------YAF 122
           T+   LY+G+LD + ++ T++Q +  +G    NV+++ N+ +NS +           Y F
Sbjct: 41  TTGNQLYMGDLDPTWDKNTIRQIWTSLGEANVNVRMMWNNPSNSGSRPSVGPKNNQGYCF 100

Query: 123 VEYLQH-HDADVAFKNLNGKTIET---KVLKINWAFQSQQTT------SDESLFNLFVGD 172
           +++    H A+   KN  G  I     + LK+NWA  S             + +++FVGD
Sbjct: 101 IDFPSSTHAANALLKN--GMLIPNFPNRKLKLNWATSSYSNNINGANMKSGNSYSIFVGD 158

Query: 173 LNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTE 231
           L  +V +  L   F + + S   A ++ D  TG S+GYGF+ F+N ++ Q A+ +MQ   
Sbjct: 159 LAPNVTESQLFELFINRYASASHAKIVHDQVTGMSKGYGFVKFTNADEEQLALSEMQGVF 218

Query: 232 LNGRQIRINWASKRE 246
           LNGR I++   S ++
Sbjct: 219 LNGRAIKVGPTSGQQ 233

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    TE +L    Q FG I+  K    KG  F++Y     A   I  +  +P
Sbjct: 305 TTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAEAAIAGMQGFP 364

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 365 IANSRVRLSWGRS 377

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 69  AINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQH 128
           ++N   + ++  +++G L   + E+ L+ YFQ  G I  VK+   K       FV+Y+  
Sbjct: 295 SLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGK----GCGFVQYVDR 350

Query: 129 HDADVAFKNLNGKTIETKVLKINWAFQSQQT 159
             A+ A   + G  I    ++++W   ++QT
Sbjct: 351 LSAEAAIAGMQGFPIANSRVRLSWGRSAKQT 381

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+G L+  V ++ L   F  F + V   +         +G GF+ + ++  A+ A+  M
Sbjct: 307 VFIGGLSSLVTEDELRAYFQPFGTIVYVKIP------VGKGCGFVQYVDRLSAEAAIAGM 360

Query: 228 QSTELNGRQIRINWA 242
           Q   +   ++R++W 
Sbjct: 361 QGFPIANSRVRLSWG 375

>KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 73.2 bits (178), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 96/197 (48%), Gaps = 19/197 (9%)

Query: 60  DDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNS 117
           D S  VPAN +           YVGN+D  +++E L + F   GP++ ++   DK     
Sbjct: 2   DGSSTVPANTV-----------YVGNVDPKVSKELLYELFLQIGPVAKIRYPKDKVLQTH 50

Query: 118 VNYAFVEYLQHHDADVAFKNLNGKT-IETKVLKINWA-FQSQQTTSDESL---FNLFVGD 172
             +AFVE+    DA+ A K LN    +  + LK+  A   S   TS  +L     LF+ +
Sbjct: 51  QGFAFVEFNSPQDAEYASKCLNNTVRLYDRTLKVRKANGASSSPTSQNALDVGAKLFIKN 110

Query: 173 LNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTEL 232
           ++  VD E L   F +F S V+   ++ ++ G  R   +I +S  E +  A++K+ +  +
Sbjct: 111 IDELVDSEMLTKIFGKFGSLVRPPEIFTLKQGLLRC-AYICYSTFEHSDAALEKLNNQMV 169

Query: 233 NGRQIRINWASKRENAT 249
             + I I++A K  + T
Sbjct: 170 MNKCISIDYAYKEGSKT 186

>Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W
           (REAL)
          Length = 613

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 69/116 (59%), Gaps = 17/116 (14%)

Query: 124 EYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLG 183
           E+L+ +++  ++K+ N K  E+K                  L  LF+GDL+  V +ETL 
Sbjct: 66  EFLRINNSKSSYKDGNLKVFESK-----------------KLVPLFIGDLHETVTEETLK 108

Query: 184 HAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
             F ++PSFV A V  D  + +S G+G+++F ++E+A  AM+++  TE+NG++IRI
Sbjct: 109 DVFGKYPSFVSAKVCLDSVSKKSLGHGYLNFEDKEEAGKAMEELNYTEVNGKEIRI 164

 Score = 37.4 bits (85), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 77/178 (43%), Gaps = 7/178 (3%)

Query: 76  TSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAF 135
           +S   +++ NL      + +  +F   GPI ++ + N       +AFV Y    D++ A 
Sbjct: 300 SSQNSIFIKNLPVITTRDDILNFFSEVGPIKSIYLSNATKVKYLWAFVTYKSDDDSEKAI 359

Query: 136 KNLNGKTIETKVLKINWAFQSQQTTS---DESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
           K  N      K L ++ A   ++       + +  LF+ +L+   + E L +   +  + 
Sbjct: 360 KRYNNFYFRGKKLSVSRAQNKEERAKFIESQKMSTLFLENLSAVCNKEFLKYLCHQ-ENI 418

Query: 193 VQAHVMWDMQTGRSRGY-GFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKRENAT 249
               +  D  +  S  Y G+I F N E+A    + + +  + G  +  +W  +R+N+T
Sbjct: 419 RPFKIQIDGYSENSSAYSGYIKFKNFEEATRIFNFLNNRLVGGSIVTTSW--ERQNST 474

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 75/161 (46%), Gaps = 10/161 (6%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYLQHHDADVAFKNL 138
           L++G+L +++ EETLK  F       + KV  D     S+ + ++ +    +A  A + L
Sbjct: 93  LFIGDLHETVTEETLKDVFGKYPSFVSAKVCLDSVSKKSLGHGYLNFEDKEEAGKAMEEL 152

Query: 139 NGKTIETKVLKINWAFQSQQTTSDESLF--NLFVGDLNVDVDDETLGHAFSEFPSFVQAH 196
           N   +  K ++I     S + T+    F  N+F  +L ++ + +    AF  + +F +  
Sbjct: 153 NYTEVNGKEIRI---MPSLRNTTFRKNFGTNVFFSNLPLN-NPQLTTRAF--YDTFSRYG 206

Query: 197 VMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
            +   +    +  GF+ F +++ A+  +    +T   G++I
Sbjct: 207 KILSCKLDSRKDIGFVYFEDEKTARNVIKMYNNTNFFGKKI 247

>Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON}
           YGR159C (REAL)
          Length = 391

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 97/184 (52%), Gaps = 17/184 (9%)

Query: 80  ILYVGNLDKSINEETLKQYFQ-IGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFK 136
            ++VG L  SI++E LK+ F+ IGG IS  +VI ++  + S  Y +V++     A+ A +
Sbjct: 138 TIFVGRLSWSIDDEWLKKEFEHIGGVIS-ARVILERGTDRSRGYGYVDFENQSYAEKAIQ 196

Query: 137 NLNGKTIETKVLKINWAFQSQQ-------------TTSDESLFNLFVGDLNVDVDDETLG 183
            + GK I+ + +  + +                   T  E    LF+G+L+ + D +T+ 
Sbjct: 197 EMQGKEIDGRPINCDISTSKPAGNNNNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDTIF 256

Query: 184 HAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWAS 243
             F++    V   +    +T + +G+G++ ++N +DA+ A+D +Q   ++ R +R++++S
Sbjct: 257 EMFAKHGEVVSVRIPTHPETEQPKGFGYVQYTNLDDAKKALDALQGEYIDNRPVRLDYSS 316

Query: 244 KREN 247
            R N
Sbjct: 317 PRPN 320

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 50/91 (54%)

Query: 155 QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISF 214
           + Q+    +    +FVG L+  +DDE L   F      + A V+ +  T RSRGYG++ F
Sbjct: 126 KKQKNEESQEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVILERGTDRSRGYGYVDF 185

Query: 215 SNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
            NQ  A+ A+ +MQ  E++GR I  + ++ +
Sbjct: 186 ENQSYAEKAIQEMQGKEIDGRPINCDISTSK 216

>Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086W
           (REAL)
          Length = 541

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 106/214 (49%), Gaps = 35/214 (16%)

Query: 63  DVVPANAINGGRETSDKILYVGNLDKSINEETLKQYF-QIGGPISNVKVI---------- 111
           +V  A+ IN G  T+   LY+G+LD + ++ T+ Q +  +G    NV+++          
Sbjct: 43  NVQGASDINTG--TAGNQLYMGDLDPTWDKNTISQIWGSLGEANINVRMMWNNPSNSSSR 100

Query: 112 ---NDKNNSVNYAFVEYLQH-HDADVAFKNLNGKTIET---KVLKINWAFQSQQTTSDES 164
                KNN   Y FV++    H A+   KN  G  I +   K LK+NWA  S    ++  
Sbjct: 101 PSMGPKNNQ-GYCFVDFPSSTHAANALLKN--GMIIPSFPNKKLKLNWATSSYSNGNNGG 157

Query: 165 L-----------FNLFVGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFI 212
                       +++FVGDL  +V +  L   F + + S   A ++ D  TG S+GYGF+
Sbjct: 158 NNSISNSKSGNNYSIFVGDLAPNVTESQLFDLFITRYASAFHAKIVHDQVTGMSKGYGFV 217

Query: 213 SFSNQEDAQTAMDKMQSTELNGRQIRINWASKRE 246
            FSN ++ Q A+ +MQ   LNGR I++   S ++
Sbjct: 218 KFSNADEQQLALSEMQGVFLNGRAIKVGPTSGQQ 251

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    TE +L    Q FG I+  K    KG  F++Y     A   I  +  +P
Sbjct: 323 TTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAETAIAGMQGFP 382

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 383 IANSRVRLSWGRS 395

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 69  AINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQH 128
           ++N   + ++  +++G L   + E+ L+ YFQ  G I  VK+   K       FV+Y+  
Sbjct: 313 SLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGK----GCGFVQYVDR 368

Query: 129 HDADVAFKNLNGKTIETKVLKINWAFQSQQT 159
             A+ A   + G  I    ++++W   ++QT
Sbjct: 369 LSAETAIAGMQGFPIANSRVRLSWGRSAKQT 399

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+G L+  V ++ L   F  F + V   +         +G GF+ + ++  A+TA+  M
Sbjct: 325 VFIGGLSSLVTEDELRAYFQPFGTIVYVKIP------VGKGCGFVQYVDRLSAETAIAGM 378

Query: 228 QSTELNGRQIRINWA 242
           Q   +   ++R++W 
Sbjct: 379 QGFPIANSRVRLSWG 393

>YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA
           binding protein, component of the U1 snRNP protein;
           mutants are defective in meiotic recombination and in
           formation of viable spores, involved in the formation of
           DSBs through meiosis-specific splicing of REC107
           pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs
           of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA
           binding domains RRM2 and RRM3 are required for Nam8p
           meiotic function
          Length = 523

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 99/197 (50%), Gaps = 29/197 (14%)

Query: 76  TSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN--------------YA 121
           T+   LY+G+LD + ++ T++Q +   G  +N+ V    NN++N              Y 
Sbjct: 51  TTGNQLYMGDLDPTWDKNTVRQIWASLGE-ANINVRMMWNNTLNNGSRSSMGPKNNQGYC 109

Query: 122 FVEYLQH-HDADVAFKNLNGKTIET---KVLKINWAFQSQQTTSDESL-------FNLFV 170
           FV++    H A+   KN  G  I     K LK+NWA  S   +++           ++FV
Sbjct: 110 FVDFPSSTHAANALLKN--GMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFV 167

Query: 171 GDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQS 229
           GDL  +V +  L   F + + S   A ++ D  TG S+GYGF+ F+N ++ Q A+ +MQ 
Sbjct: 168 GDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQG 227

Query: 230 TELNGRQIRINWASKRE 246
             LNGR I++   S ++
Sbjct: 228 VFLNGRAIKVGPTSGQQ 244

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 45/91 (49%), Gaps = 4/91 (4%)

Query: 69  AINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQH 128
           ++N   + ++  +++G L   + E+ L+ YFQ  G I  VK+   K       FV+Y+  
Sbjct: 303 SLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGK----CCGFVQYVDR 358

Query: 129 HDADVAFKNLNGKTIETKVLKINWAFQSQQT 159
             A+ A   + G  I    ++++W   ++QT
Sbjct: 359 LSAEAAIAGMQGFPIANSRVRLSWGRSAKQT 389

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    TE +L    Q FG I+  K    K   F++Y     A   I  +  +P
Sbjct: 313 TTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAEAAIAGMQGFP 372

Query: 385 FQGRNLKTGWGKE 397
                ++  WG+ 
Sbjct: 373 IANSRVRLSWGRS 385

>NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON}
           Anc_1.357
          Length = 610

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 53/87 (60%), Gaps = 2/87 (2%)

Query: 155 QSQQTTSDES--LFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFI 212
           QS  +T  ES     LF+GDLN DV  ETL   F  +PSFV A V +D QT  S G+G++
Sbjct: 88  QSSHSTKLESKPFTALFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYL 147

Query: 213 SFSNQEDAQTAMDKMQSTELNGRQIRI 239
           +F ++EDA+ A+D     +L  + IRI
Sbjct: 148 NFGDKEDAEKAIDDFNCMKLGDKVIRI 174

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 78/159 (49%), Gaps = 5/159 (3%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYLQHHDADVAFKNL 138
           L++G+L++ + +ETL+  F +     + KV  D   N S+ + ++ +    DA+ A  + 
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 139 NGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVM 198
           N   +  KV++I  + + + T       N+F    N+  +D  L H+   F  F Q   +
Sbjct: 163 NCMKLGDKVIRIMPSLRGKNTKKSIGT-NVFFT--NLPDEDNRLFHSRKFFEIFRQFGKI 219

Query: 199 WDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
              +   ++  GFISF ++E A+T + K  ++   G +I
Sbjct: 220 LSCRLDPNKNIGFISFEHEEVAKTVVKKYNNSMFFGNRI 258

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 47/95 (49%)

Query: 65  VPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVE 124
           +P   +N      +  ++V NL  SI  E ++ +F   G I N+ + +  +++  +AFV+
Sbjct: 297 MPRALLNTNNLFIENTVFVSNLPTSITVEEIRNHFNKIGNIMNLFISDKISSNALWAFVK 356

Query: 125 YLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQT 159
           Y     A  A K LN   I  K + ++ AF+  +T
Sbjct: 357 YSTAACAIRAIKELNNTFIRKKQIVVSQAFRRGET 391

>AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR159C (NSR1)
          Length = 396

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 100/203 (49%), Gaps = 17/203 (8%)

Query: 57  AAEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK-- 114
           +AE + D V       G+  +   ++VG L  S+++E LK  F   G +   +VI ++  
Sbjct: 148 SAESEDDAVAKKQKTDGQPAT---IFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGT 204

Query: 115 NNSVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFN------- 167
           + S  Y +V++     A+ A K ++GK I+ + +  + +     +   E           
Sbjct: 205 DKSRGYGYVDFEDVSYAEKAVKEMHGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPS 264

Query: 168 -----LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQT 222
                LF+G+L+ + D + L   FS+  + +   +    ++ + +G+G++ + + E+AQ 
Sbjct: 265 QPSDTLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQA 324

Query: 223 AMDKMQSTELNGRQIRINWASKR 245
           A+D +Q   ++ R +RI+++S R
Sbjct: 325 ALDALQGEYIDNRPVRIDFSSPR 347

>Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {ON}
           complement(24646..26226) [1581 nt, 527 aa]
          Length = 526

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 85/175 (48%), Gaps = 20/175 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN--NSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    EETL+ YF   G +  +K++ D N   S  + F+ +      D   K  
Sbjct: 158 MFIGGLNWETTEETLRDYFNKYGKVVELKIMKDNNTGRSRGFGFLTFEDATSVDEVVKTQ 217

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        + Q  T       +FVG +  DV  +     F+++ + + A
Sbjct: 218 HILDGKVIDPKRA---IPREEQDKTG-----KIFVGGIGADVRPKEFEDFFAQYGTIIDA 269

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKREN 247
            +M D  TGRSRG+GF+++    D+  A+D++   +  E  G+QI I  A  R N
Sbjct: 270 QLMLDKDTGRSRGFGFVTY----DSPDAVDRVCQNKFIEFKGKQIEIKRAEPRTN 320

>TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {ON}
           Anc_3.49 YOL123W
          Length = 518

 Score = 72.8 bits (177), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 85/175 (48%), Gaps = 20/175 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN--NSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+TL+ YF   G +  +K++ D N   S  + F+ +      D   K  
Sbjct: 166 MFIGGLNWETTEDTLRDYFNKYGSVVELKIMKDNNTGRSRGFGFLTFENASSVDEVVKTQ 225

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        + Q  T       +FVG +  DV  +     F+++ + + A
Sbjct: 226 HILDGKVIDPKRA---IPREEQDKTG-----KIFVGGIGADVRPKEFEEFFAQYGTIIDA 277

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQST---ELNGRQIRINWASKREN 247
            +M D  TGRSRG+GF+++    D+  A+D++  +   E  G+QI I  A  R N
Sbjct: 278 QLMLDKDTGRSRGFGFVTY----DSPDAVDRVCQSKYIEFKGKQIEIKRAEPRNN 328

>Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to
           Ashbya gossypii ADL160W
          Length = 541

 Score = 72.8 bits (177), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 85/174 (48%), Gaps = 20/174 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ L++YF   G ++ VK++ D     S  + F+ +      D   K  
Sbjct: 173 MFIGGLNWETTEDNLREYFSKYGTVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 232

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        + Q  T       +FVG +  DV  +     FSE+ S + A
Sbjct: 233 HILDGKVIDPKRA---IPREEQDKTG-----KIFVGGIGPDVRPKEFEEFFSEWGSIIDA 284

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKRE 246
            +M D  TGRSRG+GFI++    D+  A+D++   +  E  G++I I  A  R+
Sbjct: 285 QLMLDKDTGRSRGFGFITY----DSPDAVDRVCQNKFIEFKGKRIEIKRAEPRQ 334

>Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii AAR151W
          Length = 586

 Score = 72.0 bits (175), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 100/247 (40%), Gaps = 60/247 (24%)

Query: 58  AEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNS 117
           AE      P+  I    E   + L++G+LD S +E T++Q +   G    VK+I  K N 
Sbjct: 2   AESQIPQPPSTTIQTSDE-PPRTLWMGDLDPSFDETTIQQIWMTLGHQVQVKLIRAKKNL 60

Query: 118 V--------------------------------------NYAFVEYLQHHDADVAFK--- 136
           +                                       Y FV++    +A    +   
Sbjct: 61  LIPCSTSSTLASSQHVEDERIQINGVSFIDPNTTQLHHAGYCFVQFPSLQEAQAGLQLNS 120

Query: 137 ----NLNGKTIETKV-------LKINWA----FQSQQTTSDESLFNLFVGDLNVDVDDET 181
               NL   T             ++NWA     QS   T+ E  F+LFVGDL+    +  
Sbjct: 121 TPLPNLISSTTHNPTNPTAKRNFRLNWASGATLQSDIPTTPE--FSLFVGDLSPTATEAH 178

Query: 182 LGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRIN 240
           L   F ++F S     VM D  TG SR +GF+ F+++++ + A+ +M      GRQ+R+ 
Sbjct: 179 LLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEQERRRALVEMNGIWCQGRQLRVA 238

Query: 241 WASKREN 247
           +A+ R N
Sbjct: 239 YATPRNN 245

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG + +  TE+ L  L   FG IL  K  P KG  F+K++    A   I  +  + 
Sbjct: 398 TTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGKGCGFVKFEHRLDAEAAIQGMQGFI 457

Query: 385 FQGRNLKTGWGK 396
                ++  WG+
Sbjct: 458 VGNSAIRLSWGR 469

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 4/84 (4%)

Query: 70  INGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHH 129
           + G  + S+  +++G L+  I E  L+  F   G I +VKV   K       FV++    
Sbjct: 389 VPGYTDPSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGK----GCGFVKFEHRL 444

Query: 130 DADVAFKNLNGKTIETKVLKINWA 153
           DA+ A + + G  +    ++++W 
Sbjct: 445 DAEAAIQGMQGFIVGNSAIRLSWG 468

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 161 SDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDA 220
           +D S   +F+G LN  + +  L   F  F + +   V         +G GF+ F ++ DA
Sbjct: 393 TDPSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKV------PPGKGCGFVKFEHRLDA 446

Query: 221 QTAMDKMQSTELNGRQIRINWA 242
           + A+  MQ   +    IR++W 
Sbjct: 447 EAAIQGMQGFIVGNSAIRLSWG 468

>ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL123W (HRP1)
          Length = 526

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 84/174 (48%), Gaps = 20/174 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ L++YF   G ++ VK++ D     S  + F+ +      D   K  
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 224

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        +S  T        +FV  +  DV  +     FS++ S + A
Sbjct: 225 HILDGKVIDPK--------ESDPTGRARKAGKIFVAGIGPDVRPKEFEEFFSQWGSIIDA 276

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKRE 246
            +M D  TGRSRG+GFI++    D+  A+D++   +  E  G++I I  A  R+
Sbjct: 277 QLMLDKDTGRSRGFGFITY----DSPDAVDRVCQNKFIEFKGKRIEIKRAEPRQ 326

>CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {ON}
           similar to uniprot|P27476 Saccharomyces cerevisiae
           YGR159c NSR1 nuclear localization sequence binding
           protein
          Length = 425

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 105/203 (51%), Gaps = 17/203 (8%)

Query: 57  AAEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK-- 114
           A +++ +  P  A   G   +   ++VG L  SI++E LKQ F+  G +   +V+ ++  
Sbjct: 157 AEDEEEESSPKKAKTDGEPAT---VFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGT 213

Query: 115 NNSVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQS---------QQTTSD--- 162
           + S  Y +V++     A+ A K ++GK I+ + + ++ +            Q+   D   
Sbjct: 214 DRSRGYGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPS 273

Query: 163 ESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQT 222
           E    LF+G+L+ + D + +   F +F   +   +    +T + +G+G++ +++ +DA+ 
Sbjct: 274 EPSDTLFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKK 333

Query: 223 AMDKMQSTELNGRQIRINWASKR 245
           A++ +Q   ++ R +R+++++ +
Sbjct: 334 ALEALQGEYIDNRPVRLDYSTPK 356

>KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {ON}
           Anc_6.104 YBR212W
          Length = 620

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 107/252 (42%), Gaps = 65/252 (25%)

Query: 55  GTAAEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK 114
           G   E +  + P   ++   E   + L++G+LD + +E T+K+ ++  G   ++K++  K
Sbjct: 14  GDKCEPEVPLPPFATVSTSDEPP-RTLWMGDLDPTFDELTIKEIWKRLGKNVSIKLVRAK 72

Query: 115 NN-------------------------SVN----------------YAFVEYLQHHDADV 133
            N                         ++N                Y F+E+    DA  
Sbjct: 73  KNLLIPCSSFTNNSGGNSKNETEESSITINGISFIDPMTTQLHHAGYCFIEFDSLKDAQF 132

Query: 134 AFKNLNGKTIET---------------KVLKINWA----FQSQQTTSDESLFNLFVGDLN 174
              +LN K I                 +  ++NWA     QS   T+ E  ++LFVGDL+
Sbjct: 133 GL-SLNSKPIPNFKSISTELETNPSGQRTFRLNWASGATLQSSIPTTPE--YSLFVGDLS 189

Query: 175 VDVDDETLGHAFSE-FPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELN 233
               +  L   F + F S     VM D  TG SR +GFI  S++ + + A+DKM  T L+
Sbjct: 190 PMTTEADLLKLFQKTFKSVKTVRVMTDPITGESRCFGFIRLSDEFEREEALDKMNGTLLH 249

Query: 234 GRQIRINWASKR 245
           GRQ+R+  A+ R
Sbjct: 250 GRQLRVALANPR 261

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +FVG+LN  + ++ L   F  F +  +  +         +  GF+ F N+ DA+ +M  +
Sbjct: 324 VFVGNLNCKITEDELQKVFEPFGAIEKVKI------PPGKKCGFVKFCNKIDAEASMYGL 377

Query: 228 QSTELNGRQIRINW 241
           Q   + G  IRI+W
Sbjct: 378 QGYFVAGSPIRISW 391

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 54/131 (41%), Gaps = 35/131 (26%)

Query: 59  EDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSV 118
           ED SD  P N            ++VGNL+  I E+ L++ F+  G I  VK+   K    
Sbjct: 312 EDHSDNDPTNTT----------VFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGK---- 357

Query: 119 NYAFVEYLQHHDADVAFKNLNGKTIETKVLKINW---------------------AFQSQ 157
              FV++    DA+ +   L G  +    ++I+W                     +F ++
Sbjct: 358 KCGFVKFCNKIDAEASMYGLQGYFVAGSPIRISWGRSRNSNSSGSANAINRPSESSFMNE 417

Query: 158 QTTSDESLFNL 168
            + SD S +NL
Sbjct: 418 NSQSDSSTYNL 428

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV++GN+    TE +L  + + FG I   K  P K   F+K+     A   +  L  Y 
Sbjct: 322 TTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGKKCGFVKFCNKIDAEASMYGLQGYF 381

Query: 385 FQGRNLKTGW 394
             G  ++  W
Sbjct: 382 VAGSPIRISW 391

>KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49
           YOL123W
          Length = 545

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 87/173 (50%), Gaps = 20/173 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ L++YF   G + ++K++ D N+  S  + F+ + +    D   K  
Sbjct: 159 MFIGGLNWETTEDGLREYFNKYGHVIDLKIMKDPNSGRSRGFGFLTFEEPSSVDEVVKTQ 218

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        +S      +    +FVG +  DV  +     FS++ + + A
Sbjct: 219 HILDGKVIDPK--------RSIPREEQDKTGKIFVGGIGADVRPKEFEEFFSQYGTIIDA 270

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKR 245
            +M D  TGRSRG+GF+++    D+  A+D++   +  +  G+QI I  A  R
Sbjct: 271 QLMLDKDTGRSRGFGFVTY----DSPEAVDRVCQNKYIDFKGKQIEIKRAEPR 319

>SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]
           {ON} some similarities with uniprot|Q754G3 Ashbya
           gossypii AFR107W AFR107Wp and some similarites with
           YGR159C uniprot|P27476 Saccharomyces cerevisiae YGR159C
           NSR1 Nucleolar protein that binds nuclear localization
           sequences required for pre-rRNA processing and ribosome
           biogenesis
          Length = 421

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 93/182 (51%), Gaps = 16/182 (8%)

Query: 81  LYVGNLDKSINEETLKQYF-QIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKN 137
           ++VG L  SI++E LK  F  IGG +S  +VI ++  + S  Y +V++   H A+ A K 
Sbjct: 175 IFVGRLSWSIDDEWLKTEFDHIGGVVS-ARVIYERGSDRSRGYGYVDFEDKHYAEKAVKE 233

Query: 138 LNGKTIETKVLKINWAFQSQQTTSDESLFN------------LFVGDLNVDVDDETLGHA 185
           ++GK I+ + +  + +         +                LF+G+L+ + D + L   
Sbjct: 234 MHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFEI 293

Query: 186 FSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           FS+    +   +    +T + +G+G++ + + +DA+ A + +Q   ++ R +R++++  R
Sbjct: 294 FSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPVRLDYSIPR 353

Query: 246 EN 247
           +N
Sbjct: 354 QN 355

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 47/82 (57%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +FVG L+  +DDE L   F      V A V+++  + RSRGYG++ F ++  A+ A+ +M
Sbjct: 175 IFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKEM 234

Query: 228 QSTELNGRQIRINWASKRENAT 249
              E++GR I  + ++ +  A 
Sbjct: 235 HGKEIDGRPINCDMSTSKPAAA 256

>CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 513

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 82/170 (48%), Gaps = 14/170 (8%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN--NSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ L++YF   G +  +K++ D N   S  + F+ +      D   K  
Sbjct: 132 MFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFDAPSSVDEVVKTQ 191

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        + Q  T       +FVG L  DV  +     FS++ + + A
Sbjct: 192 HILDGKVIDPKRA---IPREEQDKTG-----KIFVGGLGTDVRPKEFEEYFSQWGTIIDA 243

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
            +M D  TGRSRG+GF+++ +  DA   + + +  E  G+QI I  A  R
Sbjct: 244 QLMLDKDTGRSRGFGFVTY-DSPDAAEKVCESRYREFKGKQIEIKRAEPR 292

>KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weakly
           similar to uniprot|Q99383 Saccharomyces cerevisiae
           YOL123W HRP1 Subunit of cleavage factor I a five-subunit
           complex required for the cleavage and polyadenylation of
           pre-mRNA 3' ends RRM-containing heteronuclear RNA
           binding protein and hnRNPA/B family member that binds to
           poly (A) signal sequences
          Length = 570

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 83/174 (47%), Gaps = 20/174 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    EE L+ YF   G ++ VK++ D     S  + F+ +      D   K  
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        + Q  T       +FVG +  DV  +     FS++ S + A
Sbjct: 248 HILDGKVIDPKRA---IPREEQDKTG-----KIFVGGIGPDVRPKEFEEFFSQWGSIIDA 299

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKRE 246
            +M D  TGRSRG+GFI++    D   A+D++   +  E  G+QI I  A  R+
Sbjct: 300 QLMLDKDTGRSRGFGFITY----DTPDAVDRVCQNKFIEFKGKQIEIKRAEPRQ 349

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 76/162 (46%), Gaps = 27/162 (16%)

Query: 104 PISNVKVINDK---NNSVNYA--FVEYLQHHDADVAFKNLNGKTIETKVLKINWAF-QSQ 157
           P SN+   NDK   NN  NY+    E LQ          + G    +++ ++     Q Q
Sbjct: 111 PDSNLASNNDKAENNNKENYSASVPEMLQM----PQMPQMPGMPDMSQLQQLQQTMSQLQ 166

Query: 158 QTTS-----------DESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRS 206
           QT S              +  +F+G LN +  +E L   FS++ +  +  +M D  TGRS
Sbjct: 167 QTASQHEPKAIKADLSRDINKMFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRS 226

Query: 207 RGYGFISFSNQEDAQTAMDKMQSTE--LNGRQIRINWASKRE 246
           RG+GF++F N     +++D++  T+  L+G+ I    A  RE
Sbjct: 227 RGFGFLTFEN----ASSVDEVVKTQHILDGKVIDPKRAIPRE 264

>NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa]
           {ON} Anc_3.49
          Length = 552

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 87/175 (49%), Gaps = 20/175 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQHHDADVAFKN- 137
           L++G L+    EE LK YF   G + ++K++ D N+  S  + F+ +      D   K+ 
Sbjct: 231 LFIGGLNWETTEEKLKDYFSKYGNVVDLKIMKDANSGRSRGFGFLSFEHPSSVDEVVKSQ 290

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        + Q  T       +FVG +  DV  +     F+++ + + A
Sbjct: 291 HILDGKVIDPKRA---IPREEQDKTG-----KIFVGGIGPDVRPKEFEEFFAQWGTIIDA 342

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKREN 247
            +M D  TGRSRG+GFI++    D+  A+D++   +  +   +QI I  A+ R N
Sbjct: 343 QLMLDKDTGRSRGFGFITY----DSGEAVDRVCQNKYIQFKDKQIEIKRAAPRHN 393

>TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3.49
           YOL123W
          Length = 472

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 85/173 (49%), Gaps = 20/173 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ L+QYF   G + +VK++ D +N  S  + F+ +      D   K  
Sbjct: 152 MFIGGLNWDTTEDVLRQYFNKYGNVIDVKIMTDGHNGKSRGFGFLTFENSSSVDEVVKTQ 211

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        + Q  T       +FVG +  DV  +     FS++ S + A
Sbjct: 212 HILDGKVIDPKRA---IPREEQDKTG-----KIFVGGIGPDVRPKEFEEFFSQWGSIIDA 263

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQST---ELNGRQIRINWASKR 245
            +M D  TGRSRG+GF+++    D+  A+DK+      E  G+ I I  A +R
Sbjct: 264 QLMLDKDTGRSRGFGFVTY----DSPDAVDKVCQNKFIEFKGKTIEIKRAEQR 312

>SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 551

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 84/173 (48%), Gaps = 20/173 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ L+ YF   G ++++K++ D     S  + F+ + +    D   K  
Sbjct: 184 MFIGGLNWETTEDNLRDYFSKYGAVTDLKIMRDNATGRSRGFGFLTFAESSSVDEVVKTQ 243

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        + Q  T       +FVG +  DV  +     FS++ + + A
Sbjct: 244 HILDGKVIDPKRA---IPREEQDKTG-----KIFVGGIGPDVRPKEFEEFFSQYGTIIDA 295

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKR 245
            +M D  TGRSRG+GFI++    D   A+D++   +  E  G++I I  A  R
Sbjct: 296 QLMLDKDTGRSRGFGFITY----DTPDAVDRVCQNKFIEFKGKRIEIKRAEPR 344

>TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {ON}
           Anc_4.61 YGR159C
          Length = 416

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 94/180 (52%), Gaps = 15/180 (8%)

Query: 81  LYVGNLDKSINEETLKQYF-QIGGPI-SNVKVINDKNNSVNYAFVEYLQHHDADVAFKNL 138
           ++VG L  SI++E LK  F  IGG I + V +    + S  Y +V++     A+ A K +
Sbjct: 159 IFVGRLSWSIDDEWLKNEFDHIGGVIGARVMLERGTDRSRGYGYVDFSDKSYAEKAIKEM 218

Query: 139 NGKTIETKVLKINWAFQSQQTTSD-------------ESLFNLFVGDLNVDVDDETLGHA 185
           +GK I+ + +  + +      +++             E    LF+G+L+ + D +++   
Sbjct: 219 HGKEIDGREINCDMSTSKPAGSNNGADRAKKFGDIPSEPSETLFLGNLSFNADRDSIWEM 278

Query: 186 FSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           FS+F   V   +    +T + +G+G++ + N +DA+ A++ +Q   ++ R +R+++++ +
Sbjct: 279 FSKFGEIVSVRLPTHPETEQPKGFGYVQYGNIDDAKKALEALQGEYIDNRPVRLDYSTPK 338

>Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]
           {ON} YOL123W (HRP1) - putative
           polyadenylated-RNA-binding protein [contig 124] FULL
          Length = 597

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 20/173 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ LK YF   G ++++K++ D     S  + F+ + +    D   K  
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        + Q  T       +FVG +  DV  +     FS++ + + A
Sbjct: 271 HILDGKVIDPKRA---IPREEQDKTG-----KIFVGGIGPDVRPKEFEEFFSQWGTIIDA 322

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKR 245
            +M D  TGRSRG+GFI++    D   A+D++   +  E  G++I I  A  R
Sbjct: 323 QLMLDKDTGRSRGFGFITY----DTPDAVDRVCENKFIEFKGKRIEIKRAEPR 371

>NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.49
           YOL123W
          Length = 607

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 84/173 (48%), Gaps = 20/173 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ L+ YF   G +  +K++ D     S  + F+ +      D   K  
Sbjct: 199 MFIGGLNWETTEDGLRNYFNKYGNVIELKIMKDGATGRSRGFGFLTFEHPSSVDEVVKTQ 258

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        +S      + +  +FVG +  DV  +     F++F + + A
Sbjct: 259 HILDGKVIDPK--------RSIPKEEQDKIGKIFVGGIGTDVRPKEFEEFFAQFGTIIDA 310

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKR 245
            +M D  TGRSRG+GFI++    D+  A+DK+   +  +  G+QI +  A +R
Sbjct: 311 QLMLDKDTGRSRGFGFITY----DSADAVDKVCQNKYIDFKGKQIEVKRAQQR 359

>AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR023W
           (PES4) and YHR015W (MIP6)
          Length = 678

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 59/95 (62%), Gaps = 1/95 (1%)

Query: 145 TKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTG 204
           T ++K+  +  S   TS + L  LF+GDL+  V ++ L   F++F SFV A +  D  T 
Sbjct: 96  TDIVKLGRSKDSPTLTS-KKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTK 154

Query: 205 RSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           +S GYG+++FSN+EDA+  +++     + GR++RI
Sbjct: 155 KSLGYGYLNFSNEEDAERVIEEFNYIPIFGREVRI 189

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 2/77 (2%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+ +L ++ D + L   FS+        +     +  S  + FI+F    DAQ A+D +
Sbjct: 327 VFIKNLPLNPDSDLLLDYFSQIGPV--KSIFTSNVSKLSSAWAFITFQKGSDAQDAIDNL 384

Query: 228 QSTELNGRQIRINWASK 244
             ++L GR I ++ A K
Sbjct: 385 NHSQLLGRPIELSRAQK 401

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 42/82 (51%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNG 140
           +++ NL  + + + L  YF   GP+ ++   N    S  +AF+ + +  DA  A  NLN 
Sbjct: 327 VFIKNLPLNPDSDLLLDYFSQIGPVKSIFTSNVSKLSSAWAFITFQKGSDAQDAIDNLNH 386

Query: 141 KTIETKVLKINWAFQSQQTTSD 162
             +  + ++++ A ++ QT  D
Sbjct: 387 SQLLGRPIELSRAQKNFQTDID 408

>NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49
          Length = 581

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 83/175 (47%), Gaps = 20/175 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ LK YF   G +  +K++ D     S  + F+ +      D   K  
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        +S      +    +FVG +  DV  +     F+++ + + A
Sbjct: 258 HILDGKVIDPK--------RSIPREEQDKTGKIFVGGIGTDVRPKEFEDFFAQYGTIIDA 309

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKREN 247
            +M D  TGRSRG+GF+++    D+  A+D++   +  E  G+QI I  A  R N
Sbjct: 310 QLMLDKDTGRSRGFGFVTY----DSGDAVDRVCQNKYIEFKGKQIEIKRAEPRHN 360

>KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 588

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 20/173 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ LK YF   G ++++K++ D     S  + F+ + +    D   K  
Sbjct: 210 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 269

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        + Q  T       +FVG +  DV  +     FS++ + + A
Sbjct: 270 HILDGKVIDPKRA---IPREEQDKTG-----KIFVGGIGPDVRPKEFEEFFSQWGTIIDA 321

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKR 245
            +M D  TGRSRG+GFI++    D   A+D++   +  E  G++I I  A  R
Sbjct: 322 QLMLDKDTGRSRGFGFITY----DTPDAVDRVCENKFIEFKGKRIEIKRAEPR 370

>Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar to
           Ashbya gossypii AEL016C
          Length = 681

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 59/95 (62%), Gaps = 1/95 (1%)

Query: 145 TKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTG 204
           T ++K+  +  S   TS + L  LF+GDL+  V ++ L   F++F SFV A +  D  T 
Sbjct: 100 TDIVKLGRSKDSPTLTS-KKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTK 158

Query: 205 RSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           +S GYG+++FSN+EDA+  +++     + GR++RI
Sbjct: 159 KSLGYGYLNFSNEEDAERVIEEFNYIPIFGREVRI 193

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 72/168 (42%), Gaps = 19/168 (11%)

Query: 76  TSDKI--LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN--NSVNYAFVEYLQHHDA 131
           TS K+  L++G+LD+ + E+ L+  F       + K+  D N   S+ Y ++ +    DA
Sbjct: 115 TSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDA 174

Query: 132 DVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDL---NVDVDDETLGHAFSE 188
           +   +  N   I  + ++I  + ++     +    N+F  +L   N+ +       AF +
Sbjct: 175 ERVIEEFNYIPIFGREVRIMPSLRNSFYRKNIGT-NVFFSNLPLENLALTTRVFYDAFKK 233

Query: 189 FPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQ 236
           +   +   +       R +  GF+ F     A+ A+      E NG+Q
Sbjct: 234 YGKILSCKL------DRRKNIGFVYFEKDSSAKQAI-----AEYNGKQ 270

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 2/77 (2%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+ +L ++ D + L   FS+        +     +  +  + FI+F    DAQ A+D +
Sbjct: 331 VFIKNLPLNSDSDLLLDYFSQIGPV--KSIFTSNVSKLNSAWAFITFKKGSDAQDAIDSL 388

Query: 228 QSTELNGRQIRINWASK 244
             ++L GR I ++ A K
Sbjct: 389 NHSQLLGRTIELSRAQK 405

>KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 445

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 92/182 (50%), Gaps = 16/182 (8%)

Query: 81  LYVGNLDKSINEETLKQYFQ-IGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKN 137
           ++VG L  SI++E LK  F+ IGG IS  +V+ ++  + S  Y +V++     A+ A K 
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVIS-ARVMYERGTDRSRGYGYVDFEDKSYAEKAIKE 256

Query: 138 LNGKTIETKVLKINWAFQSQQTTS------------DESLFNLFVGDLNVDVDDETLGHA 185
           ++GK I+ + +  + +                     E    LF+G+L+ + D + L   
Sbjct: 257 MHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLYEI 316

Query: 186 FSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           F ++   V   +    +T + +G+G++ + + EDA  A + +Q   +N R +R++++  +
Sbjct: 317 FGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRPVRLDYSIPK 376

Query: 246 EN 247
           +N
Sbjct: 377 QN 378

>Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {ON}
           complement(46606..47919) [1314 nt, 438 aa]
          Length = 437

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 93/183 (50%), Gaps = 18/183 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           ++VG L  S+++E LK  F+  G +   +VI ++  + S  Y +V++     A+ A K +
Sbjct: 180 IFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSKSAAERAVKEM 239

Query: 139 NGKTIETKVLKINWAFQSQQTTS--------------DESLFNLFVGDLNVDVDDETLGH 184
           +GK I+ +  +IN    + +                  +    LF+G+L+ + D + +  
Sbjct: 240 HGKQIDGR--EINCDMSTSKPAGGNGGDRAKKFGDVPSQPSDTLFLGNLSFNADRDQIYE 297

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            FS+    +   +    +T + +G+G++ + N  DAQ+A+D +Q   ++ R +R+++++ 
Sbjct: 298 LFSKHGEIISVRLPTHPETEQPKGFGYVQYGNVNDAQSALDALQGEYIDNRPVRLDFSTP 357

Query: 245 REN 247
           + N
Sbjct: 358 KPN 360

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 53/88 (60%)

Query: 158 QTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQ 217
           + ++D     +FVG L+  VDDE L + F      + A V+++  T RSRGYG++ FS++
Sbjct: 170 EDSNDGETATIFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSK 229

Query: 218 EDAQTAMDKMQSTELNGRQIRINWASKR 245
             A+ A+ +M   +++GR+I  + ++ +
Sbjct: 230 SAAERAVKEMHGKQIDGREINCDMSTSK 257

>TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {ON}
           Anc_6.104 YBR212W
          Length = 617

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 66/147 (44%), Gaps = 17/147 (11%)

Query: 120 YAFVEYLQHHDADVAFK--------------NLNGKTIETKVLKINWAFQS--QQTTSDE 163
           Y FVE+    DA  A                NL       +  ++NWA  +  Q +    
Sbjct: 141 YCFVEFESQQDAQFALSLNSGPLPNIISRSTNLPTNPSGQRNFRLNWASGATLQSSIPSR 200

Query: 164 SLFNLFVGDLNVDVDDETLGHAFSE-FPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQT 222
             F+LFVGDL+    +  L   F + F S     VM D  TG SR +GF+ F N+E+ + 
Sbjct: 201 PEFSLFVGDLSPTATEADLLSLFQQKFRSVKTVRVMTDPITGASRCFGFVRFGNEEERRR 260

Query: 223 AMDKMQSTELNGRQIRINWASKRENAT 249
           A+ +M      GR +R+ +A+ R N T
Sbjct: 261 ALVEMNGVWCQGRCLRVAYATPRNNMT 287

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 2/77 (2%)

Query: 321 PLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNC-FIKYDTHEQAAVCIVV 379
           P   TTV+IG +     EA L  L   FG IL  K  P+  NC F+KY+    A   I  
Sbjct: 382 PPNNTTVFIGGLTPKINEAQLQALFSPFGNILTVK-IPQGKNCGFVKYENRIDAEAAIQG 440

Query: 380 LANYPFQGRNLKTGWGK 396
           +  +   G  ++  WG+
Sbjct: 441 MQGFIVGGNPVRLSWGR 457

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 156 SQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFS 215
           SQ  T+  +   +F+G L   +++  L   FS F + +   +       + +  GF+ + 
Sbjct: 376 SQAYTTPPNNTTVFIGGLTPKINEAQLQALFSPFGNILTVKI------PQGKNCGFVKYE 429

Query: 216 NQEDAQTAMDKMQSTELNGRQIRINWA 242
           N+ DA+ A+  MQ   + G  +R++W 
Sbjct: 430 NRIDAEAAIQGMQGFIVGGNPVRLSWG 456

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKN 137
           +  +++G L   INE  L+  F   G I  VK+   K    N  FV+Y    DA+ A + 
Sbjct: 385 NTTVFIGGLTPKINEAQLQALFSPFGNILTVKIPQGK----NCGFVKYENRIDAEAAIQG 440

Query: 138 LNGKTIETKVLKINWA 153
           + G  +    ++++W 
Sbjct: 441 MQGFIVGGNPVRLSWG 456

>TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa]
           {ON} Anc_3.49 YOL123W
          Length = 623

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 86/175 (49%), Gaps = 20/175 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN--NSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ L+ YF   G + ++K++ D N   S  + F+ + +    D   K  
Sbjct: 172 MFIGGLNWETTEDGLRDYFNKYGNVVDLKIMKDNNTGKSRGFGFLTFEKSSSVDEVVKTQ 231

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        + Q  T       +F+G +  DV  +     F+++ + + A
Sbjct: 232 HILDGKVIDPKRA---IPREEQDKTG-----KIFIGGIGADVRPKEFEEFFAKYGNIIDA 283

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKREN 247
            +M D  TGRSRG+GF+++    D+  A+D++   +  E  G+QI I  A  R N
Sbjct: 284 QLMLDKDTGRSRGFGFVTY----DSPDAVDRVCQHKFIEFKGKQIEIKRAQPRHN 334

>TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.49
           YOL123W
          Length = 547

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 86/173 (49%), Gaps = 20/173 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+TL+ YF   G + ++K++ D N   S  + F+ + +    D   K  
Sbjct: 159 MFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTFDEPSSVDEVVKTQ 218

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        + Q  T       +FVG +  DV  +     F+++ + + A
Sbjct: 219 HILDGKVIDPKRA---IPREEQDKTG-----KIFVGGIGADVRPKEFEEFFAQWGTIIDA 270

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKR 245
            +M D  TGRSRG+GF+++    D+  A+D++   +  +  G++I I  A  R
Sbjct: 271 QLMLDKDTGRSRGFGFVTY----DSPDAVDRVCQNKFIDFKGKKIEIKRAEPR 319

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 49/84 (58%), Gaps = 6/84 (7%)

Query: 165 LFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAM 224
           +  +F+G LN +  ++TL   FS++   +   +M D  TGRSRG+GF++F    D  +++
Sbjct: 156 ICKMFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTF----DEPSSV 211

Query: 225 DKMQSTE--LNGRQIRINWASKRE 246
           D++  T+  L+G+ I    A  RE
Sbjct: 212 DEVVKTQHILDGKVIDPKRAIPRE 235

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 50/119 (42%), Gaps = 11/119 (9%)

Query: 64  VVPANAINGGRETSDKI--LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN--NSVN 119
           + P  AI   RE  DK   ++VG +   +  +  +++F   G I + +++ DK+   S  
Sbjct: 226 IDPKRAIP--REEQDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDAQLMLDKDTGRSRG 283

Query: 120 YAFVEYLQHHDADVAFKN----LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLN 174
           + FV Y      D   +N      GK IE K  +     Q QQ   D S    F G  N
Sbjct: 284 FGFVTYDSPDAVDRVCQNKFIDFKGKKIEIKRAEPRH-MQKQQQGGDTSAAQGFPGMAN 341

>TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON}
           Anc_1.357 YHR015W
          Length = 665

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%)

Query: 159 TTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQE 218
           + +D++ F LF+G LN  V  E L   F +FPSF+ A V  DM+T +S GYG+++FSNQ 
Sbjct: 87  SLNDKNSFALFIGGLNQRVTKEMLKEEFKDFPSFISAKVCVDMKTKKSLGYGYLNFSNQN 146

Query: 219 DAQTAMDKMQSTELNG 234
           D    ++K     L G
Sbjct: 147 DILRLVEKYNYRSLFG 162

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 75/173 (43%), Gaps = 13/173 (7%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNV---KVINDKNNSVNYAFVEYLQHHDADVAFKN 137
           ++V NL     EE L  YF   GPI ++   KV   K+    ++ + Y  + DA+ A + 
Sbjct: 332 VFVKNLPLYSEEEELLDYFSSIGPIKSIFSSKVYRYKS---LWSIITYKNNEDANFALEK 388

Query: 138 LNGKTIETKVLKINWAFQSQQTTSDESLFNLFV--GDLNVDVDDETLGHAFSEFPSFVQA 195
            N    + K++ +  A Q++    +E   + F+   +L++      L H F +  SF+  
Sbjct: 389 FNETNYKDKIIYVTKA-QTKPKVIEEKKCDTFIKLSNLSILCSPPYLFHLFKQ--SFINI 445

Query: 196 HVMWDMQT-GRSRGY-GFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKRE 246
             +  + + G    Y  FI    ++DA      +    +   +I + W+S  E
Sbjct: 446 ESLQLVPSLGAPNTYEAFIRCPTKKDAIIIFQLLNRKLIGTDRISVGWSSVEE 498

>AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR212W (NGR1)
          Length = 481

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 93/226 (41%), Gaps = 60/226 (26%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSV-------------------- 118
           + L++G+LD S +E T++  +   G    VK+I  K N +                    
Sbjct: 22  RTLWMGDLDPSFDEATIQHVWLTVGHQVQVKLIRAKKNLLIPCSTSSTLSASHVDEERIQ 81

Query: 119 -----------------NYAFVEYLQHHDADVAFKNLNGKTIETKV-------------- 147
                             Y FV++    +A    + LN   +   V              
Sbjct: 82  INGVSFIDPNTTQLHHAGYCFVQFANLQEAQAGLQ-LNATPLPNVVSPTTRNPTNPTGKR 140

Query: 148 -LKINWA----FQSQQTTSDESLFNLFVGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDM 201
             ++NWA     QS    + E  F+LFVGDL+    +  L   F ++F S     VM D 
Sbjct: 141 NFRLNWASGATLQSDIPATPE--FSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDP 198

Query: 202 QTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKREN 247
            TG SR +GF+ F+++++ + A+ +M      GRQ+R+ +A+ R N
Sbjct: 199 ITGASRCFGFVRFADEKERRRALAEMNGVWCQGRQLRVAYATPRNN 244

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG + +  +E  L  L   FG IL  K  P +G  F++++    A   I  +  + 
Sbjct: 326 TTVFIGGLSNMISEGQLHALFMPFGNILSVKVPPGRGCGFVRFENRMDAEAAIQGMQGFI 385

Query: 385 FQGRNLKTGWGK 396
             G  ++  WG+
Sbjct: 386 VGGNAIRLSWGR 397

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 6/86 (6%)

Query: 157 QQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSN 216
           +Q  +D +   +F+G L+  + +  L   F  F + +   V         RG GF+ F N
Sbjct: 317 RQLPADTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKV------PPGRGCGFVRFEN 370

Query: 217 QEDAQTAMDKMQSTELNGRQIRINWA 242
           + DA+ A+  MQ   + G  IR++W 
Sbjct: 371 RMDAEAAIQGMQGFIVGGNAIRLSWG 396

 Score = 37.0 bits (84), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 37/79 (46%), Gaps = 4/79 (5%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVA 134
           +T++  +++G L   I+E  L   F   G I +VKV   +       FV +    DA+ A
Sbjct: 322 DTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKVPPGR----GCGFVRFENRMDAEAA 377

Query: 135 FKNLNGKTIETKVLKINWA 153
            + + G  +    ++++W 
Sbjct: 378 IQGMQGFIVGGNAIRLSWG 396

>NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa]
           {ON} Anc_3.49
          Length = 506

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 84/173 (48%), Gaps = 20/173 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKN- 137
           L++G L+    E+ LK YF   G + ++K++ D     S  + F+ +      D   K  
Sbjct: 195 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 254

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        + Q  T       +FVG +  DV  +     F+++ + + A
Sbjct: 255 HILDGKVIDPKRA---IPREEQDKTG-----KIFVGGIGPDVRPKEFEEFFAQWGTIIDA 306

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKR 245
            +M D  TGRSRG+GFI++    D+  A+D++   +  +  G+QI I  A+ R
Sbjct: 307 QLMLDKDTGRSRGFGFITY----DSSEAVDRVCQNKYIDFKGKQIEIKRAAPR 355

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 6/81 (7%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LF+G LN +  ++ L   FS++ + V   +M D  TGRSRG+GF++F    +  +++D++
Sbjct: 195 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTF----ELSSSVDEV 250

Query: 228 QSTE--LNGRQIRINWASKRE 246
             T+  L+G+ I    A  RE
Sbjct: 251 VKTQHILDGKVIDPKRAIPRE 271

>KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some
           similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 540

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 92/222 (41%), Gaps = 53/222 (23%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSV-------------------- 118
           + L++G+LD   +E  +   +Q  G    VK+I  K N++                    
Sbjct: 20  RTLWMGDLDPGFDELIIASIWQSLGKSVKVKLIKSKTNALVPINSTSIPNNASSNALEIN 79

Query: 119 ---------------NYAFVEYLQHHDADVAF-------KNLNGKTIETKV--------L 148
                           Y FVE+    DA  A         N++  T  +K          
Sbjct: 80  GVSFIDPNKTNLHHAGYCFVEFESFEDAQQALTLNATPIPNISCNTTASKRTNDDGKRKF 139

Query: 149 KINWAFQS--QQTTSDESLFNLFVGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGR 205
           ++NWA  +    T      F+LFVGDL+    +  L   F +++ S     VM D  TG 
Sbjct: 140 RLNWANGATLHSTILPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGA 199

Query: 206 SRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKREN 247
           SR +GF+ F+N+ + + A+ +M   +  GRQ+R+ +A+ R N
Sbjct: 200 SRCFGFVRFANETERRNALIEMNGVQFQGRQLRVAYATPRNN 241

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%)

Query: 313 VDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQ 372
           V++    A +  TTV++G +     E  L  L + FG I D K  P K   F+KY+   +
Sbjct: 433 VNNNAMNAGVSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLE 492

Query: 373 AAVCIVVLANYPFQGRNLKTGWGK 396
           A   I  L  +   G  ++  WG+
Sbjct: 493 AEAAINGLQGFIIMGSPIRLSWGR 516

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 6/86 (6%)

Query: 68  NAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQ 127
           NA+N G   S   ++VG L+ +INE  L + F+  G I++VK+   K       FV+Y +
Sbjct: 436 NAMNAG--VSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGK----QCGFVKYNE 489

Query: 128 HHDADVAFKNLNGKTIETKVLKINWA 153
             +A+ A   L G  I    ++++W 
Sbjct: 490 RLEAEAAINGLQGFIIMGSPIRLSWG 515

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +FVG LN ++++  L   F  F +        D++    +  GF+ ++ + +A+ A++ +
Sbjct: 447 VFVGGLNPNINELQLFELFKPFGTIT------DVKIPPGKQCGFVKYNERLEAEAAINGL 500

Query: 228 QSTELNGRQIRINWA 242
           Q   + G  IR++W 
Sbjct: 501 QGFIIMGSPIRLSWG 515

>ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {ON}
           weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 543

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 95/200 (47%), Gaps = 20/200 (10%)

Query: 54  VGTAAEDDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVIND 113
           +G+   ++S +   NA+          +++G L+    E+TL+ YF   G + ++K++ D
Sbjct: 134 IGSQMSENSALAANNAVKADLSRDICKMFIGGLNWETTEDTLRDYFSKYGRVIDLKIMKD 193

Query: 114 KN--NSVNYAFVEYLQHHDADVAFKN---LNGKTIETKVLKINWAFQSQQTTSDESLFNL 168
            N   S  + F+ +      D   K    L+GK I+ K        + Q  T       +
Sbjct: 194 TNTGRSRGFGFLTFDSSSSVDEVVKTQHILDGKVIDPKRA---IPREEQDKTG-----KI 245

Query: 169 FVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM- 227
           FVG +  DV  +     F+++ + + A +M D  TGRSRG+GF+++    D+  A+D++ 
Sbjct: 246 FVGGIGADVRPKEFEEFFAQWGTIIDAQLMLDKDTGRSRGFGFVTY----DSPDAVDRVC 301

Query: 228 --QSTELNGRQIRINWASKR 245
             +  +  G++I I  A  R
Sbjct: 302 QNKFIDFKGKKIEIKRAEPR 321

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 50/84 (59%), Gaps = 6/84 (7%)

Query: 165 LFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAM 224
           +  +F+G LN +  ++TL   FS++   +   +M D  TGRSRG+GF++F    D+ +++
Sbjct: 158 ICKMFIGGLNWETTEDTLRDYFSKYGRVIDLKIMKDTNTGRSRGFGFLTF----DSSSSV 213

Query: 225 DKMQSTE--LNGRQIRINWASKRE 246
           D++  T+  L+G+ I    A  RE
Sbjct: 214 DEVVKTQHILDGKVIDPKRAIPRE 237

>Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W
           (REAL)
          Length = 664

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 69/147 (46%), Gaps = 21/147 (14%)

Query: 120 YAFVEYLQHHDADVAFK------------NLNGKTIET--KVLKINWA----FQSQQTTS 161
           Y FVE+    DA  A                N +T  T  +  ++NWA     QS   ++
Sbjct: 129 YCFVEFETQKDAQFALSLNATPLPNFYSPTTNAQTNPTFKRTFRLNWASGATLQSSIPST 188

Query: 162 DESLFNLFVGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDA 220
            E  F+LFVGDL+    +  L   F + F S     VM D  TG SR +GF+ F N+++ 
Sbjct: 189 PE--FSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDER 246

Query: 221 QTAMDKMQSTELNGRQIRINWASKREN 247
           + A+ +M      GR +R+ +A+ R N
Sbjct: 247 RRALIEMSGKWFQGRALRVAYATPRNN 273

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 48/94 (51%), Gaps = 6/94 (6%)

Query: 63  DVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAF 122
           + +P+N  N   + ++  ++VG L     E  L+  F+  GPI NV++ N K    N  F
Sbjct: 345 EFLPSNTYNS--DPTNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRIPNGK----NCGF 398

Query: 123 VEYLQHHDADVAFKNLNGKTIETKVLKINWAFQS 156
           V++ +  DA+ + + L G  +    ++++W   S
Sbjct: 399 VKFEKRIDAEASIQGLQGFIVGGSPIRLSWGRPS 432

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 2/76 (2%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNC-FIKYDTHEQAAVCIVVLANY 383
           TTV++G +     E  L  L + FG IL+ +  P   NC F+K++    A   I  L  +
Sbjct: 359 TTVFVGGLVPKTAEFQLRSLFKPFGPILNVRI-PNGKNCGFVKFEKRIDAEASIQGLQGF 417

Query: 384 PFQGRNLKTGWGKEKA 399
              G  ++  WG+  +
Sbjct: 418 IVGGSPIRLSWGRPSS 433

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 38/95 (40%), Gaps = 6/95 (6%)

Query: 148 LKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSR 207
           ++ N    S    SD +   +FVG L     +  L   F  F   +   +         +
Sbjct: 341 VRANEFLPSNTYNSDPTNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRI------PNGK 394

Query: 208 GYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWA 242
             GF+ F  + DA+ ++  +Q   + G  IR++W 
Sbjct: 395 NCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 429

>SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 672

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 49/79 (62%)

Query: 161 SDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDA 220
           S + L  LF+GDL+  V ++ L   F+++PS V   +  D  + RS GYG+I+FSN EDA
Sbjct: 97  SSKRLVALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDA 156

Query: 221 QTAMDKMQSTELNGRQIRI 239
           + A ++     L G+++RI
Sbjct: 157 EKATEEFNYVPLFGKEVRI 175

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 83/192 (43%), Gaps = 9/192 (4%)

Query: 60  DDSDVVPANAINGGRETSDK---ILYVGNLDKSINEETLKQYFQIGGPISNVKVIND--K 114
           D +D+V  + +      S K    L++G+LD+ + E+ L+  F     + +VK+  D   
Sbjct: 80  DGTDIVKLDKLKDSLYLSSKRLVALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAIS 139

Query: 115 NNSVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLN 174
             S+ Y ++ +    DA+ A +  N   +  K ++I  + ++     +    N+F  +L 
Sbjct: 140 KRSLGYGYINFSNDEDAEKATEEFNYVPLFGKEVRIMPSLRNSFYRKNIGT-NVFFSNLP 198

Query: 175 VDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNG 234
           ++ +      AF  + +F +   +   +  R +  GFI F     A++A+D     E  G
Sbjct: 199 LE-NLSLTTRAF--YDTFKKYGKILSCKLDRRKNIGFIYFDKDTSAKSAIDDFNGKEYYG 255

Query: 235 RQIRINWASKRE 246
             I       RE
Sbjct: 256 NNIMCGIHFDRE 267

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 43/82 (52%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNG 140
           ++V NL  + NE+ +  +F   GP+ +V        + ++AFV Y +  D   A + LNG
Sbjct: 314 IFVKNLPVNANEDDILDFFSRIGPVKSVFTSKVPKYNSSWAFVTYKKGSDTSEAIEKLNG 373

Query: 141 KTIETKVLKINWAFQSQQTTSD 162
           +  + + +++  A ++ Q  S+
Sbjct: 374 EIFKHRKIEVARAQKNFQHPSN 395

>ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR319W (HSH49)
          Length = 204

 Score = 63.9 bits (154), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 88/178 (49%), Gaps = 5/178 (2%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYLQHHDAD 132
           + ++  +YVGNLD  +++E L + F    P+S ++   D  K     +AFVE     D D
Sbjct: 3   QNTECTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCD 62

Query: 133 VAFKNLNGK-TIETKVLKINWAFQSQQTTSDE-SLFNLFVGDLNVDVDDETLGHAFSEFP 190
            A K+LN   ++  KVLK+    ++ + ++   +   LFV +L+  +D   L   F +F 
Sbjct: 63  FAIKSLNNTVSLFGKVLKVRRTLENAKNSAPVFARAKLFVKNLDSTIDAVQLQKLFGKFG 122

Query: 191 SFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKRENA 248
              +   ++ ++ G  R   ++ F+    +  A++K+ +  +  + I I++A K   A
Sbjct: 123 PLAKPPQLFTLKDGALRC-AYVYFTTFRHSDEALEKLNNQIVANQIISIDYAFKEGKA 179

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 68  NAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISN-VKVINDKNNSVNYAFVEYL 126
           NA N     +   L+V NLD +I+   L++ F   GP++   ++   K+ ++  A+V + 
Sbjct: 87  NAKNSAPVFARAKLFVKNLDSTIDAVQLQKLFGKFGPLAKPPQLFTLKDGALRCAYVYFT 146

Query: 127 QHHDADVAFKNLNGKTIETKVLKINWAFQ 155
               +D A + LN + +  +++ I++AF+
Sbjct: 147 TFRHSDEALEKLNNQIVANQIISIDYAFK 175

>Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W
           (REAL)
          Length = 663

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 69/147 (46%), Gaps = 21/147 (14%)

Query: 120 YAFVEYLQHHDADVAFK------------NLNGKTIET--KVLKINWA----FQSQQTTS 161
           Y FVE+    DA  A                N +T  T  +  ++NWA     QS   ++
Sbjct: 129 YCFVEFETQKDAQFALSLNATPLPNFYSPTTNSQTNSTFKRTFRLNWASGATLQSSIPST 188

Query: 162 DESLFNLFVGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDA 220
            E  F+LFVGDL+    +  L   F + F S     VM D  TG SR +GF+ F N+++ 
Sbjct: 189 PE--FSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDER 246

Query: 221 QTAMDKMQSTELNGRQIRINWASKREN 247
           + A+ +M      GR +R+ +A+ R N
Sbjct: 247 RRALIEMSGKWFQGRALRVAYATPRNN 273

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 48/94 (51%), Gaps = 6/94 (6%)

Query: 63  DVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAF 122
           + +P++  N   + ++  ++VG L     E  L+  F+  GPI NV++ N K    N  F
Sbjct: 342 EFLPSHTYN--TDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGK----NCGF 395

Query: 123 VEYLQHHDADVAFKNLNGKTIETKVLKINWAFQS 156
           V++ +  DA+ + + L G  +    ++++W   S
Sbjct: 396 VKFEKRIDAEASIQGLQGFIVGGSPIRLSWGRPS 429

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 2/76 (2%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNC-FIKYDTHEQAAVCIVVLANY 383
           TTV++G +    TE  L  L + FG IL+ +  P   NC F+K++    A   I  L  +
Sbjct: 356 TTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI-PNGKNCGFVKFEKRIDAEASIQGLQGF 414

Query: 384 PFQGRNLKTGWGKEKA 399
              G  ++  WG+  +
Sbjct: 415 IVGGSPIRLSWGRPSS 430

>Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W
           (REAL)
          Length = 736

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 69/147 (46%), Gaps = 21/147 (14%)

Query: 120 YAFVEYLQHHDADVAFK------------NLNGKTIET--KVLKINWA----FQSQQTTS 161
           Y FVE+    DA  A                N +T  T  +  ++NWA     QS   ++
Sbjct: 129 YCFVEFETQTDAQFALSLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIPST 188

Query: 162 DESLFNLFVGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDA 220
            E  F+LFVGDL+    +  L   F + F S     VM D  TG SR +GF+ F N+++ 
Sbjct: 189 PE--FSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNEDER 246

Query: 221 QTAMDKMQSTELNGRQIRINWASKREN 247
           + A+ +M      GR +R+ +A+ R N
Sbjct: 247 RRALIEMSGKWFQGRALRVAYATPRNN 273

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 6/97 (6%)

Query: 63  DVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAF 122
           + +P+N  N   + ++  ++VG L     E  L+  F+  GPI NV++ N K    N  F
Sbjct: 345 ESLPSNTFN--TDPTNTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRIPNGK----NCGF 398

Query: 123 VEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQT 159
           V++ +  DA+ + + L G  +    ++++W   S  +
Sbjct: 399 VKFEKRIDAEASIQGLQGFIVGGSPIRLSWGRPSSSS 435

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 2/76 (2%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNC-FIKYDTHEQAAVCIVVLANY 383
           TTV++G +    TE  L  L + FG IL+ +  P   NC F+K++    A   I  L  +
Sbjct: 359 TTVFVGGLGPKTTEFQLRSLFKPFGPILNVRI-PNGKNCGFVKFEKRIDAEASIQGLQGF 417

Query: 384 PFQGRNLKTGWGKEKA 399
              G  ++  WG+  +
Sbjct: 418 IVGGSPIRLSWGRPSS 433

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/95 (21%), Positives = 39/95 (41%), Gaps = 6/95 (6%)

Query: 148 LKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSR 207
           ++ N +  S    +D +   +FVG L     +  L   F  F   +   +         +
Sbjct: 341 MRQNESLPSNTFNTDPTNTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRI------PNGK 394

Query: 208 GYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWA 242
             GF+ F  + DA+ ++  +Q   + G  IR++W 
Sbjct: 395 NCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 429

>TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {ON}
           Anc_1.357 YHR015W
          Length = 713

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 47/72 (65%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           L++GDL  DV +  L   F+ + SFV A +  D +TG S GYG+++ SN+E+A + +++ 
Sbjct: 154 LYIGDLGKDVTEGMLNSIFNSYNSFVSAKICIDSKTGESLGYGYLNLSNREEAYSLLERY 213

Query: 228 QSTELNGRQIRI 239
             T + GR++RI
Sbjct: 214 NYTNIFGREVRI 225

>CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some
           similarities with uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 452

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 82/173 (47%), Gaps = 20/173 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ L+ YF   G +  +K++ D     S  + F+ +      D   K  
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVVKTQ 183

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        + Q  T       +FVG +  DV  +     F+++ + + A
Sbjct: 184 HILDGKVIDPKRA---IPREEQDKTG-----KIFVGGIGPDVRPKEFEEFFAQWGTIIDA 235

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKR 245
            +M D  TGRSRG+GFI++    D   A+DK+   +  +  GR+I I  A+ R
Sbjct: 236 QLMLDKDTGRSRGFGFITY----DTPDAVDKVCQNKFIDFKGRKIEIKRAAPR 284

>Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON}
           similar to Ashbya gossypii ABL059W
          Length = 204

 Score = 63.2 bits (152), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 85/172 (49%), Gaps = 5/172 (2%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           +YVGNLD  + +E L + F   GP+  ++   DK       +AFVE+  + D + A K+L
Sbjct: 9   IYVGNLDGQVTKEHLYELFVQMGPVYRIRYRKDKITQEYQGFAFVEFYTNSDCEFAIKSL 68

Query: 139 NGK-TIETKVLKINWAFQSQQTTSDE-SLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAH 196
           N   ++  K+LK+    ++        S   LFV +L+  VD + L   F +F   V+  
Sbjct: 69  NNSVSLFGKILKVRRTLENTHYGGPLISGAKLFVKNLDDSVDFQQLQKLFGKFGPLVKQP 128

Query: 197 VMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKRENA 248
            ++ ++ G  +   +I +S  + +  A+ K+    L  R I I++A K  N+
Sbjct: 129 EIFTLKNGTLKC-AYIYYSTFKHSDEALQKLNKQILANRVISIDYAFKDGNS 179

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 68  NAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGP-ISNVKVINDKNNSVNYAFVEYL 126
           N   GG   S   L+V NLD S++ + L++ F   GP +   ++   KN ++  A++ Y 
Sbjct: 87  NTHYGGPLISGAKLFVKNLDDSVDFQQLQKLFGKFGPLVKQPEIFTLKNGTLKCAYIYYS 146

Query: 127 QHHDADVAFKNLNGKTIETKVLKINWAFQ 155
               +D A + LN + +  +V+ I++AF+
Sbjct: 147 TFKHSDEALQKLNKQILANRVISIDYAFK 175

>KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some
           similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre- rRNA
           processing and ribosome biogenesis
          Length = 505

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 98/181 (54%), Gaps = 16/181 (8%)

Query: 80  ILYVGNLDKSINEETLKQYFQ-IGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFK 136
            ++VG L  S+++E LK  F+ IGG IS  +VI ++  + S  Y +V++     A+ A K
Sbjct: 257 TIFVGRLSWSVDDEWLKTEFEPIGGVIS-ARVIMERGTDRSRGYGYVDFENKFYAEKAVK 315

Query: 137 NLNGKTIETKVLKINWAF----------QSQQ--TTSDESLFNLFVGDLNVDVDDETLGH 184
            ++GK I+ + +  + +           +++Q   T  +    LF+G+L+ + D + +  
Sbjct: 316 EMHGKEIDGRPINCDMSTSKPAGNPRNDRAKQFGDTPSQPSDTLFLGNLSFNADRDNIFE 375

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F+E    V   +    +T + +G+G++ +S+ ++AQ A + +Q   ++ R +R+++++ 
Sbjct: 376 TFAEHGEVVSVRLPTHPETNQPKGFGYVQYSSVDEAQKAFEALQGHYIDNRPVRLDFSTP 435

Query: 245 R 245
           +
Sbjct: 436 K 436

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 49/88 (55%)

Query: 158 QTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQ 217
           +T S+     +FVG L+  VDDE L   F      + A V+ +  T RSRGYG++ F N+
Sbjct: 248 KTESNGEPATIFVGRLSWSVDDEWLKTEFEPIGGVISARVIMERGTDRSRGYGYVDFENK 307

Query: 218 EDAQTAMDKMQSTELNGRQIRINWASKR 245
             A+ A+ +M   E++GR I  + ++ +
Sbjct: 308 FYAEKAVKEMHGKEIDGRPINCDMSTSK 335

>NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON}
           Anc_1.357
          Length = 464

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 66/115 (57%), Gaps = 13/115 (11%)

Query: 127 QHHDADVAFKNLNGKTI--ETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGH 184
           Q   +D+   NL G+T   E K +KI    +S +T      F+LF+GDL+  V  E L +
Sbjct: 21  QSEGSDIV--NLYGQTTNYEGKKIKI---LESGET------FSLFIGDLHPKVTQEILEN 69

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
            F ++PSF+ A V +D +T  S G+G+++FS++ D++ A+D    T L    IR+
Sbjct: 70  IFGKYPSFLSAKVCYDFKTKVSLGHGYLNFSSERDSKQAIDDFNCTRLFDSVIRL 124

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 76/168 (45%), Gaps = 10/168 (5%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQHHDADVAFKNL 138
           L++G+L   + +E L+  F       + KV  D     S+ + ++ +    D+  A  + 
Sbjct: 53  LFIGDLHPKVTQEILENIFGKYPSFLSAKVCYDFKTKVSLGHGYLNFSSERDSKQAIDDF 112

Query: 139 NGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSE---FPSFVQA 195
           N   +   V+++  +F+ +     +S +NLF  +L  +VDD   G +F+    +  F + 
Sbjct: 113 NCTRLFDSVIRLMPSFRGKNI--KKSNYNLFFSNL-PEVDDT--GQSFTPRRFYELFREC 167

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWAS 243
             +   +   ++  GFISF ++  A+  +    +  L G+QI     S
Sbjct: 168 GEIISCKFEENKNIGFISFQSENVAREVIINYNNKFLFGKQITCKLLS 215

>Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W
           (PES4) - poly(A) binding protein; related to PES4
           protein homolog YHR015w [contig 89] FULL
          Length = 560

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 52/89 (58%), Gaps = 6/89 (6%)

Query: 151 NWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYG 210
           N    SQ+ +S      LF+GDL+ +V ++ L   F  FPS +   +  D +TG S GYG
Sbjct: 6   NPCVTSQKVSS------LFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYG 59

Query: 211 FISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           +++F + +DA+TA++      L GR++RI
Sbjct: 60  YLNFYSSKDAETAIETFSYVNLFGREVRI 88

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 74/168 (44%), Gaps = 18/168 (10%)

Query: 76  TSDKI--LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQHHDA 131
           TS K+  L++G+LD ++ E+ L   F++   + +VK+  D     S+ Y ++ +    DA
Sbjct: 10  TSQKVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDA 69

Query: 132 DVA-----FKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAF 186
           + A     + NL G+ +       N  F+    T      N+F  +L ++    T    F
Sbjct: 70  ETAIETFSYVNLFGREVRIMPSMRNSYFRKNIGT------NVFFSNLPLEQPALT-TRVF 122

Query: 187 SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNG 234
            E  +F +   +   +  R +  GF+ F +   A+ A+    + E  G
Sbjct: 123 YE--TFREYGKVLSCKLDRRKNIGFVYFESDAAARKAIASYNNKEYYG 168

 Score = 37.7 bits (86), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 74/191 (38%), Gaps = 31/191 (16%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNG 140
           ++V NL  +I  E L  YF   GP+ +V     +    ++ FV Y +  D   A  +LNG
Sbjct: 227 IHVKNLPFNICNEDLLNYFSRIGPVKSVFTSKLEAYRSSWGFVTYKKGCDTRKALDSLNG 286

Query: 141 KTIETKVLKINWA-----------------------FQSQQTTSDESLFN------LFVG 171
                + L++N A                       F+S    S  SL +      LF+ 
Sbjct: 287 AIFMDRRLEVNKALKNNGDRRDGTVSKNRRAYNDQNFRSSDENSISSLLSNGYRQTLFLS 346

Query: 172 DLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGY-GFISFSNQEDAQTAMDKMQST 230
           DL++  +D+ LG             ++ D        Y G+I   ++ DA    + + + 
Sbjct: 347 DLSLVCNDKFLGE-LCRAEKINYHKIVVDHYDEECLTYSGYIVCKSRPDANRLFEVLNNK 405

Query: 231 ELNGRQIRINW 241
            +    +R++W
Sbjct: 406 LIGDSIVRVSW 416

>YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA
           binding protein that negatively regulates growth rate;
           interacts with the 3' UTR of the mitochondrial porin
           (POR1) mRNA and enhances its degradation; overexpression
           impairs mitochondrial function; interacts with Dhh1p to
           mediate POR1 mRNA decay; expressed in stationary phase
          Length = 672

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 69/147 (46%), Gaps = 21/147 (14%)

Query: 120 YAFVEYLQHHDADVAFK------------NLNGKTIET--KVLKINWA----FQSQQTTS 161
           Y FVE+    DA  A                N +T  T  +  ++NWA     QS   ++
Sbjct: 130 YCFVEFETQKDAKFALSLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIPST 189

Query: 162 DESLFNLFVGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDA 220
            E  F+LFVGDL+    +  L   F + F S     VM D  TG SR +GF+ F ++++ 
Sbjct: 190 PE--FSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDER 247

Query: 221 QTAMDKMQSTELNGRQIRINWASKREN 247
           + A+ +M      GR +R+ +A+ R N
Sbjct: 248 RRALIEMSGKWFQGRALRVAYATPRNN 274

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 6/102 (5%)

Query: 63  DVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAF 122
           D +P+N  N   + ++  ++VG L     E  L+  F+  GPI NV++ N K    N  F
Sbjct: 346 DSLPSNTYN--TDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGK----NCGF 399

Query: 123 VEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDES 164
           V++ +  DA+ + + L G  +    ++++W   S       S
Sbjct: 400 VKFEKRIDAEASIQGLQGFIVGGSPIRLSWGRPSSSNAKTNS 441

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 2/76 (2%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNC-FIKYDTHEQAAVCIVVLANY 383
           TTV++G +    TE  L  L + FG IL+ +  P   NC F+K++    A   I  L  +
Sbjct: 360 TTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI-PNGKNCGFVKFEKRIDAEASIQGLQGF 418

Query: 384 PFQGRNLKTGWGKEKA 399
              G  ++  WG+  +
Sbjct: 419 IVGGSPIRLSWGRPSS 434

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/95 (21%), Positives = 40/95 (42%), Gaps = 6/95 (6%)

Query: 148 LKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSR 207
           +++N +  S    +D +   +FVG L     +  L   F  F   +   +         +
Sbjct: 342 MRVNDSLPSNTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI------PNGK 395

Query: 208 GYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWA 242
             GF+ F  + DA+ ++  +Q   + G  IR++W 
Sbjct: 396 NCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 430

>SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {ON}
           weakly similar to uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 490

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 95/233 (40%), Gaps = 67/233 (28%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSV-------------------- 118
           + L++G+LD + +E +++Q +   G   +VK+I  K N +                    
Sbjct: 29  RTLWMGDLDPAFDESSIQQIWAALGKSVSVKLIRAKKNLLIPCSTSSTFNAGEDASTAQL 88

Query: 119 ------------------------NYAFVEYLQHHDADVAFKNLNGKTIET--------- 145
                                    Y FVE+ +  DA  A   LN   +           
Sbjct: 89  TDPQKIKINGVSFIDPNTTQLHHAGYCFVEFQKLEDAQWAL-TLNSTPLPNILSNSTHSQ 147

Query: 146 ------KVLKINWA----FQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSE-FPSFVQ 194
                 +  ++NWA     QS   ++ E  F+LFVGDL+    +  L   F + F S   
Sbjct: 148 TNPTLQRSFRLNWASGATLQSAIPSTPE--FSLFVGDLSPSATEAHLLSLFQKNFKSVKT 205

Query: 195 AHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKREN 247
             VM D  TG SR +GF+ F+++++ + A+ +M      GR +R+ +A+ R N
Sbjct: 206 VRVMTDPITGASRCFGFVRFADEQERRRALVEMNGVWCQGRCLRVAYATPRNN 258

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+G L   + +  L   F  F S     +       + +G GF+ F ++ DA+ A+  M
Sbjct: 369 VFIGGLASQISEPQLYSLFLPFGSITNVRI------PQGKGCGFVKFESRIDAEAAIQGM 422

Query: 228 QSTELNGRQIRINWA 242
           Q   + G  IR++W 
Sbjct: 423 QGFIVGGNPIRLSWG 437

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 51/104 (49%), Gaps = 8/104 (7%)

Query: 65  VPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVE 124
           +P N+    + T+   +++G L   I+E  L   F   G I+NV++   K       FV+
Sbjct: 356 IPKNSYTNPKNTT---VFIGGLASQISEPQLYSLFLPFGSITNVRIPQGK----GCGFVK 408

Query: 125 YLQHHDADVAFKNLNGKTIETKVLKINWAFQS-QQTTSDESLFN 167
           +    DA+ A + + G  +    ++++W   S ++T + + ++N
Sbjct: 409 FESRIDAEAAIQGMQGFIVGGNPIRLSWGRSSGEKTPTQQHMWN 452

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 34/75 (45%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    +E  L  L   FG I + +    KG  F+K+++   A   I  +  + 
Sbjct: 367 TTVFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKGCGFVKFESRIDAEAAIQGMQGFI 426

Query: 385 FQGRNLKTGWGKEKA 399
             G  ++  WG+   
Sbjct: 427 VGGNPIRLSWGRSSG 441

>ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {ON}
           similar to uniprot|Q75EC3 Ashbya gossypii AAR151W
           AAR151Wp and weakly similar to YBR212W uniprot|P32831
           Saccharomyces cerevisiae YBR212W NGR1 negative growth
           regulatory protein
          Length = 716

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 66/146 (45%), Gaps = 19/146 (13%)

Query: 120 YAFVEYLQHHDADVAFKNLNGKTIET---------------KVLKINWAFQS--QQTTSD 162
           Y FVE+    DA     +LN   +                 +  ++NWA  +  Q +   
Sbjct: 160 YCFVEFETQQDAQFGL-SLNSTPLPNFISQSSGLATNPTGQRNFRLNWASGATLQSSIPS 218

Query: 163 ESLFNLFVGDLNVDVDDETLGHAFSE-FPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQ 221
              F+LFVGDL+    +  L   F + F S     VM D  TG SR +GF+ F N+E+ +
Sbjct: 219 RPEFSLFVGDLSPTATEADLLSLFQQKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERR 278

Query: 222 TAMDKMQSTELNGRQIRINWASKREN 247
            A+ +M      GR +R+ +A+ R N
Sbjct: 279 RALVEMNGVWCQGRCLRVAYATPRNN 304

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 156 SQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFS 215
           +Q  T+D +   +F+G L   +++  L   FS F + +   +       + +  GF+ F 
Sbjct: 411 AQAYTTDPNNTTVFIGGLTPKINENQLQTLFSPFGNILTVKIP------QGKNCGFVKFE 464

Query: 216 NQEDAQTAMDKMQSTELNGRQIRINWA 242
            + DA+ A+  MQ   + G  IR++W 
Sbjct: 465 KRIDAEAAIQGMQGFVVGGCPIRLSWG 491

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 39/79 (49%), Gaps = 4/79 (5%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVA 134
           + ++  +++G L   INE  L+  F   G I  VK+   K    N  FV++ +  DA+ A
Sbjct: 417 DPNNTTVFIGGLTPKINENQLQTLFSPFGNILTVKIPQGK----NCGFVKFEKRIDAEAA 472

Query: 135 FKNLNGKTIETKVLKINWA 153
            + + G  +    ++++W 
Sbjct: 473 IQGMQGFVVGGCPIRLSWG 491

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 2/73 (2%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNC-FIKYDTHEQAAVCIVVLANY 383
           TTV+IG +     E  L  L   FG IL  K  P+  NC F+K++    A   I  +  +
Sbjct: 421 TTVFIGGLTPKINENQLQTLFSPFGNILTVK-IPQGKNCGFVKFEKRIDAEAAIQGMQGF 479

Query: 384 PFQGRNLKTGWGK 396
              G  ++  WG+
Sbjct: 480 VVGGCPIRLSWGR 492

>KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 639

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 52/80 (65%)

Query: 160 TSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQED 219
           T+  S+ +LF+GDL+  V ++ L HAFS F +     +  D +T +S GYG+++F++ ++
Sbjct: 88  TAGPSISSLFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQE 147

Query: 220 AQTAMDKMQSTELNGRQIRI 239
           A  A++K    +L G+++RI
Sbjct: 148 ADEAIEKFSYVKLFGKEVRI 167

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 71/164 (43%), Gaps = 16/164 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVA---- 134
           L++G+LDK + E+ L   F     +++VK+  D     S+ Y ++ +    +AD A    
Sbjct: 96  LFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEKF 155

Query: 135 -FKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFV 193
            +  L GK +       N  F+    T      N+F  +L ++ +       F E  SF 
Sbjct: 156 SYVKLFGKEVRIMPSMRNSYFRKNIGT------NVFFTNLPLE-NPALTTRVFYE--SFR 206

Query: 194 QAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
           +   +   +  R +  GF+ F +   A+ A+D   S E  G +I
Sbjct: 207 KYGRVLSCKLDRRKNIGFVYFESDISAKKAIDDFNSREYFGNKI 250

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 6/98 (6%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLN- 139
           ++V NL   +  E L  YF   GPI +V        + ++ F+ Y +  D   A + LN 
Sbjct: 306 VHVKNLPIGVCNEDLLNYFSKVGPIKSVYTSKADVYTTSWGFITYKRSRDTIRALEELNG 365

Query: 140 ----GKTIE-TKVLKINWAFQSQQTTSDESLFNLFVGD 172
               GK +E T+ +K N   +S  T ++   F   VG+
Sbjct: 366 AIFMGKRVEVTRAVKYNGERKSTSTNNNGIEFTGCVGN 403

>CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} similar
           to uniprot|P32831 Saccharomyces cerevisiae YBR212w
           Negative growth regulatory protein
          Length = 802

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 67/146 (45%), Gaps = 23/146 (15%)

Query: 120 YAFVEYLQHHDADVAFKNLNGKTIET---------------KVLKINWA----FQSQQTT 160
           Y FVE+    DA      LN   +                 +  ++NWA     QS   T
Sbjct: 172 YCFVEFESQKDAQEGLA-LNSTPLPNFVSTTTGQDINPTGQRTFRLNWASGATLQSSIPT 230

Query: 161 SDESLFNLFVGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQED 219
           + E  ++LFVGDL+    +  L   F ++F S     VM D  TG SR +GF+ F N+E+
Sbjct: 231 TPE--YSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEE 288

Query: 220 AQTAMDKMQSTELNGRQIRINWASKR 245
            + A+ +M      GR +R+ +A+ R
Sbjct: 289 RRRALIEMNGVHFQGRTLRVAYATPR 314

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 42/79 (53%), Gaps = 4/79 (5%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVA 134
           + ++  ++VG L  ++ E+ L++ FQ  G I ++K+   K    N  FV++    DA+ A
Sbjct: 463 DPTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGK----NCGFVKFEHKIDAEAA 518

Query: 135 FKNLNGKTIETKVLKINWA 153
            + L G  +    ++++W 
Sbjct: 519 IQGLQGFVLVENPIRLSWG 537

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 1/85 (1%)

Query: 312 AVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHE 371
           A++D     P   TTV++G +     E  L  + Q FG IL  K  P K   F+K++   
Sbjct: 455 ALNDFFATDPTN-TTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGKNCGFVKFEHKI 513

Query: 372 QAAVCIVVLANYPFQGRNLKTGWGK 396
            A   I  L  +      ++  WG+
Sbjct: 514 DAEAAIQGLQGFVLVENPIRLSWGR 538

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 161 SDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDA 220
           +D +   +FVG L   V ++ L   F  F + +       ++    +  GF+ F ++ DA
Sbjct: 462 TDPTNTTVFVGGLGPTVQEQQLRKIFQPFGNIL------SIKIPPGKNCGFVKFEHKIDA 515

Query: 221 QTAMDKMQSTELNGRQIRINWA 242
           + A+  +Q   L    IR++W 
Sbjct: 516 EAAIQGLQGFVLVENPIRLSWG 537

>KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 203

 Score = 61.2 bits (147), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 86/170 (50%), Gaps = 8/170 (4%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNS-----VNYAFVEYLQHHDADVAF 135
           +YVGNLD  +N+  L + F   GPIS +K   +K +        YAF++++ + D D   
Sbjct: 5   VYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFV-NDDVDYVC 63

Query: 136 KNLNGK-TIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQ 194
           K  + + ++  K LK+  + +  +TT  +    LFV +L+  +D   L + F  F   ++
Sbjct: 64  KLFDNRVSLYGKPLKVRRSNKQPETTDFDVGAKLFVKNLDESIDVPQLSNIFKIFGKLLR 123

Query: 195 AHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
              ++ +Q G  R   ++ F+  + +  A+ ++  T L  + I I++A K
Sbjct: 124 KPEVFYLQNGTLRC-AYVWFTTFKHSDEALQQLNETNLANKLIYIDYAYK 172

>Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON}
           (47628..49610) [1983 nt, 661 aa]
          Length = 660

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 46/72 (63%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LF+G+L++DV++E L   F +FPS V   +  +  T  S GYG+++F ++EDA+ A ++ 
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 228 QSTELNGRQIRI 239
               L G +++I
Sbjct: 140 NYINLFGNEVKI 151

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 74/163 (45%), Gaps = 14/163 (8%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQHHDADVAFKNL 138
           L++GNL   +NEE LKQ F+    + +VK+  +     S+ Y ++ +    DA+ A +  
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 139 NGKTI---ETKVL-KINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQ 194
           N   +   E K++  +  +F  +   +     NLF  +L +D  + T    +  F  + +
Sbjct: 140 NYINLFGNEVKIMPSLRNSFYRKNIGT-----NLFFCNLPLDNKELTTRRFYDTFKKYGK 194

Query: 195 AHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
              +   +  + +  GF+ F N + A+  +    + E  G +I
Sbjct: 195 ---ILSCKLDKRKNIGFVYFDNDKSAKEVIKDFNNKEFFGTKI 234

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 50/95 (52%), Gaps = 8/95 (8%)

Query: 64  VVPANAI--NGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNV---KVINDKNNSV 118
           V+ +N+I     ++T    ++V NL  +  +E +  YF + GPI +V   KV   K NS+
Sbjct: 315 VIDSNSIIDETNKKTYPNSVFVKNLPINTTDEEILDYFSVAGPIKSVFSSKV--PKFNSL 372

Query: 119 NYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWA 153
            ++ + Y +  D+  A +  + KT + KV+ +  A
Sbjct: 373 -WSIITYKKSSDSIKAIQTYDNKTFKEKVISVTKA 406

>SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} similar
           to uniprot|P38922 Saccharomyces cerevisiae YNL004W
          Length = 464

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 77/177 (43%), Gaps = 23/177 (12%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNG 140
           ++VGNL      E LK+YF   G +    +I  + +      VE+    D D A +  +G
Sbjct: 164 IFVGNLTYDCQPEDLKEYFSQIGEVVRADIITSRGHHRGMGTVEFTNADDVDEAIRRFDG 223

Query: 141 KTIETKVLKINWAFQSQQTTSDESL-----------------FNLFVGDLNVDVDDETLG 183
            T+  + +     F  Q     ES+                 + +F+ +L   V+ + L 
Sbjct: 224 STLLDREI-----FVRQDNPPPESMRAPPRERRPRIQASAPGYEVFIANLPYSVNWQALK 278

Query: 184 HAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRIN 240
             F E    ++A V  D + G SRGYG + +  +E+ Q A+++    EL GR + ++
Sbjct: 279 DMFKECGDVLRADVKLD-RDGYSRGYGVVYYKTKEEVQVAIERYNGYELEGRVLDVH 334

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 167 NLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDK 226
           ++FVG+L  D   E L   FS+    V+A ++     G  RG G + F+N +D   A+ +
Sbjct: 163 SIFVGNLTYDCQPEDLKEYFSQIGEVVRADII--TSRGHHRGMGTVEFTNADDVDEAIRR 220

Query: 227 MQSTELNGRQI 237
              + L  R+I
Sbjct: 221 FDGSTLLDREI 231

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFI----LDFKYYPE-KGNCFIKYDTHEQAAVCIVV 379
           +T+++ N+P    ++DL  L +  G +    L F Y  +  G   ++YD    A VCI  
Sbjct: 386 STIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEVCISR 445

Query: 380 LANYPFQGRNLKTGW 394
           L +Y + GR+L   +
Sbjct: 446 LNSYNYGGRDLDISY 460

>Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON}
           complement(931..1584) [654 nt, 218 aa]
          Length = 217

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 84/184 (45%), Gaps = 13/184 (7%)

Query: 73  GRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHD 130
           G +  D  +YVGN+D SI +E L + F    PI+ +    DK       YAF+++    D
Sbjct: 7   GFKNPDLSVYVGNIDPSITKELLYELFVQISPIAKINYPKDKVLQTHQGYAFIDFYTEED 66

Query: 131 ADVAFKNLNGKT-IETKVLKI-----NWAFQS----QQTTSDESLFNLFVGDLNVDVDDE 180
           A+ A +  N    +  +VLK+     N + +S     Q TS      +FV +L+  VD  
Sbjct: 67  ANYAIQAFNNNVQLNNRVLKVRKTNNNISSKSSTNLSQATSVTPYAKIFVKNLDSSVDVA 126

Query: 181 TLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRIN 240
            L   F +F S  +   ++ +  G  R   ++ F + E A  A+  +    +  ++I I 
Sbjct: 127 YLSKLFKKFGSLARESEIFHLSNGELRC-AYVYFKDYEKADEAIKSLDGQLVTNKRINIE 185

Query: 241 WASK 244
           +A K
Sbjct: 186 YAFK 189

>KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.491
           YPL043W
          Length = 690

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 50/79 (63%), Gaps = 1/79 (1%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFV  +  DV DE LG  FS F     A V+ D+   +SRG+GF+SF+ +ED + A+ K 
Sbjct: 24  LFVRSIPFDVTDEELGGFFSNFAPTKHAVVVKDVNK-KSRGFGFVSFATEEDTKDALGKA 82

Query: 228 QSTELNGRQIRINWASKRE 246
           + ++LNG  +R++ A +R+
Sbjct: 83  RRSKLNGNVLRVDIAKRRD 101

 Score = 37.0 bits (84), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 35/60 (58%)

Query: 166 FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMD 225
           +++FV ++  D   E+L   FS+F     A  + D +TG ++G  F++F N+E  ++ ++
Sbjct: 292 YSVFVRNVPYDATKESLVDHFSKFGPVKYALPVIDRETGLAKGTAFVAFRNEETYKSCLE 351

>SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {ON}
           similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 60.5 bits (145), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 84/173 (48%), Gaps = 8/173 (4%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           LY+GN+D ++ ++ L + F    PIS ++   DK  +    YAF+E+    DAD   K +
Sbjct: 12  LYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVKVM 71

Query: 139 NGKT-IETKVLKINWA----FQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFV 193
           N    +  + LK+  A      SQ +   E    LFV +L+  VD   L   F +F  F 
Sbjct: 72  NNTVQLYNRTLKVRRANSNTAASQPSKHVEIGAKLFVKNLDDLVDVAALAKIFGKFGPFS 131

Query: 194 QAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKRE 246
           +   ++ ++    +   +I ++  +D+  A+ K+ +  +  R I +++A K E
Sbjct: 132 KQPEIFHVKQADYKC-AYIYYTTFDDSDQALAKLNNQIVFNRSISVDYAFKDE 183

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISN-VKVINDKNNSVNYAFVEYLQHHDADVAFKNLN 139
           L+V NLD  ++   L + F   GP S   ++ + K      A++ Y    D+D A   LN
Sbjct: 106 LFVKNLDDLVDVAALAKIFGKFGPFSKQPEIFHVKQADYKCAYIYYTTFDDSDQALAKLN 165

Query: 140 GKTIETKVLKINWAFQSQQ 158
            + +  + + +++AF+ ++
Sbjct: 166 NQIVFNRSISVDYAFKDEK 184

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 39/83 (46%), Gaps = 1/83 (1%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           L++G+++ +V  + L   F +     +     D      +GY FI F  +EDA   +  M
Sbjct: 12  LYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVKVM 71

Query: 228 QST-ELNGRQIRINWASKRENAT 249
            +T +L  R +++  A+    A+
Sbjct: 72  NNTVQLYNRTLKVRRANSNTAAS 94

>KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {ON}
           Anc_1.357 YHR015W
          Length = 589

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 49/72 (68%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LF+G+L+ DV ++ L   FS +PSF+ A V ++  T  S G+G+++F ++EDA+ A ++M
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 228 QSTELNGRQIRI 239
             +++   +IRI
Sbjct: 151 NYSKVLNNEIRI 162

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/159 (20%), Positives = 70/159 (44%), Gaps = 6/159 (3%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVI--NDKNNSVNYAFVEYLQHHDADVAFKNL 138
           L++GNLDK + E+ L+  F +     + KV   +  N S+ + ++ +    DA+ A + +
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 139 NGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVM 198
           N   +    ++I  + +           N++  +L  + +  T  + +  F  + +   +
Sbjct: 151 NYSKVLNNEIRIMPSMRDPDYRKKVGT-NVYFRNLPTENNMLTTRYFYDSFRKYGK---I 206

Query: 199 WDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
              +  RS+  GFI F+ +  A   + K  ++   G  I
Sbjct: 207 LSCKIERSKKIGFIYFACEVTANEVIKKFNNSSFLGNNI 245

>ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON}
           similar to uniprot|P39684 Saccharomyces cerevisiae or to
           YHR015W uniprot|P38760 Saccharomyces cerevisiae
          Length = 654

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 47/87 (54%)

Query: 153 AFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFI 212
              SQ     +    LF+GDL+  +D+E L   F +F S     V  D +TG+S GYG++
Sbjct: 90  GLDSQSVIESQPTIALFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYL 149

Query: 213 SFSNQEDAQTAMDKMQSTELNGRQIRI 239
           +FS ++D   A ++     + G+++RI
Sbjct: 150 NFSRRQDTLAATEEFNYRPIFGKEVRI 176

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 74/159 (46%), Gaps = 6/159 (3%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYLQHHDADVAFKNL 138
           L++G+LD+ I+EE L Q F+    +++VKV  D     S+ Y ++ + +  D   A +  
Sbjct: 105 LFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYLNFSRRQDTLAATEEF 164

Query: 139 NGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVM 198
           N + I  K ++I  + ++     +    N+F  +L ++  + T    +  F  +     +
Sbjct: 165 NYRPIFGKEVRIMPSLRNTFYRKNIGT-NIFFSNLPLENSNLTTRVFYDTFKVYGN---I 220

Query: 199 WDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
              +  + +  GFI F N   A+  + +   +E  G +I
Sbjct: 221 LSCKLDKRKNIGFIYFDNDHAARVVIKEFNGSEFFGNKI 259

>AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL043W (NOP4)
          Length = 729

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 1/84 (1%)

Query: 165 LFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAM 224
           L  LFV ++  D  D  L   FS+F     A ++ D   G SRG+GF+SF+ + D Q A+
Sbjct: 15  LKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKD-NAGSSRGFGFVSFAVESDTQAAL 73

Query: 225 DKMQSTELNGRQIRINWASKRENA 248
           DK + T+  GR +R++ A +RE +
Sbjct: 74  DKGRKTQFKGRLLRVDVAKRRERS 97

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 166 FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQ 217
           F++FV ++  D   ETL   FS+F     A  + D +TG  +G  F++F ++
Sbjct: 288 FSVFVRNVPYDATQETLEAHFSKFGPVKYALPVQDKETGLPKGTAFVAFKDE 339

>Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043W
           (REAL)
          Length = 686

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 1/93 (1%)

Query: 156 SQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFS 215
           S+Q  +   +  LFV  +  DV DE L   FS F     A V+ D+   RSRG+GF+SF+
Sbjct: 16  SKQNDNGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDVNK-RSRGFGFVSFA 74

Query: 216 NQEDAQTAMDKMQSTELNGRQIRINWASKRENA 248
            ++D + A+ K + T+ NG  +R++ A +R+ +
Sbjct: 75  VEDDTKEALAKARKTKFNGHSLRVDVAKRRDRS 107

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%)

Query: 166 FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQ 217
           F++FV ++  D  +E+L   FS+F S   A  + D  TG ++G  F++F +Q
Sbjct: 292 FSIFVRNVPYDATEESLAAHFSKFGSVKYALPVIDKSTGLAKGTAFVAFKDQ 343

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 35/200 (17%), Positives = 76/200 (38%), Gaps = 37/200 (18%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDADVAFK- 136
           K L+V ++ + + +E L  +F    PI +  V+ D N  S  + FV +    D   A   
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDVNKRSRGFGFVSFAVEDDTKEALAK 85

Query: 137 ----NLNGKTIETKVLKINWAFQSQQTTSDESL--------------------------- 165
                 NG ++   V K     +     +++S                            
Sbjct: 86  ARKTKFNGHSLRVDVAKRRDRSKKSSEGAEKSAPKSFEKTEVQKTENEDDDVDDEDSMLK 145

Query: 166 --FNLFVGDLNVDVDDET-LGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQT 222
               L + ++     D T L   F  + + V+A +    + G+  G+ F++     + + 
Sbjct: 146 GKPKLIIRNMPWSCRDPTKLKKIFGRYGTVVEATIPRK-RDGKLCGFAFVTMKKISNCRI 204

Query: 223 AMDKMQSTELNGRQIRINWA 242
           A++  +   ++GR++ +++A
Sbjct: 205 ALEGTKDLTIDGRKVAVDFA 224

>TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON}
           Anc_6.104 YBR212W
          Length = 594

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 67/144 (46%), Gaps = 19/144 (13%)

Query: 120 YAFVEYLQHHDADVAFKNLNGKTIET---------------KVLKINWAFQSQQTTSDE- 163
           Y FVE+    DA  A   LN   I                 +  ++NWA  +   +S   
Sbjct: 131 YCFVEFANQVDAKFALS-LNSSPIPNFYSSSISLHTNPNNNRNFRLNWASGATLNSSIPL 189

Query: 164 -SLFNLFVGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQ 221
              F+LFVGDL+  V +  L   F  +F S     VM D  TG SR +GFI F+++ + +
Sbjct: 190 TPEFSLFVGDLSPLVTEADLLSLFQKKFKSVKTVRVMTDPITGTSRCFGFIRFTDELERK 249

Query: 222 TAMDKMQSTELNGRQIRINWASKR 245
            A+ +M     NGR +R+ +A+ R
Sbjct: 250 NALIEMNGIWCNGRPLRVAYATPR 273

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 120 YAFVEYLQHHDADVAFKNLNGKTIETKV-LKINWAFQSQQTTSDES 164
           +A + Y    DAD A KN+ G TI   + L I+W+    Q   + S
Sbjct: 430 FAIIVYENFKDADCAIKNMQGLTIGNSIKLNISWSLNDSQQEHNRS 475

>Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {ON}
           complement(104488..106251) [1764 nt, 588 aa]
          Length = 587

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 65/145 (44%), Gaps = 21/145 (14%)

Query: 120 YAFVEYLQHHDADVAFK--------------NLNGKTIETKVLKINWA----FQSQQTTS 161
           Y FVE+    DA  A                NL       +  ++NWA     QS    +
Sbjct: 166 YCFVEFQNQEDAQYALSLNSNPIPNILSDSNNLYTNPTGKRNFRLNWASGATLQSSIPVT 225

Query: 162 DESLFNLFVGDLNVDVDDETLGHAFSE-FPSFVQAHVMWDMQTGRSRGYGFISFSNQEDA 220
            E  F+LFVGDL+    +  L   F + + S     VM D  TG SR +GFI F +Q++ 
Sbjct: 226 PE--FSLFVGDLSPTATEADLLSLFQQQYRSVKTVRVMTDPITGASRCFGFIRFGDQDER 283

Query: 221 QTAMDKMQSTELNGRQIRINWASKR 245
           + A+ +M      GR +R+ +A+ R
Sbjct: 284 KRALSEMNGVWCQGRPLRVAYATPR 308

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%)

Query: 324 VTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANY 383
           V+TV+IG +     E+ +  L + FG I++ K  P K   F+K++    A   I  L  +
Sbjct: 379 VSTVFIGGLSPKINESQVRSLFKPFGNIVNVKLPPGKNCGFVKFENRIDAEAAIQGLQGF 438

Query: 384 PFQGRNLKTGWGKEKAV 400
              G  ++  WGK  ++
Sbjct: 439 IVAGNPIRLSWGKASSM 455

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 4/84 (4%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNG 140
           +++G L   INE  ++  F+  G I NVK+   KN      FV++    DA+ A + L G
Sbjct: 382 VFIGGLSPKINESQVRSLFKPFGNIVNVKLPPGKN----CGFVKFENRIDAEAAIQGLQG 437

Query: 141 KTIETKVLKINWAFQSQQTTSDES 164
             +    ++++W   S  T+ + S
Sbjct: 438 FIVAGNPIRLSWGKASSMTSGNAS 461

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 44/87 (50%), Gaps = 6/87 (6%)

Query: 156 SQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFS 215
           S+  + +E +  +F+G L+  +++  +   F  F + V      +++    +  GF+ F 
Sbjct: 370 SKSNSQNELVSTVFIGGLSPKINESQVRSLFKPFGNIV------NVKLPPGKNCGFVKFE 423

Query: 216 NQEDAQTAMDKMQSTELNGRQIRINWA 242
           N+ DA+ A+  +Q   + G  IR++W 
Sbjct: 424 NRIDAEAAIQGLQGFIVAGNPIRLSWG 450

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 83/215 (38%), Gaps = 45/215 (20%)

Query: 64  VVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFV 123
           + P++ I    E   + L++G+LD S +E T++Q ++    +  VK+I  K N +     
Sbjct: 10  LPPSSTIETSSEP-PRTLWMGDLDPSFDESTIQQIWKSLDRLVTVKLIRAKKNLLIPCSS 68

Query: 124 EYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVD------- 176
                        +    +        + +  +  ++S E+  N    +L+ D       
Sbjct: 69  TINDSFSNSSNSLSPTNSSTRLSSAGSSASPTTVSSSSAENKSNSITNNLSTDQTEDASI 128

Query: 177 ---VDDETLG-----HAFS----EF--PSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQT 222
              +DD+T G     H  +     F  PS VQ H           GY F+ F NQEDAQ 
Sbjct: 129 TSNLDDDTNGGNQNLHKININGVSFIDPSTVQLH---------HAGYCFVEFQNQEDAQY 179

Query: 223 AM--------------DKMQSTELNGRQIRINWAS 243
           A+              + + +     R  R+NWAS
Sbjct: 180 ALSLNSNPIPNILSDSNNLYTNPTGKRNFRLNWAS 214

>YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit of
           cleavage factor I, a five-subunit complex required for
           the cleavage and polyadenylation of pre-mRNA 3' ends;
           RRM-containing heteronuclear RNA binding protein and
           hnRNPA/B family member that binds to poly (A) signal
           sequences
          Length = 534

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 85/173 (49%), Gaps = 20/173 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ L++YF   G ++++K++ D     S  + F+ + +    D   K  
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        ++      +    +FVG +  DV  +     FS++ + + A
Sbjct: 221 HILDGKVIDPK--------RAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDA 272

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKR 245
            +M D  TG+SRG+GF+++    D+  A+D++   +  +   R+I I  A  R
Sbjct: 273 QLMLDKDTGQSRGFGFVTY----DSADAVDRVCQNKFIDFKDRKIEIKRAEPR 321

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 46/81 (56%), Gaps = 6/81 (7%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+G LN D  ++ L   F ++ +     +M D  TGRSRG+GF+SF    +  +++D++
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSF----EKPSSVDEV 216

Query: 228 QSTE--LNGRQIRINWASKRE 246
             T+  L+G+ I    A  R+
Sbjct: 217 VKTQHILDGKVIDPKRAIPRD 237

>Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W
           (REAL)
          Length = 536

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 85/173 (49%), Gaps = 20/173 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ L++YF   G ++++K++ D     S  + F+ + +    D   K  
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        ++      +    +FVG +  DV  +     FS++ + + A
Sbjct: 221 HILDGKVIDPK--------RAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDA 272

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKR 245
            +M D  TG+SRG+GF+++    D+  A+D++   +  +   R+I I  A  R
Sbjct: 273 QLMLDKDTGQSRGFGFVTY----DSADAVDRVCQNKFIDFKDRKIEIKRAEPR 321

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 46/81 (56%), Gaps = 6/81 (7%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+G LN D  ++ L   F ++ +     +M D  TGRSRG+GF+SF    +  +++D++
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSF----EKPSSVDEV 216

Query: 228 QSTE--LNGRQIRINWASKRE 246
             T+  L+G+ I    A  R+
Sbjct: 217 VKTQHILDGKVIDPKRAIPRD 237

>NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408
          Length = 377

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 77/168 (45%), Gaps = 12/168 (7%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNG 140
           +++GNL     EE L+ +F   G + N +V++ +  S     VE+    DA+ A +  NG
Sbjct: 80  IFIGNLSFDATEEDLRDFFSQVGEVVNAEVMSYRGRSKGMGTVEFTNPADAEEAIRQYNG 139

Query: 141 KTIETKVLKI---------NWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPS 191
                + + +            F+S + T  +  +  FV +L   +  + L   F E   
Sbjct: 140 VPFMGRDIFVKQDQPPPGSRQEFKSSEPT--QQGYEAFVVNLPYSITWQNLKDIFRECGD 197

Query: 192 FVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
            ++A V  D   G SRG+G + ++N+ED   A+D     EL GR + +
Sbjct: 198 VIRADVELDY-NGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEV 244

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 73/203 (35%), Gaps = 41/203 (20%)

Query: 82  YVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN-SVNYAFVEYLQHHDADVAFKNLNG 140
           +V NL  SI  + LK  F+  G +    V  D N  S  +  V Y    D   A  + NG
Sbjct: 175 FVVNLPYSITWQNLKDIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNG 234

Query: 141 KTIETKVLKI---------------------------------------NWAFQSQQTTS 161
             +E ++L++                                       N +F    +  
Sbjct: 235 AELEGRILEVREGKFNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSFTEGVSGD 294

Query: 162 DESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQ 221
            E    ++  +L +      L   F        A +++D +TG S G   + +++Q+ A 
Sbjct: 295 GERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYD-ETGTSTGAAVVEYASQDAAD 353

Query: 222 TAMDKMQSTELNGRQIRINWASK 244
             ++K+      GR + I +AS+
Sbjct: 354 VCINKLNGYNYGGRDLHITYASR 376

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 5/73 (6%)

Query: 323 RVTTVYIGNIPHFATEADLIPLLQNFGFI-LDFKYYPEKGN----CFIKYDTHEQAAVCI 377
           R  TVY  N+P   T  DL  L  + G I +    Y E G       ++Y + + A VCI
Sbjct: 297 RNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCI 356

Query: 378 VVLANYPFQGRNL 390
             L  Y + GR+L
Sbjct: 357 NKLNGYNYGGRDL 369

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 31/74 (41%), Gaps = 1/74 (1%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN-SVNYAFVEYLQHHDADVAFKNLN 139
           +Y  NL  S     L   F   G I+  +++ D+   S   A VEY     ADV    LN
Sbjct: 301 VYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCINKLN 360

Query: 140 GKTIETKVLKINWA 153
           G     + L I +A
Sbjct: 361 GYNYGGRDLHITYA 374

>Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa]
           {ON} YOR319W (HSH49) - homolog of mammalian splicing
           factor/U2 snRNP protein [contig 20] FULL
          Length = 209

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 87/179 (48%), Gaps = 8/179 (4%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAF 135
           D  +YVGN+D  +  E L + F    P++ ++   DK       +AFVE+    D + A 
Sbjct: 9   DNTVYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYAT 68

Query: 136 KNLNGKT-IETKVLKINWAFQSQQTTSDESLFN----LFVGDLNVDVDDETLGHAFSEFP 190
           K LN    +  + LK+  A  +    ++++  +    LFV +++  VD   L   FS+F 
Sbjct: 69  KCLNNSLRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATALTRIFSKFG 128

Query: 191 SFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKRENAT 249
              +A  ++ ++ G  +   ++S++  E +  A+ K+ +  +  + I +++A K  + T
Sbjct: 129 PLAKAPEIFYLKQGVLKC-AYVSYTTFEHSDKALAKLNNQMVMNKCISLDYALKEGSKT 186

>YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A)
           binding protein, suppressor of DNA polymerase epsilon
           mutation, similar to Mip6p
          Length = 611

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 55/77 (71%)

Query: 163 ESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQT 222
           + L  LF+GDL+  V +ETL   F ++PSFV A V  D  T +S G+G+++F ++E+A+ 
Sbjct: 88  KKLVPLFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEK 147

Query: 223 AMDKMQSTELNGRQIRI 239
           AM+++  T++NG++IRI
Sbjct: 148 AMEELNYTKVNGKEIRI 164

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 69/170 (40%), Gaps = 5/170 (2%)

Query: 76  TSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAF 135
           +S   +++ NL      + +  +F   GPI ++ + N       +AFV Y    D++ A 
Sbjct: 300 SSQNSIFIKNLPTITTRDDILNFFSEVGPIKSIYLSNATKVKYLWAFVTYKNSSDSEKAI 359

Query: 136 KNLNGKTIETKVLKINWAFQSQQTTS---DESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
           K  N      K L +  A   ++       + +  LF+ +L+   + E L +   +  + 
Sbjct: 360 KRYNNFYFRGKKLLVTRAQDKEERAKFIESQKISTLFLENLSAVCNKEFLKYLCHQ-ENI 418

Query: 193 VQAHVMWDMQTGRSRGY-GFISFSNQEDAQTAMDKMQSTELNGRQIRINW 241
               +  D     S  Y GFI F N EDA    + + +  + G  +  +W
Sbjct: 419 RPFKIQIDGYDENSSTYSGFIKFRNFEDATRIFNFLNNRLVGGSIVTTSW 468

>Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043W
           (REAL)
          Length = 690

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 1/94 (1%)

Query: 156 SQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFS 215
           S+Q  +   +  LFV  +  DV DE L   FS F     A V+ D    RSRG+GF+SF+
Sbjct: 16  SKQNDNGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNK-RSRGFGFVSFA 74

Query: 216 NQEDAQTAMDKMQSTELNGRQIRINWASKRENAT 249
            ++D + A+ K + T+ NG  +R++ A +R+  +
Sbjct: 75  VEDDTKEALAKARKTKFNGHTLRVDVAKRRDRTS 108

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%)

Query: 166 FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQ 217
           F++FV ++  D  +E+L   FS+F S   A  + D  TG ++G  F++F +Q
Sbjct: 295 FSVFVRNVPYDATEESLAAHFSKFGSVKYALPVIDKSTGLAKGTAFVAFKDQ 346

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 37/199 (18%), Positives = 81/199 (40%), Gaps = 36/199 (18%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDADVAFK- 136
           K L+V ++ + + +E L  +F    PI +  V+ D N  S  + FV +    D   A   
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAK 85

Query: 137 ----NLNGKTIETKVLK----INWAFQSQQTTSDESL-----------------FNLFVG 171
                 NG T+   V K     + + +  + ++ ES                   +L  G
Sbjct: 86  ARKTKFNGHTLRVDVAKRRDRTSKSPEGAEKSTPESFEKISGQKNENDNDADDEDSLLKG 145

Query: 172 DLNVDV--------DDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTA 223
              + +        D   L   F+ + + V+A +    + G+  G+ F++     + + A
Sbjct: 146 KPKLIIRNMPWSCRDPTKLKKIFTRYGTVVEATIPR-KRDGKLCGFAFVTMKKISNCRIA 204

Query: 224 MDKMQSTELNGRQIRINWA 242
           ++  +  +++GR++ +++A
Sbjct: 205 LENTKDLKIDGRKVAVDFA 223

>Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W
           (REAL)
          Length = 551

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 85/173 (49%), Gaps = 20/173 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ L++YF   G ++++K++ D     S  + F+ + +    D   K  
Sbjct: 163 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 222

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        ++      +    +FVG +  DV  +     FS++ + + A
Sbjct: 223 HILDGKVIDPK--------RAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDA 274

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKR 245
            +M D  TG+SRG+GF+++    D+  A+D++   +  +   R+I I  A  R
Sbjct: 275 QLMLDKDTGQSRGFGFVTY----DSADAVDRVCQNKFIDFKDRKIEIKRAEPR 323

>KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} similar
           to uniprot|P37838 Saccharomyces cerevisiae YPL043W NOP4
           Nucleolar protein essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis contains four RNA recognition motifs (RRMs),
          Length = 685

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 53/84 (63%), Gaps = 1/84 (1%)

Query: 165 LFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAM 224
           L  LFV  +  +  DE  G+ FS+F     A ++ D + G SRG+GF+SF+ ++D +TA+
Sbjct: 14  LKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGE-GASRGFGFVSFAVEDDTKTAL 72

Query: 225 DKMQSTELNGRQIRINWASKRENA 248
           ++ + T+  GR +RI+ A +RE +
Sbjct: 73  NQARKTKFMGRLLRIDIAKRRERS 96

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 166 FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDA 220
           F++FV ++  D   E+L   F  F     A  + D +TG ++G  F++F + EDA
Sbjct: 296 FSIFVRNVPYDATQESLERHFGVFGPVKYALPVIDKETGLAKGTAFVAFRS-EDA 349

>Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 55/77 (71%)

Query: 163 ESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQT 222
           + L  LF+GDL+  V +ETL   F ++PSFV + V  D  T +S G+G+++F ++E+A+ 
Sbjct: 88  KKLVPLFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAEK 147

Query: 223 AMDKMQSTELNGRQIRI 239
           AM+++  T++NG++IRI
Sbjct: 148 AMEELNYTKVNGKEIRI 164

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 70/170 (41%), Gaps = 5/170 (2%)

Query: 76  TSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAF 135
           +S   +++ NL      + +  +F   GPI ++ + N       +AFV Y  + D++ A 
Sbjct: 300 SSQNSIFIKNLPTITTRDDILNFFSEVGPIKSIYLSNATKVKYLWAFVTYKSNDDSEKAI 359

Query: 136 KNLNGKTIETKVLKINWAFQSQQTTS---DESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
           K  N      + L +  A   ++       + +  LF+ +L+   + E L +   +  + 
Sbjct: 360 KRYNNFYFRGRKLLVTRAQGKEERAKYIESQKISTLFLENLSAVCNKEFLKYLCHQ-ENI 418

Query: 193 VQAHVMWDMQTGRSRGY-GFISFSNQEDAQTAMDKMQSTELNGRQIRINW 241
               +  D     S  Y G+I F N EDA    + + S  + G  +  +W
Sbjct: 419 RPFKIQIDRYDENSSTYSGYIKFRNFEDATRIFNFLNSRLVGGSIVMTSW 468

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 77/160 (48%), Gaps = 8/160 (5%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           L++G+LD+++ EETLK+ F+      + KV  D     S+ + ++ +    +A+ A + L
Sbjct: 93  LFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 139 NGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETL-GHAFSEFPSFVQAHV 197
           N   +  K ++I     S + T+    F   V   N+ +++  L    F  + +F +   
Sbjct: 153 NYTKVNGKEIRI---MPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVF--YDTFSRYGK 207

Query: 198 MWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
           +   +    +  GF+ F +++ A++ +    +T   G++I
Sbjct: 208 ILSCKLDSRKDIGFVYFEDEKTARSVIKMYNNTNFFGKKI 247

>Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W
           (REAL)
          Length = 539

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 85/173 (49%), Gaps = 20/173 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKN- 137
           +++G L+    E+ L++YF   G ++++K++ D     S  + F+ + +    D   K  
Sbjct: 164 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 223

Query: 138 --LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQA 195
             L+GK I+ K        ++      +    +FVG +  DV  +     FS++ + + A
Sbjct: 224 HILDGKVIDPK--------RAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDA 275

Query: 196 HVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGRQIRINWASKR 245
            +M D  TG+SRG+GF+++    D+  A+D++   +  +   R+I I  A  R
Sbjct: 276 QLMLDKDTGQSRGFGFVTY----DSADAVDRVCQNKFIDFKDRKIEIKRAEPR 324

>TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {ON}
           Anc_1.357 YHR015W
          Length = 622

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 46/81 (56%)

Query: 159 TTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQE 218
           T   +S+  LF+GDL   V +  L   F +F S     +  D  +G+S GYG+++F+N E
Sbjct: 90  TLESKSVVALFIGDLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFANSE 149

Query: 219 DAQTAMDKMQSTELNGRQIRI 239
           DA+ A ++     + G+++RI
Sbjct: 150 DAEKATEEFNYRPIEGQEVRI 170

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 76/159 (47%), Gaps = 6/159 (3%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQHHDADVAFKNL 138
           L++G+L+ S+ E  L+  F     +++VK+  D N+  S+ Y ++ +    DA+ A +  
Sbjct: 99  LFIGDLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFANSEDAEKATEEF 158

Query: 139 NGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVM 198
           N + IE + ++I  + ++     +    N+F  +L ++ D       F  + +F +   +
Sbjct: 159 NYRPIEGQEVRIMPSLRNSFYRKNVGT-NVFFSNLPLE-DSRLTTRVF--YDTFKKYGKI 214

Query: 199 WDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
              +  + +  GFI F+N + A+  +      E  G ++
Sbjct: 215 LSCKLDKRKDIGFIYFNNDQSARKVIKDYNGKEFFGNKV 253

>Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043W
           (REAL)
          Length = 680

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (56%), Gaps = 1/93 (1%)

Query: 156 SQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFS 215
           S+Q  +   +  LFV  +  DV DE L   FS F     A V+ D    RSRG+GF+SF+
Sbjct: 16  SKQNDNGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNK-RSRGFGFVSFA 74

Query: 216 NQEDAQTAMDKMQSTELNGRQIRINWASKRENA 248
            ++D + A+ K + T+ NG  +R++ A +R+ +
Sbjct: 75  VEDDTKEALIKARKTKFNGHTLRVDVAKRRDRS 107

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 41/199 (20%), Positives = 84/199 (42%), Gaps = 36/199 (18%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDADVAF-- 135
           K L+V ++ + + +E L  +F    PI +  V+ D N  S  + FV +    D   A   
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALIK 85

Query: 136 ---KNLNGKTIETKV---------------LKINWAFQSQ--QTTSDE-------SLF-- 166
                 NG T+   V               +K + +F+    Q T +E       S+   
Sbjct: 86  ARKTKFNGHTLRVDVAKRRDRSKKSSEGAPMKASESFEKTIGQKTENEHDADGEDSMLKG 145

Query: 167 --NLFVGDLNVDVDDET-LGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTA 223
              L + ++     D T L   FS + + V+A +    + G+  G+ F++     + + A
Sbjct: 146 KPKLIIRNMPWSCRDSTKLKDIFSRYGTVVEATIPR-KRDGKLCGFAFVTMKKISNCRIA 204

Query: 224 MDKMQSTELNGRQIRINWA 242
           ++  +  +++GR++ +++A
Sbjct: 205 LENSKDLKIDGRKVAVDFA 223

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%)

Query: 166 FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQ 217
           F++FV ++  D  +E+L   FS+F S   A  + D  TG ++G  F++F +Q
Sbjct: 285 FSVFVRNVPYDATEESLVAHFSKFGSVKYALPVIDRSTGLAKGTAFVAFKDQ 336

>ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 468

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 92/182 (50%), Gaps = 18/182 (9%)

Query: 80  ILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQHHDADVAFKN 137
            ++VG L  +I+++ LK  F+  G + + +VI ++ +  S  Y +V++     A+ A K 
Sbjct: 237 TIFVGRLSWNIDDQWLKNEFEHIGGVQSARVIYERGSTRSRGYGYVDFTDKSYAEKAVKE 296

Query: 138 LNGKTIETKVLKINWAFQSQQTT--------------SDESLFNLFVGDLNVDVDDETLG 183
           ++GK ++ +   IN    + + T                E    LF+G+L+ + D + + 
Sbjct: 297 MHGKELDGRP--INCDMSTSKPTVNPREDRAKRFGDMPSEPSDTLFLGNLSFNADRDQIY 354

Query: 184 HAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWAS 243
             FS     +   +    +T + +G+G++ +++ + AQ A++ +Q   ++ R +R+++++
Sbjct: 355 ELFSPHGEVISVRIPTHPETEQPKGFGYVQYASVDSAQKALETLQGEYIDNRPVRLDFST 414

Query: 244 KR 245
            +
Sbjct: 415 PK 416

>TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.491
           YPL043W
          Length = 692

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 165 LFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAM 224
           +  LFV  +  DV DE +G  FS F     A ++ D Q  +SRG+GF+SF+ ++D   A+
Sbjct: 25  MKTLFVRSIPADVTDEEMGEFFSNFAPIKHAVIVKDAQK-KSRGFGFVSFAVEDDTLAAL 83

Query: 225 DKMQSTELNGRQIRINWASKRE 246
            + + T+L  R +RI+ A +R+
Sbjct: 84  KEARKTKLKDRLLRIDIAKRRD 105

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/190 (20%), Positives = 88/190 (46%), Gaps = 27/190 (14%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVIND-KNNSVNYAFVEYLQHHDADVAFKN 137
           K L+V ++   + +E + ++F    PI +  ++ D +  S  + FV +    D   A K 
Sbjct: 26  KTLFVRSIPADVTDEEMGEFFSNFAPIKHAVIVKDAQKKSRGFGFVSFAVEDDTLAALKE 85

Query: 138 LNGKTIETKVLKINWAF----------QSQQTTSD----------ESLF----NLFVGDL 173
                ++ ++L+I+ A           +S+ T+ D          ESL      + + ++
Sbjct: 86  ARKTKLKDRLLRIDIAKRRDRNKKKGEESKPTSEDTESADGPIDEESLLKGKPKIIIRNM 145

Query: 174 NVDVDD-ETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTEL 232
                D E L + FS F + V+A +    + G+  G+ F++     + +TA++  +  ++
Sbjct: 146 PWSCRDPEKLKNIFSRFGTVVEAKI-PKKKDGKLCGFAFVTMKKLVNCKTAIENSKDLKI 204

Query: 233 NGRQIRINWA 242
           +GR++ +++A
Sbjct: 205 DGRKVAVDFA 214

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 32/53 (60%)

Query: 166 FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQE 218
           F++FV ++  D  +E+L   F +F     A  + D +TG ++G  F++FS+++
Sbjct: 295 FSVFVRNVPYDATEESLVEHFGKFGPVKYALPVIDRETGLAKGTAFVAFSSKQ 347

>YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}
           NOP4Nucleolar protein, essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis; constituent of 66S pre-ribosomal particles;
           contains four RNA recognition motifs (RRMs)
          Length = 685

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 52/93 (55%), Gaps = 1/93 (1%)

Query: 156 SQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFS 215
           S+Q      +  LFV  +  DV DE L   FS F     A V+ D    RSRG+GF+SF+
Sbjct: 16  SKQNDDGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNK-RSRGFGFVSFA 74

Query: 216 NQEDAQTAMDKMQSTELNGRQIRINWASKRENA 248
            ++D + A+ K + T+ NG  +R++ A +R+ +
Sbjct: 75  VEDDTKEALAKARKTKFNGHILRVDIAKRRDRS 107

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%)

Query: 166 FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQ 217
           F++FV ++  D  +E+L   FS+F S   A  + D  TG ++G  F++F +Q
Sbjct: 290 FSVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKSTGLAKGTAFVAFKDQ 341

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/199 (17%), Positives = 81/199 (40%), Gaps = 36/199 (18%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN-SVNYAFVEYLQHHDADVAFKN 137
           K L+V ++ + + +E L  +F    PI +  V+ D N  S  + FV +    D   A   
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAK 85

Query: 138 LNGKTIETKVLKINWAF---QSQQTT---------SDESL--------------FNLFVG 171
                    +L+++ A    +S++T+         S E +               ++  G
Sbjct: 86  ARKTKFNGHILRVDIAKRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSMLKG 145

Query: 172 DLNVDV--------DDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTA 223
              + +        D   L   F  + + V+A +    + G+  G+ F++     + + A
Sbjct: 146 KPKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPR-KRDGKLCGFAFVTMKKISNCRIA 204

Query: 224 MDKMQSTELNGRQIRINWA 242
           ++  +  +++GR++ +++A
Sbjct: 205 LENTKDLKIDGRKVAVDFA 223

>KNAG0G03260 Chr7 (701431..702036) [606 bp, 201 aa] {ON} Anc_8.797
           YOR319W
          Length = 201

 Score = 58.2 bits (139), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 77/169 (45%), Gaps = 7/169 (4%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           LYVGN+D  +  E L + F    P+ +++   DK       YAFV      DAD A + L
Sbjct: 8   LYVGNIDPRVTREQLYELFVQACPVVSLRYPRDKVLQTPQGYAFVGVPSVQDADYAVQLL 67

Query: 139 -NGKTIETKVLKINWAFQSQQTTSDES-LFNLFVGDLNVDVDDETLGHAFSEFPSFVQAH 196
            N  T+  + LKI  A       +D + +  L+VG L   VD + L   F +F +  +  
Sbjct: 68  HNCVTLHGRPLKIRRARPDSAEAADTAPVARLYVGGLAATVDAQQLARVFGKFGALYRPP 127

Query: 197 VMWDM-QTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            +    + GR   Y  + F +  DA  A+D +    L G ++ + +A +
Sbjct: 128 TVHPAGEAGRR--YALVEFRSYGDADAALDALAGATLAGGRVSVAYARR 174

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 1/82 (1%)

Query: 162 DESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQ 221
           D S  NL+VG+++  V  E L   F +    V      D      +GY F+   + +DA 
Sbjct: 2   DNSTTNLYVGNIDPRVTREQLYELFVQACPVVSLRYPRDKVLQTPQGYAFVGVPSVQDAD 61

Query: 222 TAMDKMQ-STELNGRQIRINWA 242
            A+  +     L+GR ++I  A
Sbjct: 62  YAVQLLHNCVTLHGRPLKIRRA 83

>Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C
           (NSR1) - nuclear localization sequence binding protein
           [contig 667] PARTIAL
          Length = 222

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 75/144 (52%), Gaps = 14/144 (9%)

Query: 115 NNSVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINW-------------AFQSQQTTS 161
           + S  Y +V++     A+ A K ++GK I+ + + ++              A Q   T S
Sbjct: 6   DRSRGYGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPAGNPRNDRAKQYGDTPS 65

Query: 162 DESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQ 221
             S   LF+G+L+ + + + +   FSE+   V   +    +T + +G+G++ +S+ E+AQ
Sbjct: 66  QPSD-TLFLGNLSFNTERDNVFEIFSEYGDVVSVRLPTHPETNQPKGFGYVQYSSVENAQ 124

Query: 222 TAMDKMQSTELNGRQIRINWASKR 245
            A+D +Q   ++ R +R+++++ +
Sbjct: 125 KALDALQGHYIDNRPVRLDFSTPK 148

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 29/43 (67%)

Query: 203 TGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           T RSRGYG++ F ++  A+ A+ +M   E++GR I ++ ++ +
Sbjct: 5   TDRSRGYGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSK 47

>NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.491
           YPL043W
          Length = 701

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 1/85 (1%)

Query: 165 LFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAM 224
           +  LFV  + +DV DE L   FS F     A V+ D+   +SRG+GF+SF+ ++D + A+
Sbjct: 25  MKTLFVRSIPMDVTDEELTDYFSNFAPTKHAVVVKDVNK-KSRGFGFVSFAVEDDTKEAL 83

Query: 225 DKMQSTELNGRQIRINWASKRENAT 249
            K + T+L G  +R++ A +R+ ++
Sbjct: 84  KKARQTKLKGHLLRVDIAKRRDRSS 108

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 37/201 (18%), Positives = 79/201 (39%), Gaps = 38/201 (18%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDADVAFKN 137
           K L+V ++   + +E L  YF    P  +  V+ D N  S  + FV +    D   A K 
Sbjct: 26  KTLFVRSIPMDVTDEELTDYFSNFAPTKHAVVVKDVNKKSRGFGFVSFAVEDDTKEALKK 85

Query: 138 LNGKTIETKVLKINWAFQSQQTTS-------------------------------DESLF 166
                ++  +L+++ A +  +++                                +ESL 
Sbjct: 86  ARQTKLKGHLLRVDIAKRRDRSSKSDDKNEGKVKTDTIAVGTRGDDNGDEPEEVDEESLL 145

Query: 167 ----NLFVGDLNVDVDD-ETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQ 221
                L + ++     D E L   F  F + V+A +    + G+  G+ F++     +  
Sbjct: 146 KGKPKLIIRNMPWSCRDPEKLKKVFGRFGNVVEATIPR-KRDGKLCGFAFVTMKKLSNCH 204

Query: 222 TAMDKMQSTELNGRQIRINWA 242
            A++  +  +++GR + +++A
Sbjct: 205 LALENTKDLKIDGRPVAVDFA 225

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 29/51 (56%)

Query: 166 FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSN 216
           +++FV ++  D  +E+L   FS+F     A  + D  TG ++G  F++F +
Sbjct: 302 YSIFVRNVPYDATEESLAAHFSKFGLVKYALPVIDRATGLAKGTAFVAFKD 352

>Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {ON}
           YPL043W (NOP4) - RNA recognition motif-containing
           protein [contig 27] FULL
          Length = 686

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFV  +  D  DE L + FS       A ++ D Q   SRG+GF+SF+ ++D + A+DK 
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKN-SRGFGFVSFAVEDDTKDALDKA 81

Query: 228 QSTELNGRQIRINWASKRE 246
           + T+  GR +R++ A +R+
Sbjct: 82  RKTKFKGRLLRVDIAKRRD 100

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 80/193 (41%), Gaps = 36/193 (18%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVI-NDKNNSVNYAFVEYLQHHDADVAFKN 137
           K L+V ++     +E L  YF    PI +  ++ +D+ NS  + FV +    D   A   
Sbjct: 21  KTLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDK 80

Query: 138 LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNV----DVDDETLGHAFSEFPSFV 193
                 + ++L+++ A +  +T  D+   N   G  +     D +DE LG      P  +
Sbjct: 81  ARKTKFKGRLLRVDIAKRRDRTKKDQ---NAAAGSEDTSGPQDKEDELLGGK----PKLI 133

Query: 194 QAHVMWDMQT------------------------GRSRGYGFISFSNQEDAQTAMDKMQS 229
             ++ W ++                         G+  G+ F++       + A+++ +S
Sbjct: 134 VRNMPWSVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKS 193

Query: 230 TELNGRQIRINWA 242
            ++ GRQ+ +++A
Sbjct: 194 LKIGGRQVAVDFA 206

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQE 218
           +FV ++  D   E+L   F++F     A  + D +TG ++G  F+ F  QE
Sbjct: 293 VFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQE 343

>KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 766

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 49/85 (57%)

Query: 155 QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISF 214
           Q   T   E    LF+GDL  +V ++ L + F++F SF    +  D  T +S GYG+++F
Sbjct: 127 QQTNTMKSEKQTALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNF 186

Query: 215 SNQEDAQTAMDKMQSTELNGRQIRI 239
            + +DA+ A+D+     + GR+IR+
Sbjct: 187 GDPKDAENAVDEYNYMPIFGREIRM 211

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 77/169 (45%), Gaps = 8/169 (4%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNG 140
           ++V NL  + + + L  +F   GP+ +V   +      ++AF+ Y +  D   A + LNG
Sbjct: 388 IFVKNLPINPSHDNLLNFFSKIGPVKSVYTSDVSKFDSSWAFITYKRIQDTKTAIEKLNG 447

Query: 141 -----KTIETKVLKINWAFQSQ---QTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSF 192
                +TIE K  + +   +SQ    T  +     +F+ +L+V  ++E L     +    
Sbjct: 448 CKYMKRTIEVKKTERHHLEESQFENNTRPNNYKKTVFLTNLSVICNEEFLNFLCGQERIK 507

Query: 193 VQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINW 241
            +  V+   +       G++  +++ DAQ   + M++  L   +++ +W
Sbjct: 508 TERVVVRYYEEKTDTYSGYVRCASRNDAQRLFELMENKLLGDSEVKASW 556

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 65/159 (40%), Gaps = 16/159 (10%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN--NSVNYAFVEYLQHHDADVAFKNL 138
           L++G+L  ++ E+ L   F      ++VK+  D N   S+ Y ++ +    DA+ A    
Sbjct: 140 LFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDEY 199

Query: 139 N-----GKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFV 193
           N     G+ I       N  F+    T      N+F  +L +D    T    + EF  F 
Sbjct: 200 NYMPIFGREIRMMPSLRNTYFRKNIGT------NVFFSNLPLDNTKLTTRVFYDEFKKFG 253

Query: 194 QAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTEL 232
           +   +   +  R +  GFI F N   A+ A+ +    E 
Sbjct: 254 K---ILSCKLDRRKNIGFIYFENDAAAKEAIKQYNGKEF 289

>TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON}
           Anc_8.797 YOR319W
          Length = 210

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 86/184 (46%), Gaps = 11/184 (5%)

Query: 70  INGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN--YAFVEYLQ 127
           +N      +  +YVGN+D  + +E L + F    PI+N++   DK   ++  +AFVE+  
Sbjct: 1   MNASLNNPETTVYVGNIDPKVTKENLYELFVQVSPIANIRYPKDKVLQLHQGFAFVEFYT 60

Query: 128 HHDADVAFKNLNGKT-IETKVLKINWAFQSQQTTSD------ESLFNLFVGDLNVDVDDE 180
             D     + LN    +  + LK+  A   Q + SD      + +  +FV +L+  +D+ 
Sbjct: 61  PEDCQYVVQLLNNTVQLYDRFLKVRKA-NVQSSGSDTIDVTIQPIAKVFVKNLDPSIDEP 119

Query: 181 TLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRIN 240
            L   F +F    +   ++ +  G+ R   +I F N + +  A+  +    +  +++ ++
Sbjct: 120 HLSRLFGKFGPLAKGPEIFYLSDGQLRC-AYIYFKNYDHSDLALATLNGQLVVNKKVTVD 178

Query: 241 WASK 244
           +A K
Sbjct: 179 YAFK 182

>CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae YFR023w PES4
           DNA-directed DNA polymerase epsilon suppressor
          Length = 602

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 43/72 (59%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFVG+L  ++  E L   F  + SF+ A V  +    RS G+G+I+F N+EDA+ A +  
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 228 QSTELNGRQIRI 239
              ++ G++IRI
Sbjct: 126 NYNKIMGKEIRI 137

 Score = 37.4 bits (85), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 70/159 (44%), Gaps = 6/159 (3%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIN--DKNNSVNYAFVEYLQHHDADVAFKNL 138
           L+VGNL + I  E L + F++     + KV    D N S+ + ++ +    DA+ A ++ 
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 139 NGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVM 198
           N   I  K ++I  + +      +    N+F    N+ +  E L H    +  F +   +
Sbjct: 126 NYNKIMGKEIRIMPSIRDSVYRKNFGT-NIFFS--NLPLQKEKLTHRMF-YDIFRKYGNV 181

Query: 199 WDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
             ++   S+  GF+ F +   A+  + +  + E  G  I
Sbjct: 182 LSVKLDSSKNIGFVYFEDDTIARDVIKEFNNKEFLGNII 220

>KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {ON}
           some similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 547

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 3/103 (2%)

Query: 148 LKINWAFQSQQTTSDESL--FNLFVGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTG 204
            ++NWA  +   ++  S   F+LFVGDL+    +  L   F  +F S     VM D  TG
Sbjct: 155 FRLNWASGATLLSAIPSTPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITG 214

Query: 205 RSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKREN 247
            SR +GF+ F ++++ + A+ +M      GR +R+ +A+ R N
Sbjct: 215 ASRCFGFVRFGDEQERRRALVEMNGVWCQGRNLRVAYATPRNN 257

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    +E  L  L   FG I++ K  P KG  F+KY     A   I  +  + 
Sbjct: 406 TTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQGFI 465

Query: 385 FQGRNLKTGWGK 396
             G  ++  WG+
Sbjct: 466 VGGNPIRLSWGR 477

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 4/88 (4%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKN 137
           +  +++G L    +E  L   F   G I NVK+   K       FV+Y    DA+ A + 
Sbjct: 405 NTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKG----CGFVKYAYRIDAEAAIQG 460

Query: 138 LNGKTIETKVLKINWAFQSQQTTSDESL 165
           + G  +    ++++W   S  T+   ++
Sbjct: 461 MQGFIVGGNPIRLSWGRTSTDTSRHPAM 488

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +F+G L     +  L   F+ F + +      +++    +G GF+ ++ + DA+ A+  M
Sbjct: 408 VFIGGLTSHTSERQLHSLFAPFGTII------NVKIPPGKGCGFVKYAYRIDAEAAIQGM 461

Query: 228 QSTELNGRQIRINWA 242
           Q   + G  IR++W 
Sbjct: 462 QGFIVGGNPIRLSWG 476

>Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {ON}
           YBR212W (NGR1) - negative growth regulatory protein
           [contig 235] FULL
          Length = 535

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 67/146 (45%), Gaps = 19/146 (13%)

Query: 120 YAFVEYLQHHDADVAFKNLNGKTIE---------------TKVLKINWAFQSQQTTSDES 164
           Y FVE+    DA  A   LN   +                 +  ++NWA  +   ++  S
Sbjct: 112 YCFVEFESLADAQWALT-LNSSPLPDITCGNGHVSTNPSGLRNFRLNWASGATLLSAIPS 170

Query: 165 L--FNLFVGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQ 221
              F+LFVGDL+    +  L   F  +F S     VM D  TG SR +GF+ F ++++ +
Sbjct: 171 TPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERR 230

Query: 222 TAMDKMQSTELNGRQIRINWASKREN 247
            A+ +M      GR +R+ +A+ R N
Sbjct: 231 RALVEMNGVWCQGRNLRVAYATPRNN 256

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           TTV+IG +    +E  L  L   FG I++ K  P KG  F+KY     A   I  +  + 
Sbjct: 396 TTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQGFI 455

Query: 385 FQGRNLKTGWGKEKA 399
             G  ++  WG+  A
Sbjct: 456 VGGNPIRLSWGRTSA 470

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 11/95 (11%)

Query: 153 AFQSQQTTSDESLFN-----LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSR 207
           AF +Q T    +  N     +F+G L   + +  L   FS F + +      +++    +
Sbjct: 378 AFMAQPTAPRSAFTNPNNTTVFIGGLTSQISERQLHSLFSPFGAII------NVKIPPGK 431

Query: 208 GYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWA 242
           G GF+ ++ + DA+ A+  MQ   + G  IR++W 
Sbjct: 432 GCGFVKYAYRIDAEAAIQGMQGFIVGGNPIRLSWG 466

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 4/88 (4%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKN 137
           +  +++G L   I+E  L   F   G I NVK+   K       FV+Y    DA+ A + 
Sbjct: 395 NTTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGKG----CGFVKYAYRIDAEAAIQG 450

Query: 138 LNGKTIETKVLKINWAFQSQQTTSDESL 165
           + G  +    ++++W   S  T    ++
Sbjct: 451 MQGFIVGGNPIRLSWGRTSADTGRHSAM 478

>KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]
           {ON} some similarities with uniprot|P37838 Saccharomyces
           cerevisiae YPL043W NOP4 Nucleolar protein essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis contains four RNA
           recognition motifs (RRMs)
          Length = 693

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFV  +  +  DE L + FSE      A ++ D +   SRG+GF+SF+ ++D + A++K 
Sbjct: 23  LFVRSIPFEATDEELTNYFSELAPIKHAVIVKDNEKN-SRGFGFVSFAVEDDTKDALEKA 81

Query: 228 QSTELNGRQIRINWASKRENA 248
           + T+  GR +R++ A +RE +
Sbjct: 82  RKTKFKGRLLRVDIAKRRERS 102

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/187 (18%), Positives = 79/187 (42%), Gaps = 24/187 (12%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVIND-KNNSVNYAFVEYLQHHDADVAFKN 137
           K L+V ++     +E L  YF    PI +  ++ D + NS  + FV +    D   A + 
Sbjct: 21  KTLFVRSIPFEATDEELTNYFSELAPIKHAVIVKDNEKNSRGFGFVSFAVEDDTKDALEK 80

Query: 138 LNGKTIETKVLKINWAFQSQQTTSDESLFN--------------LFVGDLNVDVDD---- 179
                 + ++L+++ A + +++  D+   +              L  G   + + +    
Sbjct: 81  ARKTKFKGRLLRVDIAKRRERSKGDQRSSSSSEQAGNVENKENELMGGKPKLIIRNMPWS 140

Query: 180 ----ETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGR 235
               E L   F  F + V+A +      G+  G+ F++       + A++  +  +++GR
Sbjct: 141 VRKPEQLKQIFMRFGTVVEAKIP-KKPDGKLCGFAFVTMKKLAACKKAIEDSKDLKIDGR 199

Query: 236 QIRINWA 242
           Q+ +++A
Sbjct: 200 QVAVDFA 206

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 92/186 (49%), Gaps = 30/186 (16%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDAD--VAF 135
           ++ +Y+GNL K++  E +    + GG + N+K++ND++      FV ++    A    A 
Sbjct: 471 NRTVYLGNLPKNVKLEEICNAIR-GGLLQNIKLLNDRH----VCFVTFIDPTAAAQFYAM 525

Query: 136 KNLNGKTIETKVLKINWAFQSQQTTSDESLF-------NLFVGDLNVDVD---------D 179
            +L+G TI  K  KI W   S    +  +L        N+++G++N + D         +
Sbjct: 526 SSLHGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLGNINFEEDAKQEESVFAE 585

Query: 180 ETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           +TL   F EF +  Q + +++      +   FI+F+N  +A  A+DK++S   +   ++I
Sbjct: 586 DTLRAIFEEFGTVEQINFLYE------KNCCFINFANISNAILAIDKIKSNP-HFNNLKI 638

Query: 240 NWASKR 245
           N+   R
Sbjct: 639 NFGKDR 644

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 5/83 (6%)

Query: 320 APLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAV--CI 377
           AP R  TVY+GNIP   T   L+  ++  G + + K   EK   F+ +     A +    
Sbjct: 230 APSR--TVYLGNIPATITYKALLDYVRT-GVVEEVKILSEKMCAFVSFVDENDALLFHSD 286

Query: 378 VVLANYPFQGRNLKTGWGKEKAV 400
            +L      GR++K GWGK + +
Sbjct: 287 AILKRLNIDGRDIKIGWGKPQPI 309

>KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.491
           YPL043W
          Length = 682

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 50/82 (60%), Gaps = 1/82 (1%)

Query: 165 LFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAM 224
           L  LFV  +   V DE L   F+ F     A V+ D+   +SRG+GF+SF+++ED + A+
Sbjct: 16  LQTLFVRAIPFAVTDEQLTEFFANFAPTKHAVVVKDVNK-KSRGFGFVSFASEEDTKEAL 74

Query: 225 DKMQSTELNGRQIRINWASKRE 246
            K +  +LNG+ +R++ A +RE
Sbjct: 75  LKARKEKLNGQLLRVDIAKRRE 96

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/191 (18%), Positives = 80/191 (41%), Gaps = 30/191 (15%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDADVAFKNLN 139
           L+V  +  ++ +E L ++F    P  +  V+ D N  S  + FV +    D   A     
Sbjct: 19  LFVRAIPFAVTDEQLTEFFANFAPTKHAVVVKDVNKKSRGFGFVSFASEEDTKEALLKAR 78

Query: 140 GKTIETKVLKINWAFQSQQTTSDESLFN--------------------LFVGDLNVDV-- 177
            + +  ++L+++ A + ++    E   N                     F G   + +  
Sbjct: 79  KEKLNGQLLRVDIAKRRERNKRKEDASNGIAAPKPEHKEKRTYGDEDDQFKGKPKLIIRN 138

Query: 178 ------DDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTE 231
                 D  TL + F  F + V AH+    + G+  G+ F++ +   + + A++  +  +
Sbjct: 139 MPWSCRDPNTLKNIFGRFGTVVDAHIPR-KRDGKLCGFAFVTMNKISNCKNALENTKDLK 197

Query: 232 LNGRQIRINWA 242
           ++GRQ+ +++A
Sbjct: 198 IDGRQVAVDFA 208

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/52 (23%), Positives = 31/52 (59%)

Query: 166 FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQ 217
           +++F+ ++  +   E+L   F++F     A  ++D +TG ++G  F++F ++
Sbjct: 290 YSIFIRNVPYEATSESLAEHFAKFGPVKYALPVFDKETGLAKGTAFVAFKDE 341

>Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON}
           (325215..327119) [1905 nt, 635 aa]
          Length = 634

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 87/178 (48%), Gaps = 11/178 (6%)

Query: 59  EDDSDVVPANAINGGRETSDKI-LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN- 116
           E+  D+ P N  N   E+   I LY+G+L+K + E+ LK +F +   + +VK+  D ++ 
Sbjct: 80  ENLDDIAPKN--NNVIESKQSIALYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSG 137

Query: 117 -SVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNV 175
            S+ Y ++      +AD   +  N   I  KV++I  + ++ QT  +    N+F  DL +
Sbjct: 138 ESLGYGYLNLTTKEEADDLMERFNYTPIFGKVVRIMPSLRNSQTRKNMGT-NVFFSDLPL 196

Query: 176 DVDDETLGHAFSEFPSFVQAHV-MWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTEL 232
                T      +F +F +A+  +   +   S+  GFI F N+  A+  + K  + EL
Sbjct: 197 SEKSITT----RDFYNFFKAYGNILSCKLNTSKNIGFIFFENESSAKEVISKFNANEL 250

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 42/72 (58%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           L++GDL   V ++ L + F+ + S +   +  D  +G S GYG+++ + +E+A   M++ 
Sbjct: 101 LYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEEADDLMERF 160

Query: 228 QSTELNGRQIRI 239
             T + G+ +RI
Sbjct: 161 NYTPIFGKVVRI 172

>ZYRO0F08294g Chr6 complement(670688..672832) [2145 bp, 714 aa] {ON}
           similar to uniprot|P37838 Saccharomyces cerevisiae
           YPL043W NOP4 Nucleolar protein essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis contains four RNA recognition motifs
           (RRMs)
          Length = 714

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 50/87 (57%), Gaps = 1/87 (1%)

Query: 162 DESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQ 221
           D  +  LFV  +  +  DE L   FS F     A ++ D +  +SRG+GF+SF+ ++D  
Sbjct: 23  DVDMKTLFVRSIPPNTTDEDLSVFFSNFAPIKHAVLVKD-KNQKSRGFGFVSFAVEDDTM 81

Query: 222 TAMDKMQSTELNGRQIRINWASKRENA 248
            A+ + + T+LNG Q+R++ A +R  +
Sbjct: 82  EALKQARRTKLNGHQVRVDLAKRRHRS 108

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%)

Query: 166 FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQE 218
           +++FV ++  D  +E+L   F +F     A  + D +TG +RG  FI+F N++
Sbjct: 309 YSVFVKNVPYDATEESLAEHFEKFGPVKYALPVIDRETGLARGTAFIAFRNKQ 361

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 40/198 (20%), Positives = 80/198 (40%), Gaps = 35/198 (17%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDADVAFK- 136
           K L+V ++  +  +E L  +F    PI +  ++ DKN  S  + FV +    D   A K 
Sbjct: 27  KTLFVRSIPPNTTDEDLSVFFSNFAPIKHAVLVKDKNQKSRGFGFVSFAVEDDTMEALKQ 86

Query: 137 ----NLNGKTIETKVLKI-------NWAFQSQQTTSDESLFN-------------LFVGD 172
                LNG  +   + K        +   Q QQ  ++  +               L  G 
Sbjct: 87  ARRTKLNGHQVRVDLAKRRHRSGKNDEGAQHQQQAAEVHIARHNEGDHEDDDEDALLKGK 146

Query: 173 LNVDV--------DDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAM 224
             + +        D E L   F ++   V+A +      G+ RG+ F++     + + A+
Sbjct: 147 PKIIIRNMPWSCRDPEKLKSIFGKYGLVVEATIPRK-PNGQLRGFAFVTMKKISNCKKAI 205

Query: 225 DKMQSTELNGRQIRINWA 242
           +  ++ +++GR + +++A
Sbjct: 206 EDSKNLKIDGRPVAVDFA 223

>CAGL0L12672g Chr12 complement(1361933..1363981) [2049 bp, 682 aa]
           {ON} similar to uniprot|P37838 Saccharomyces cerevisiae
           YPL043w nucleolar protein
          Length = 682

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 51/84 (60%), Gaps = 1/84 (1%)

Query: 165 LFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAM 224
           +  LFV  +   V DE L   FS F     A V+ D+   +SRG+GF+SF+ ++D + A+
Sbjct: 21  MKTLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNK-KSRGFGFVSFAVEDDTKIAL 79

Query: 225 DKMQSTELNGRQIRINWASKRENA 248
            + + T+L+G Q++++ A +R+ +
Sbjct: 80  KEARKTKLDGAQLKVDIARRRDRS 103

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/199 (19%), Positives = 79/199 (39%), Gaps = 35/199 (17%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDADVAFKN 137
           K L+V ++ +S+ +E L  +F    PI +  V+ D N  S  + FV +    D  +A K 
Sbjct: 22  KTLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKE 81

Query: 138 LNGKTIETKVLKINWAF----------QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFS 187
                ++   LK++ A           +S Q   D +      GD N +  +E       
Sbjct: 82  ARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLK 141

Query: 188 EFPSFVQAHVMW-------------------DMQTGRSR-----GYGFISFSNQEDAQTA 223
             P  +  ++ W                   D    R R     G+ F++ +   + + A
Sbjct: 142 GKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKA 201

Query: 224 MDKMQSTELNGRQIRINWA 242
           ++  ++  ++GR++ +++A
Sbjct: 202 LEDTKNLTIDGRKVAVDFA 220

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 34/60 (56%)

Query: 166 FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMD 225
           F++FV ++  D  +E+L   FS+F     A  + D  TG ++G  F++F +++  +  +D
Sbjct: 290 FSVFVRNVPYDATEESLFDHFSKFGPVKYALPVIDKNTGLAKGTAFVAFKDEKTYKYCVD 349

>NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.491
           YPL043W
          Length = 702

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFV  + +DV DE L   FS F     A V+ D+   +SRG+GF+SF+ ++D + A+ + 
Sbjct: 28  LFVRSIPMDVTDEELADYFSNFAPTKHAVVVKDVNK-KSRGFGFVSFAVEDDTKEALKQA 86

Query: 228 QSTELNGRQIRINWASKRENA 248
           +  +L G  +R++ A +R+ +
Sbjct: 87  RKAKLKGHLLRVDIAKRRDRS 107

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/195 (18%), Positives = 80/195 (41%), Gaps = 32/195 (16%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDADVAFKN 137
           K L+V ++   + +E L  YF    P  +  V+ D N  S  + FV +    D   A K 
Sbjct: 26  KTLFVRSIPMDVTDEELADYFSNFAPTKHAVVVKDVNKKSRGFGFVSFAVEDDTKEALKQ 85

Query: 138 LNGKTIETKVLKINWAFQSQQTTS--------DESLFNLFVGDLNVDVDDET-------- 181
                ++  +L+++ A +  ++           ++  +    D N +VD+E+        
Sbjct: 86  ARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTDTIARDENEEVDEESLLKGKPKL 145

Query: 182 --------------LGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
                         L   FS F + V+A +    + G+  G+ F++     +   A++  
Sbjct: 146 IIRNMPWSCRDPNQLKKIFSRFGTVVEASI-PKKRDGKLCGFAFVTMKKLSNCTIALENT 204

Query: 228 QSTELNGRQIRINWA 242
           +  +++GR + +++A
Sbjct: 205 KDLKIDGRSVAVDFA 219

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%)

Query: 166 FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQ 217
           F++FV ++  D  +E+L   FS+F     A  + D  TG ++G  F++F + 
Sbjct: 303 FSIFVRNVPYDATEESLAAHFSKFGQVKYALPVIDRTTGLAKGTAFVAFRDH 354

>TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON}
           Anc_7.159 YIR005W
          Length = 167

 Score = 53.5 bits (127), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 66/116 (56%), Gaps = 6/116 (5%)

Query: 134 AFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFV 193
           A + +N   + + +L  N ++ ++    D +   +F+G LNV++ +  +   FS++   V
Sbjct: 6   AIQRINDTELSSGILSPNLSWHNE--YKDRAY--IFIGGLNVELTEADILTIFSQYGIPV 61

Query: 194 QAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRIN--WASKREN 247
              ++ D +TG S+G+G++ + +Q  A  A+D +  +++ GR I+++  W + R++
Sbjct: 62  DVFLVRDRETGDSKGFGYLKYEDQRSAVLAIDNLNGSKIAGRIIKVDHAWYTPRDD 117

>TBLA0A01570 Chr1 (364733..366961) [2229 bp, 742 aa] {ON} Anc_8.491
           YPL043W
          Length = 742

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 50/91 (54%), Gaps = 1/91 (1%)

Query: 156 SQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFS 215
           S  T +D     LFV  + +D  D  L   FS F     A ++ D Q  RSRG+GF++F+
Sbjct: 24  SNSTDNDLDFKTLFVRSIPLDTTDGELADYFSNFAPIRHAVIVKDDQK-RSRGFGFVTFA 82

Query: 216 NQEDAQTAMDKMQSTELNGRQIRINWASKRE 246
            +ED + A+ + + T+L    IR++ A +R+
Sbjct: 83  VEEDTKEALKQARKTKLKNHLIRVDIAKRRD 113

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 149 KINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRG 208
           KI    +S+Q   ++  F++FV ++  D  +E+L   F++F     A  + D +TG ++G
Sbjct: 300 KIEQQEKSKQNRRED--FSVFVRNVPYDASEESLVEHFTKFGPVKYALPVIDRETGLAKG 357

Query: 209 YGFISFSNQE 218
             F++F N++
Sbjct: 358 TAFVAFRNKD 367

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/202 (18%), Positives = 82/202 (40%), Gaps = 39/202 (19%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVI-NDKNNSVNYAFVEYLQHHDADVAFKN 137
           K L+V ++     +  L  YF    PI +  ++ +D+  S  + FV +    D   A K 
Sbjct: 34  KTLFVRSIPLDTTDGELADYFSNFAPIRHAVIVKDDQKRSRGFGFVTFAVEEDTKEALKQ 93

Query: 138 LNGKTIETKVLKINWAFQ---------SQQTTSDESLFNLFV----GDLNVDVDDE---- 180
                ++  +++++ A +         S+Q ++D++     V    G+ N D +D     
Sbjct: 94  ARKTKLKNHLIRVDIAKRRDRNKTKASSEQISNDQNSEKKQVIDNHGEYNNDNEDPEDSE 153

Query: 181 --------------------TLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDA 220
                                L   FS F + V A +    + G+  G+ F++     + 
Sbjct: 154 FKGKPKLIIRNMPWSCRDPIKLKKIFSRFGNVVDASIPR-KRDGKLCGFAFVTMKKISNC 212

Query: 221 QTAMDKMQSTELNGRQIRINWA 242
           + A++  +  +++GR + +++A
Sbjct: 213 RIALENTKDLKIDGRAVAVDFA 234

>Skud_8.67 Chr8 (116061..118019) [1959 bp, 652 aa] {ON} YHR015W
           (REAL)
          Length = 652

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 48/83 (57%)

Query: 157 QQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSN 216
           +++T +  + +LF+G L   V +E L   F ++ SF  A +  D  T +S GYG+++F N
Sbjct: 102 KKSTKNSRMSSLFIGKLKSTVTEEMLRKTFKKYQSFESAKICRDFLTKKSLGYGYLNFGN 161

Query: 217 QEDAQTAMDKMQSTELNGRQIRI 239
           ++DA+ A  +       G++++I
Sbjct: 162 KKDAEAAKKEFNYRIFFGQEVKI 184

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 70/164 (42%), Gaps = 16/164 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYLQHHDADVAFKNL 138
           L++G L  ++ EE L++ F+      + K+  D     S+ Y ++ +    DA+ A K  
Sbjct: 113 LFIGKLKSTVTEEMLRKTFKKYQSFESAKICRDFLTKKSLGYGYLNFGNKKDAEAAKKEF 172

Query: 139 NGKTIETKVLKI-----NWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFV 193
           N +    + +KI     N  F+    T      N+F  +L +D + +    +F  +   +
Sbjct: 173 NYRIFFGQEVKIMPSMKNTLFRKNIGT------NVFFSNLPLD-NPQLTTRSF--YLIMI 223

Query: 194 QAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
           +   +      + +  GF+ F N   A+  + K  + E  G ++
Sbjct: 224 EYGNVLSCLLEKRKNIGFVYFDNDISARNVIKKYNNQEFFGSKV 267

>Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL250W
          Length = 675

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 47/81 (58%), Gaps = 1/81 (1%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFV ++     D  L   FS+F     A ++ D   G SRG+GF+SF+  ED QTA+++ 
Sbjct: 18  LFVRNIPFTATDAELTDFFSQFAPLKHAIIVKDGD-GNSRGFGFVSFAVDEDTQTALNEG 76

Query: 228 QSTELNGRQIRINWASKRENA 248
           +  +  GR +R++ A +RE +
Sbjct: 77  RKMKFQGRLLRVDIAKRRERS 97

>NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408
          Length = 435

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 75/188 (39%), Gaps = 30/188 (15%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNL-- 138
           ++VGNL      E L+ YF   G +    +I  K +      VE+    D + A +    
Sbjct: 107 IFVGNLTYDCTPEDLRDYFSGIGEVVRADIITSKGHHRGMGTVEFTNSRDVEEAIRQYDS 166

Query: 139 ------------------NGKTIETKVLKINWAFQSQQTTSDESL---------FNLFVG 171
                             NG+   T   +       QQ  S  +          + +FV 
Sbjct: 167 SYFMDRQIFVRQDNPPPDNGRNERTPSRRTTAPSSRQQDISSGAYSMQSNMKQGYEIFVA 226

Query: 172 DLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTE 231
           +L   ++ + L   F E    ++A V  D + GRSRG+G + F  ++D + A+D+    E
Sbjct: 227 NLPYSINWQALKDMFKECGDVMRADVELD-RAGRSRGFGTVIFRTRDDMERAIDRYNRFE 285

Query: 232 LNGRQIRI 239
           ++GR + +
Sbjct: 286 VDGRTLDV 293

 Score = 37.0 bits (84), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 3/85 (3%)

Query: 70  INGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN-SVNYAFVEYLQH 128
           + GG   +  ++Y  NL  S     L   F+  G + N ++  D+N  +   A VE++  
Sbjct: 350 VEGGERNT--LIYCSNLPPSTARSDLYDLFESIGKVRNAELKYDRNGETTGVAIVEFISQ 407

Query: 129 HDADVAFKNLNGKTIETKVLKINWA 153
            DADV  + LN        L+I++A
Sbjct: 408 DDADVCIERLNKYNYGGCDLEISYA 432

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 38/80 (47%), Gaps = 5/80 (6%)

Query: 323 RVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEK-----GNCFIKYDTHEQAAVCI 377
           R T +Y  N+P     +DL  L ++ G + + +   ++     G   +++ + + A VCI
Sbjct: 355 RNTLIYCSNLPPSTARSDLYDLFESIGKVRNAELKYDRNGETTGVAIVEFISQDDADVCI 414

Query: 378 VVLANYPFQGRNLKTGWGKE 397
             L  Y + G +L+  + K 
Sbjct: 415 ERLNKYNYGGCDLEISYAKR 434

>KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.797
           YOR319W
          Length = 212

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 85/184 (46%), Gaps = 17/184 (9%)

Query: 76  TSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADV 133
           + ++ +YVGN+D  +N+E L + F   G I  +    DK  +    YAF+E+L     D 
Sbjct: 4   SKERTVYVGNIDPRVNKEDLYELFVQFGRIKKINYPRDKVLDTHQGYAFIEFLNDSTVDY 63

Query: 134 AFK---NLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDL--------NVD--VDDE 180
             K   N N  ++  + LKI  +   ++  ++ +  N+ V  L        NVD  VD  
Sbjct: 64  VLKLFGNTNLVSLYERSLKIRKSENGKEANANGTNKNIDVDMLPIAKIIVKNVDESVDIM 123

Query: 181 TLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRIN 240
            L    S+F    +   +  M  G     GF+ F + +D+  A+DK+ +  +  ++I + 
Sbjct: 124 KLNKICSKFGKLARDSDIVTMSNGMR--CGFVHFRDYKDSDLAIDKLNNELIVNKRISVE 181

Query: 241 WASK 244
           +A K
Sbjct: 182 YALK 185

>KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.357
           YHR015W
          Length = 365

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 48/79 (60%)

Query: 161 SDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDA 220
           + +S+ +LF+G+L+ +V +E L   F  +P F+ A + ++  T +S G+G+++FSN+ DA
Sbjct: 87  ASDSMESLFIGNLHKNVTEELLRGVFGVYPGFISAKICYNAITKKSLGHGYLNFSNKIDA 146

Query: 221 QTAMDKMQSTELNGRQIRI 239
             A   +    +   +IR+
Sbjct: 147 IRATKDLNYCNILSSEIRL 165

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 84/190 (44%), Gaps = 18/190 (9%)

Query: 66  PANAINGGRETSDKI--LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYA 121
           P   +   +  SD +  L++GNL K++ EE L+  F +     + K+  +     S+ + 
Sbjct: 77  PGVTMATNKLASDSMESLFIGNLHKNVTEELLRGVFGVYPGFISAKICYNAITKKSLGHG 136

Query: 122 FVEYLQHHDADVAFKNLNGKTIETKVLKI-----NWAFQSQQTTSDESLFNLFVGDLNVD 176
           ++ +    DA  A K+LN   I +  +++     N A++ Q  T      N+F+ +L +D
Sbjct: 137 YLNFSNKIDAIRATKDLNYCNILSSEIRLMPSMRNAAYRKQIGT------NVFMSNLPLD 190

Query: 177 VDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQ 236
           +   T    +  F  F +   +   +    +G GFI F +   A   ++    + L G+Q
Sbjct: 191 IPFLTTRFFYVYFSGFGE---VLSCKLVEEKGIGFIYFESNTVANYVVNLFNGSLLYGKQ 247

Query: 237 IRINWASKRE 246
           +  +    +E
Sbjct: 248 VFCSIHKSKE 257

>NDAI0G05970 Chr7 complement(1475760..1477595) [1836 bp, 611 aa]
           {ON} Anc_1.357 YFR023W
          Length = 611

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (56%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           L++G L+ DV +ETL  AF ++ +     +  D  T  S GYG+++FSN  +A   +D  
Sbjct: 103 LYIGGLSKDVTEETLFEAFEDYKTLASIKICRDSVTNESLGYGYLNFSNSVEATKLIDDY 162

Query: 228 QSTELNGRQIRI 239
             T L G +I+I
Sbjct: 163 NYTNLFGNEIKI 174

 Score = 37.0 bits (84), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 69/164 (42%), Gaps = 16/164 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDA-----DV 133
           LY+G L K + EETL + F+    ++++K+  D   N S+ Y ++ +    +A     D 
Sbjct: 103 LYIGGLSKDVTEETLFEAFEDYKTLASIKICRDSVTNESLGYGYLNFSNSVEATKLIDDY 162

Query: 134 AFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFV 193
            + NL G  I+      N  ++    T      N+F  +L ++    T    +  F  + 
Sbjct: 163 NYTNLFGNEIKIMPSMRNTLYRKNIGT------NVFFSNLPLENKQLTTRKFYDTFKKYG 216

Query: 194 QAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
           +   +   +    +  GF+ F N + A  A+    +    G +I
Sbjct: 217 E---ILSCKLDSRKNIGFVYFENDKAALQAIKDYNNKVFFGNKI 257

 Score = 30.4 bits (67), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 29/164 (17%), Positives = 73/164 (44%), Gaps = 6/164 (3%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNV---KVINDKNNSVNYAFVEYLQHHDADVAFKN 137
           +++ NL  + N++ +  +F   GP+ +V   +V+  K NS+ +AFV Y +  D ++A + 
Sbjct: 313 VFIKNLPMTTNDDEILDFFSKIGPVKSVFASQVL--KYNSL-WAFVTYKKSSDTELAIQK 369

Query: 138 LNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHV 197
           L+    + + + +  A   +          +++ +L+   ++  +     +    VQ   
Sbjct: 370 LDQTYFKDRAISVTKAKSKKTNFKIHDKKTVYLKNLSPICNERFIERICLQERIRVQKIS 429

Query: 198 MWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINW 241
           +  +        GF++   + DA    + M    + G  ++++W
Sbjct: 430 VDPISPDILTNTGFVTCKTEVDANKLFNFMDKRLIGGCSVQVSW 473

>YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-snRNP
           associated splicing factor with similarity to the
           mammalian splicing factor SAP49; proposed to function as
           a U2-snRNP assembly factor along with Hsh155p and
           binding partner Cus1p; contains two RNA recognition
           motifs (RRM)
          Length = 213

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 83/180 (46%), Gaps = 13/180 (7%)

Query: 77  SDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVA 134
           S   +YVGN+D  I +E L + F    P+  +K   DK       YAF+E+    DA  A
Sbjct: 7   SGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYA 66

Query: 135 FKNLNGKT-IETKVLKINWAFQSQQTTSDES---------LFNLFVGDLNVDVDDETLGH 184
            K +N    +  +++K+     S  TT+  S         +  LF+ +L   +D + L  
Sbjct: 67  IKIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVK 126

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F++F   ++   ++ +  G+ +   ++ F + E A  A+  + +  +   +I +++A K
Sbjct: 127 IFNKFGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRITVDYAFK 185

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           ++VG+++  +  E L   F +    ++     D      +GY FI F NQ DAQ A+  M
Sbjct: 11  VYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIM 70

Query: 228 QST-ELNGRQIRINWASKRENAT 249
            +T  L  R I++   +     T
Sbjct: 71  NNTVRLYDRLIKVRQVTNSTGTT 93

>YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putative
           RNA-binding protein, interacts with Mex67p, which is a
           component of the nuclear pore involved in nuclear mRNA
           export
          Length = 659

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 42/72 (58%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LF+G+L   V +E L   F  + SF  A V  D  T +S GYG+++F ++ DA++A  + 
Sbjct: 113 LFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEF 172

Query: 228 QSTELNGRQIRI 239
             T   G++++I
Sbjct: 173 NYTVFFGQEVKI 184

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 71/164 (43%), Gaps = 16/164 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYLQHHDADVAFKNL 138
           L++GNL  ++ EE L++ F+      + KV  D     S+ Y ++ +   +DA+ A K  
Sbjct: 113 LFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEF 172

Query: 139 NGKTIETKVLKI-----NWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFV 193
           N      + +KI     N  F+    T      N+F  +L ++ + +    +F  +   +
Sbjct: 173 NYTVFFGQEVKIMPSMKNTLFRKNIGT------NVFFSNLPLE-NPQLTTRSF--YLIMI 223

Query: 194 QAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
           +   +      R +  GF+ F N   A+  + K  + E  G +I
Sbjct: 224 EYGNVLSCLLERRKNIGFVYFDNDISARNVIKKYNNQEFFGNKI 267

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 41/86 (47%), Gaps = 5/86 (5%)

Query: 62  SDVVPANAINGGRETSD----KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNS 117
           SD+V  + +      SD    K + V NL     +E +  YF   GPI +V +   + N+
Sbjct: 292 SDIVIEDELLASNNLSDNARSKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEKQANT 351

Query: 118 VNYAFVEYLQHHDADVAFKNLNGKTI 143
            + AFV Y    ++  A K LN KTI
Sbjct: 352 PHKAFVTYKNEEESKKAQKCLN-KTI 376

>CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar to
           uniprot|Q99181 Saccharomyces cerevisiae YOR319w
           essential yeast splicing factor
          Length = 211

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 77/177 (43%), Gaps = 14/177 (7%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNL 138
           +YVGN+D  + +E L + F   G +  VK   DK       +AF+E+    DAD     +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 139 NGKT-IETKVLKINWAFQSQQTTS-------DESLF---NLFVGDLNVDVDDETLGHAFS 187
           N    +  KVLKI  + Q+ Q          D SL     +FV D+   V+   L   FS
Sbjct: 68  NNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQLFS 127

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
           +F    +   ++ +  G  R   FI F   ++A  A+  +    +  ++  + +A K
Sbjct: 128 KFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIMNKKASLEYAFK 183

>Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 nt,
           265 aa]
          Length = 264

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 167 NLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDK 226
           NLFV +L+  VDDE L   FS F + + A VM   + G+S+ +GF+ FS  E+A  A+ +
Sbjct: 22  NLFVKNLDDSVDDEKLQEEFSPFGTIISAKVMR-TEDGKSKNFGFVCFSTPEEATRAITE 80

Query: 227 MQSTELNGRQIRINWASKRE 246
                + G+ + +  A ++E
Sbjct: 81  KNQQIVAGKPLYVAIAQRKE 100

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN-NSVNYAFVEYLQHHDADVAFKNLN 139
           L+V NLD S+++E L++ F   G I + KV+  ++  S N+ FV +    +A  A    N
Sbjct: 23  LFVKNLDDSVDDEKLQEEFSPFGTIISAKVMRTEDGKSKNFGFVCFSTPEEATRAITEKN 82

Query: 140 GKTIETKVLKINWA 153
            + +  K L +  A
Sbjct: 83  QQIVAGKPLYVAIA 96

>TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.104
           YBR212W
          Length = 608

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 68/151 (45%), Gaps = 29/151 (19%)

Query: 120 YAFVEYLQHHDADVA------------------FKNLNGKTIETKVLKINWA----FQSQ 157
           Y FVE+    D   A                  + N NG+    +  ++NWA     QS 
Sbjct: 121 YCFVEFESQQDVIAALSLNKAVIPNIFSESINLYTNPNGR----RTFRLNWASGATLQSL 176

Query: 158 QTTSDESLFNLFVGDLN-VDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSN 216
              + E  ++LF+GDL+ +  + + L     ++ S     VM D   G SRG+GFI FS+
Sbjct: 177 IPATPE--YSLFIGDLSPLTTEADILSIFQKKYKSVKTVRVMTDPINGSSRGFGFIRFSD 234

Query: 217 QEDAQTAMDKMQSTELNGRQIRINWASKREN 247
           +++ + A++ M     + R  R+  A+ R N
Sbjct: 235 EDERKDALENMNGVMCHSRYFRLALATPRTN 265

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 2/73 (2%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNC-FIKYDTHEQAAVCIVVLANY 383
           TTV+IG +     E +L  L + FG IL  K  P   NC F+K+    +A   I  +  +
Sbjct: 342 TTVFIGGLSTSTNEYELQVLFEPFGNILSVKI-PIGKNCGFVKFKRKIEANAAIKGMQGF 400

Query: 384 PFQGRNLKTGWGK 396
              G  ++  WGK
Sbjct: 401 IINGNPIRLSWGK 413

 Score = 37.4 bits (85), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 162 DESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQ 221
           D S   +F+G L+   ++  L   F  F + +   +         +  GF+ F  + +A 
Sbjct: 338 DNSNTTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPI------GKNCGFVKFKRKIEAN 391

Query: 222 TAMDKMQSTELNGRQIRINWASKRENAT 249
            A+  MQ   +NG  IR++W     NA+
Sbjct: 392 AAIKGMQGFIINGNPIRLSWGKSNNNAS 419

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 4/79 (5%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVA 134
           + S+  +++G L  S NE  L+  F+  G I +VK+   K    N  FV++ +  +A+ A
Sbjct: 338 DNSNTTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPIGK----NCGFVKFKRKIEANAA 393

Query: 135 FKNLNGKTIETKVLKINWA 153
            K + G  I    ++++W 
Sbjct: 394 IKGMQGFIINGNPIRLSWG 412

>AAL018W Chr1 (309542..310555) [1014 bp, 337 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL004W (HRB1) and
           YCL011C (GBP2)
          Length = 337

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 70/172 (40%), Gaps = 14/172 (8%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNG 140
           +++GNL      E L+Q F   G +    +I  + +      VEY    D D A +  NG
Sbjct: 9   VFIGNLTYDTTPEDLRQLFGEVGHVVRADIITSRGHHRGMGTVEYTNAQDVDEAIRRFNG 68

Query: 141 KTIETKVLKINW-----AFQSQQTTSDESL--------FNLFVGDLNVDVDDETLGHAFS 187
                + L +         + ++      L        F +FV +L   +  +TL   F 
Sbjct: 69  MDFMHRELFVRRDNPPPVGERRERRGPGPLPRRTHPGGFEIFVANLPYSISWQTLKDMFK 128

Query: 188 EFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           E    + A V  D   G SRG+G +  + +E+   A+++    EL GR + +
Sbjct: 129 ECSEVIHADVSVDAD-GYSRGFGTVYVTTRENQIAAIERWNGYELEGRILEV 179

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 167 NLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDK 226
           ++F+G+L  D   E L   F E    V+A ++     G  RG G + ++N +D   A+ +
Sbjct: 8   SVFIGNLTYDTTPEDLRQLFGEVGHVVRADII--TSRGHHRGMGTVEYTNAQDVDEAIRR 65

Query: 227 MQSTELNGRQI 237
               +   R++
Sbjct: 66  FNGMDFMHREL 76

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 5/73 (6%)

Query: 327 VYIGNIPHFATEADLIPLLQNFGFIL--DFKYYPE---KGNCFIKYDTHEQAAVCIVVLA 381
           +Y  N+P    E+DL  L +  G +L  + +Y  E    G+   +++T   A  CI  L 
Sbjct: 261 IYCENMPLATAESDLYDLFETAGKVLRANLQYDSEGNPTGSSVCEFETVADAQECIERLN 320

Query: 382 NYPFQGRNLKTGW 394
           NY + G +LK  +
Sbjct: 321 NYHYGGCDLKMSY 333

>TPHA0C01740 Chr3 (398136..400229) [2094 bp, 697 aa] {ON} Anc_8.491
           YPL043W
          Length = 697

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 50/84 (59%), Gaps = 1/84 (1%)

Query: 165 LFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAM 224
           L  LFV  + +   D+     FS F     A ++ D    +SRG+GF+SF+++ED+Q A+
Sbjct: 21  LKTLFVRSIPLQTTDDEFTDFFSNFAPLKHAVIVKDTNK-KSRGFGFVSFASEEDSQEAL 79

Query: 225 DKMQSTELNGRQIRINWASKRENA 248
            K +++++    +R+++A +R+ +
Sbjct: 80  TKARTSKIQNHLLRVDFAKRRDRS 103

 Score = 37.0 bits (84), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 39/204 (19%), Positives = 86/204 (42%), Gaps = 41/204 (20%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN-SVNYAFVEYLQHHDADVAFKN 137
           K L+V ++     ++    +F    P+ +  ++ D N  S  + FV +    D+  A   
Sbjct: 22  KTLFVRSIPLQTTDDEFTDFFSNFAPLKHAVIVKDTNKKSRGFGFVSFASEEDSQEALTK 81

Query: 138 LNGKTIETKVLKINWAFQ----------SQQT------TSDESLFNLFVG-DLNVDVDDE 180
                I+  +L++++A +          S+QT      T  +S      G D + D D+E
Sbjct: 82  ARTSKIQNHLLRVDFAKRRDRSKTRTEGSEQTKEIVKKTFKKSATERDDGKDEDKDFDEE 141

Query: 181 T----------------------LGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQE 218
           +                      L + FS + +  +A +    + G+  G+ F++F N  
Sbjct: 142 SSLKGKPKLIIRNMPWSCRDSAKLKNIFSRYGTVDEATIPRK-RDGKLCGFAFVTFKNLA 200

Query: 219 DAQTAMDKMQSTELNGRQIRINWA 242
           + + A++K +  +++GR + +++A
Sbjct: 201 NCKVALEKSKGLKIDGRAVAVDFA 224

>KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {ON}
           Anc_1.357 YHR015W
          Length = 590

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 46/81 (56%)

Query: 159 TTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQE 218
           T  ++ +  L++G L   ++ +TL   F +F S   A V +D  TG S GYG+++F++Q+
Sbjct: 79  TIKNKPMLALYIGGLGKSINSKTLIETFKDFLSLQSAKVCYDSLTGDSLGYGYLNFTSQK 138

Query: 219 DAQTAMDKMQSTELNGRQIRI 239
           +    +DK     + G +I++
Sbjct: 139 ELDKFVDKYNYKRMLGGEIKL 159

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 61/145 (42%), Gaps = 15/145 (10%)

Query: 109 KVINDKNNSVNYA-FVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLF- 166
           KVIND NN+  Y   +    H D D+  +N  G      VL  N   +++    D+    
Sbjct: 227 KVINDFNNTDFYGNKIVCGLHFDKDL--RNYPGFEKRKAVLTGNVVIENELAALDKETAV 284

Query: 167 ---------NLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQ 217
                     +FV +L VDV  + L   FS+F       V     T  +  + FI++  Q
Sbjct: 285 PKNKAPHPNAVFVKNLPVDVTTDELLDYFSQFGPV--KSVYTSRTTQHTSEWAFITYKWQ 342

Query: 218 EDAQTAMDKMQSTELNGRQIRINWA 242
           +DAQ  +D   + E  GR + +  A
Sbjct: 343 KDAQKLLDDFPTVEFRGRTVTVARA 367

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 37/191 (19%), Positives = 80/191 (41%), Gaps = 11/191 (5%)

Query: 54  VGTAAEDDSDVVPANAINGGRETSDK-----ILYVGNLDKSINEETLKQYFQIGGPISNV 108
           V T  ++   V+   A+N    ++ K      LY+G L KSIN +TL + F+    + + 
Sbjct: 56  VKTKEKNACKVINGLAVNKAAISTIKNKPMLALYIGGLGKSINSKTLIETFKDFLSLQSA 115

Query: 109 KVINDK--NNSVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLF 166
           KV  D    +S+ Y ++ +    + D      N K +    +K+  + ++     +    
Sbjct: 116 KVCYDSLTGDSLGYGYLNFTSQKELDKFVDKYNYKRMLGGEIKLMPSLRNSVYRKNIGT- 174

Query: 167 NLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDK 226
           N+F  +L +     +    +  F  + +   +   +    +  GF+ F + + A   ++ 
Sbjct: 175 NVFFSNLPLHNSGLSTRRFYDIFKKYGK---ILSCKLDARKNIGFVYFEDDKAATKVIND 231

Query: 227 MQSTELNGRQI 237
             +T+  G +I
Sbjct: 232 FNNTDFYGNKI 242

>Smik_8.80 Chr8 (114815..116827) [2013 bp, 670 aa] {ON} YHR015W
           (REAL)
          Length = 670

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 47/83 (56%)

Query: 157 QQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSN 216
           +++T +  +  LF+G+L   V +E L   F ++ SF  A +  D  T +S GYG+++F N
Sbjct: 112 KRSTKNLKISTLFIGNLKPTVTEEMLRKIFRKYQSFESAKICRDFLTKKSLGYGYLNFKN 171

Query: 217 QEDAQTAMDKMQSTELNGRQIRI 239
           + + + A  +   T   G++++I
Sbjct: 172 KNETEAARKEFNYTVFFGQEVKI 194

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 9/91 (9%)

Query: 62  SDVVPANAINGGRETSD----KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNS 117
           SD+V  + +   +   D    K +   NL     +E +  +F   GP+ +V +   + N+
Sbjct: 302 SDIVIEDELLASKNLPDNAHLKTIIAKNLPSESTQEEVLNFFSTSGPVKSVFISQKQANA 361

Query: 118 VNYAFVEYLQHHDADVAFKNLN-----GKTI 143
            + AFV Y    D+  A K LN     G+TI
Sbjct: 362 PHRAFVTYKSEEDSKKAQKYLNNTVFKGQTI 392

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 32/161 (19%), Positives = 67/161 (41%), Gaps = 16/161 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYLQHHDADVAFKNL 138
           L++GNL  ++ EE L++ F+      + K+  D     S+ Y ++ +   ++ + A K  
Sbjct: 123 LFIGNLKPTVTEEMLRKIFRKYQSFESAKICRDFLTKKSLGYGYLNFKNKNETEAARKEF 182

Query: 139 N-----GKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFV 193
           N     G+ ++      N  F+    T      N+F  +L +D + +     F  +   +
Sbjct: 183 NYTVFFGQEVKIMPSMKNTLFRKNIGT------NVFFSNLPLD-NPQLTTRKF--YLIMI 233

Query: 194 QAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNG 234
           +   +      + +  GF+ F N   A+  + K  + E  G
Sbjct: 234 EYGNVLSCLLEKRKNIGFVYFDNDISARNVIKKYNNQEFFG 274

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 88/188 (46%), Gaps = 34/188 (18%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDAD--VAF 135
           ++ +Y+GNL K +  E +    + GG + ++K++ND++      FV ++    A    A 
Sbjct: 394 NRTIYLGNLPKDVKLEEICNSVR-GGLLQHIKLLNDRH----VCFVTFIDPTAAAQFYAM 448

Query: 136 KNLNGKTIETKVLKINWAFQSQQTTSDESLF-------NLFVGDLNVDVDDE-------- 180
            +L+G TI  K  KI W   S    +  +L        N+++G  N+D +D+        
Sbjct: 449 SSLHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLG--NIDFEDDRKLEQPIF 506

Query: 181 ---TLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
              +L   F EF    Q + +++      R   FI+F+N   A  A+DK++S     + +
Sbjct: 507 TETSLRSVFQEFGEVEQINFLYE------RNCCFINFANISSAILAIDKIKSIP-TFKDL 559

Query: 238 RINWASKR 245
           +IN+   R
Sbjct: 560 KINFGKDR 567

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 7/84 (8%)

Query: 320 APLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCI-- 377
           AP R  TVY+GN+P + T  +L+  +++ G + D K  PEK   FI +   E +A+    
Sbjct: 153 APSR--TVYLGNVPPYITTRELLDHVRS-GVVEDVKILPEKMCAFISF-VDENSALLFHS 208

Query: 378 -VVLANYPFQGRNLKTGWGKEKAV 400
             +L       R++K GWGK   +
Sbjct: 209 DAILKRLNIDDRDIKIGWGKPTQI 232

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 12/83 (14%)

Query: 327 VYIGNI----------PHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVC 376
           +Y+GNI          P F TE  L  + Q FG +    +  E+  CFI +     A + 
Sbjct: 488 IYLGNIDFEDDRKLEQPIF-TETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILA 546

Query: 377 IVVLANYPFQGRNLKTGWGKEKA 399
           I  + + P   ++LK  +GK++ 
Sbjct: 547 IDKIKSIP-TFKDLKINFGKDRC 568

>NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797
          Length = 219

 Score = 51.2 bits (121), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 90/191 (47%), Gaps = 17/191 (8%)

Query: 70  INGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN--YAFVEYLQ 127
           +N      +  +YVGN+D  + +E L + F    PIS ++   DK   ++  YAF+E+  
Sbjct: 1   MNASLNNPETTVYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYT 60

Query: 128 HHDADVAFKNLNGKT-IETKVLKINWAFQSQQTT---------SDESLF----NLFVGDL 173
             D     + +N    +  + LK+  + Q+  ++         S++S+      LFV +L
Sbjct: 61  AKDVQYVIQVMNNTVALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNL 120

Query: 174 NVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELN 233
           +  +++  L   F +F    +   ++ +  G+ R   +I F   E++  A+ K+ +  + 
Sbjct: 121 DESIENPQLIKLFQKFGPLFKDPEIFFLSNGKLRC-AYIYFKFYENSDMAIAKLNNELIV 179

Query: 234 GRQIRINWASK 244
            ++I +++A K
Sbjct: 180 NKRINVDYAFK 190

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPI-SNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLN 139
           L+V NLD+SI    L + FQ  GP+  + ++    N  +  A++ +  + ++D+A   LN
Sbjct: 115 LFVKNLDESIENPQLIKLFQKFGPLFKDPEIFFLSNGKLRCAYIYFKFYENSDMAIAKLN 174

Query: 140 GKTIETKVLKINWAFQSQQTTSD 162
            + I  K + +++AF+   +  +
Sbjct: 175 NELIVNKRINVDYAFKENTSNKN 197

>Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to
           Ashbya gossypii AFR649W
          Length = 324

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LF+  LN     E +   F  F   +   ++ D +TG S GYGFI F  +E  + A  KM
Sbjct: 243 LFICKLNPLTKAEHIATIFERFGDVLSVEIVRDKKTGNSLGYGFIEFETKEACEQAYSKM 302

Query: 228 QSTELNGRQIRINWA 242
            +T ++ R+I ++++
Sbjct: 303 DNTLIDDRRIHVDFS 317

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/84 (19%), Positives = 44/84 (52%), Gaps = 2/84 (2%)

Query: 72  GGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN--NSVNYAFVEYLQHH 129
            G + ++ +L++  L+     E +   F+  G + +V+++ DK   NS+ Y F+E+    
Sbjct: 234 AGIKPAENVLFICKLNPLTKAEHIATIFERFGDVLSVEIVRDKKTGNSLGYGFIEFETKE 293

Query: 130 DADVAFKNLNGKTIETKVLKINWA 153
             + A+  ++   I+ + + ++++
Sbjct: 294 ACEQAYSKMDNTLIDDRRIHVDFS 317

>KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.167
           YNL110C
          Length = 220

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%)

Query: 159 TTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQE 218
           T  DE    ++V  L     ++ L   FS+F    +A +  + ++G SR YGF+ F+N+E
Sbjct: 84  TKDDEYSSIIYVSRLPNGFHEKELSKYFSQFGDLKEARLARNKKSGNSRHYGFVEFANKE 143

Query: 219 DAQTAMDKMQSTELNGRQIRINWASK 244
           DA+ A + M +  L G  +R+    K
Sbjct: 144 DAKVAQETMDNYLLMGHLLRVRLMGK 169

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 2/73 (2%)

Query: 80  ILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN--NSVNYAFVEYLQHHDADVAFKN 137
           I+YV  L    +E+ L +YF   G +   ++  +K   NS +Y FVE+    DA VA + 
Sbjct: 92  IIYVSRLPNGFHEKELSKYFSQFGDLKEARLARNKKSGNSRHYGFVEFANKEDAKVAQET 151

Query: 138 LNGKTIETKVLKI 150
           ++   +   +L++
Sbjct: 152 MDNYLLMGHLLRV 164

>Suva_8.370 Chr8 (653473..654114) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 84/181 (46%), Gaps = 15/181 (8%)

Query: 77  SDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVA 134
           S   +YVGN+D  I +E L + F    PI  +K   DK       YAF+E+    DA   
Sbjct: 7   SGSTVYVGNIDPRITKEQLYELFIQINPILRIKYPKDKVLQTYQGYAFIEFHSKEDAQYV 66

Query: 135 FKNLNGKTIE-----TKVLKINWAFQSQQTTSDES------LFNLFVGDLNVDVDDETLG 183
            + +N  T++      KV ++  +  +   +S+ S      +  LFV +L   VD E L 
Sbjct: 67  IQIMNN-TVKLYDRLIKVRQVTNSVGAANASSNNSKGISLPIAKLFVKNLADSVDIEQLE 125

Query: 184 HAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWAS 243
             F++F   V    ++ + TG+ +   ++ F + E A  A+  + +  +   +I +++A 
Sbjct: 126 KIFNKFGKTVNKPEIFHLSTGKLKC-AYVYFEDFEKADMAIKSLNNQLVANNRITVDYAF 184

Query: 244 K 244
           K
Sbjct: 185 K 185

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 161 SDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDA 220
           S +S   ++VG+++  +  E L   F +    ++     D      +GY FI F ++EDA
Sbjct: 4   STDSGSTVYVGNIDPRITKEQLYELFIQINPILRIKYPKDKVLQTYQGYAFIEFHSKEDA 63

Query: 221 QTAMDKMQST-ELNGRQIRI 239
           Q  +  M +T +L  R I++
Sbjct: 64  QYVIQIMNNTVKLYDRLIKV 83

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEK------GNCFIKYDTHEQAAVCIV 378
           +TVY+GNI    T+  L  L      IL  KY  +K      G  FI++ + E A   I 
Sbjct: 9   STVYVGNIDPRITKEQLYELFIQINPILRIKYPKDKVLQTYQGYAFIEFHSKEDAQYVIQ 68

Query: 379 VLAN 382
           ++ N
Sbjct: 69  IMNN 72

>SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} similar
           to uniprot|P37838 Saccharomyces cerevisiae YPL043W NOP4
           Nucleolar protein essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis contains four RNA recognition motifs (RRMs)
          Length = 697

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 54/94 (57%), Gaps = 3/94 (3%)

Query: 157 QQTTSDESL--FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISF 214
           +Q+ +D+ L    LFV  +  D +DE     FS+F     + ++ D +  +SRG+GF+SF
Sbjct: 15  KQSPNDDGLDMKTLFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEK-QSRGFGFVSF 73

Query: 215 SNQEDAQTAMDKMQSTELNGRQIRINWASKRENA 248
           + ++D + A+ + +  +   R +RI+ A +RE +
Sbjct: 74  AVEDDTKEALAQARKAKFKNRLLRIDIAKRRERS 107

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/186 (19%), Positives = 77/186 (41%), Gaps = 23/186 (12%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVIND-KNNSVNYAFVEYLQHHDADVAFKN 137
           K L+V ++    N+E    +F    PI +  ++ D +  S  + FV +    D   A   
Sbjct: 26  KTLFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEALAQ 85

Query: 138 LNGKTIETKVLKINWAFQSQQTTSDESL-------------FNLFVGDLNVDV------- 177
                 + ++L+I+ A + +++  +E                 L  G   + +       
Sbjct: 86  ARKAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKPKLIIRNMPWSC 145

Query: 178 -DDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQ 236
            D   L   FS F + V+A +      G+  G+ F++       + A+++ +  +++GRQ
Sbjct: 146 RDAAVLKKLFSRFGTVVEAKIPKKA-GGKLCGFAFVTMKKLSACKRAIEEGKDMKIDGRQ 204

Query: 237 IRINWA 242
           + I++A
Sbjct: 205 VAIDFA 210

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 34/64 (53%)

Query: 155 QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISF 214
           Q +Q  + +  F++FV ++  D   E+L   F +F     A  + D +TG ++G  F++F
Sbjct: 287 QPRQKKNKQESFSIFVRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAF 346

Query: 215 SNQE 218
             +E
Sbjct: 347 KTEE 350

>ZYRO0B09790g Chr2 (765258..765854) [597 bp, 198 aa] {ON} similar to
           uniprot|P53927 Saccharomyces cerevisiae YNL110C NOP15
           Constituent of 66S pre-ribosomal particles involved in
           60S ribosomal subunit biogenesis localizes to both
           nucleolus and cytoplasm
          Length = 198

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%)

Query: 155 QSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISF 214
           Q Q ++ DE    +FV  L     ++ L   FS+F     A +  + +TG +R YGFI F
Sbjct: 58  QQQNSSQDEYSGIVFVSRLPHGFQEKELSKYFSQFGDLKDARLARNKKTGNTRHYGFIEF 117

Query: 215 SNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            N++DA+ A + M +  L G  I++    K
Sbjct: 118 VNKDDAKVAQETMNNYLLMGHLIQVRLLPK 147

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 40/76 (52%), Gaps = 7/76 (9%)

Query: 80  ILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN--NSVNYAFVEYLQHHDADVAFKN 137
           I++V  L     E+ L +YF   G + + ++  +K   N+ +Y F+E++   DA VA + 
Sbjct: 70  IVFVSRLPHGFQEKELSKYFSQFGDLKDARLARNKKTGNTRHYGFIEFVNKDDAKVAQET 129

Query: 138 LN-----GKTIETKVL 148
           +N     G  I+ ++L
Sbjct: 130 MNNYLLMGHLIQVRLL 145

>KAFR0A00980 Chr1 complement(182578..184506) [1929 bp, 642 aa] {ON}
           Anc_1.357 YHR015W
          Length = 642

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (54%), Gaps = 5/86 (5%)

Query: 154 FQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFIS 213
           F+SQ+  +      LF+G L   V +  L   F++F S     + +D +T +S GYG+++
Sbjct: 88  FKSQKKVTP-----LFIGGLGPHVTESMLKELFNKFSSLYSVKICYDSETKKSLGYGYLN 142

Query: 214 FSNQEDAQTAMDKMQSTELNGRQIRI 239
           FS  ++    +++   TE+ G +I+I
Sbjct: 143 FSGSDEIDRVIEEFNYTEVFGSEIKI 168

>TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON}
           Anc_1.102
          Length = 334

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFV  LN   + + L   FS F   +   ++ D  TGRS GYGFI F ++   + A   M
Sbjct: 244 LFVCKLNAMTNAKDLAQIFSRFGQIISVEIVRDKDTGRSLGYGFIEFDSEGAVELAYSNM 303

Query: 228 QSTELNGRQIRINWA 242
           +   ++ ++I ++++
Sbjct: 304 EGVIIDDKKIHVDFS 318

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 43/76 (56%), Gaps = 2/76 (2%)

Query: 80  ILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQHHDADVAFKN 137
           +L+V  L+   N + L Q F   G I +V+++ DK+   S+ Y F+E+      ++A+ N
Sbjct: 243 VLFVCKLNAMTNAKDLAQIFSRFGQIISVEIVRDKDTGRSLGYGFIEFDSEGAVELAYSN 302

Query: 138 LNGKTIETKVLKINWA 153
           + G  I+ K + ++++
Sbjct: 303 MEGVIIDDKKIHVDFS 318

>Suva_15.198 Chr15 (343049..345037) [1989 bp, 662 aa] {ON} YHR015W
           (REAL)
          Length = 662

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LF+G L   V +E L   F ++ SF  A V  D  T +S GYG+++F ++ DA  A    
Sbjct: 118 LFIGKLKPTVTEEMLKQTFKKYQSFESAKVCRDFLTKKSLGYGYLNFKSEGDADAAKKDF 177

Query: 228 QSTELNGRQIRI 239
             T   G++++I
Sbjct: 178 NYTLFFGQEVKI 189

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 68/164 (41%), Gaps = 16/164 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYLQHHDADVAFKNL 138
           L++G L  ++ EE LKQ F+      + KV  D     S+ Y ++ +    DAD A K+ 
Sbjct: 118 LFIGKLKPTVTEEMLKQTFKKYQSFESAKVCRDFLTKKSLGYGYLNFKSEGDADAAKKDF 177

Query: 139 N-----GKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFV 193
           N     G+ ++      N  F+    T      N+F  +L +D    T     S +   +
Sbjct: 178 NYTLFFGQEVKIMPSMKNTLFRKNIGT------NVFFSNLPLDNPHLT---TRSFYLIMI 228

Query: 194 QAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
           +   +      + +  GF+ F N   A+  + +  + E  G ++
Sbjct: 229 EYGNVLSCLLEKRKDIGFVYFDNDISARNVIKRYNNQEFFGNKV 272

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 4/77 (5%)

Query: 62  SDVVPANAINGGRETSD----KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNS 117
           SD+V  + ++ G+   D    K + V NL     +E +  +F   GP+ +V +   + N 
Sbjct: 297 SDIVIEDELSIGKNLPDNVPLKTILVKNLPTKTTQEEVLDFFSSSGPVKSVFISRKQGNK 356

Query: 118 VNYAFVEYLQHHDADVA 134
              AFV Y    D+  A
Sbjct: 357 APKAFVTYKNEKDSKRA 373

>NDAI0E00470 Chr5 complement(91514..92290) [777 bp, 258 aa] {ON}
           Anc_8.797
          Length = 258

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 90/196 (45%), Gaps = 17/196 (8%)

Query: 64  VVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYA 121
           V  ++ +N      +  +YVGN+D ++ +  L + F    PIS +    DK       YA
Sbjct: 34  VCSSSKMNSQMSNPELSVYVGNIDPNVTKAQLYELFVQVSPISKIAYPKDKLLQTHQGYA 93

Query: 122 FVEYLQHHDADVAFKNLNGK-TIETKVLKINWAFQSQQTTSDES-----------LFNLF 169
           F+E+    D +   K +N   ++  + LK+  + Q+  ++++++           +  +F
Sbjct: 94  FIEFYTPEDTNYVVKVMNNTVSLYDRFLKVRKSVQNLPSSNNKTYTTSKQVEVLPIAKVF 153

Query: 170 VGDLNVDVDDETLGHAFSEF-PSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQ 228
           V +L+  VD + L + F +F P F +  + +         + F  F    DA  A+ K+ 
Sbjct: 154 VKNLDESVDIQQLSNIFEKFGPLFKEPEIFYLSNNTLRCAHIFFKFYPDSDA--AIGKLD 211

Query: 229 STELNGRQIRINWASK 244
           +  +  ++I +++A K
Sbjct: 212 NELIANKRINLDYAYK 227

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPI-SNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLN 139
           ++V NLD+S++ + L   F+  GP+    ++    NN++  A + +  + D+D A   L+
Sbjct: 152 VFVKNLDESVDIQQLSNIFEKFGPLFKEPEIFYLSNNTLRCAHIFFKFYPDSDAAIGKLD 211

Query: 140 GKTIETKVLKINWAFQSQQT 159
            + I  K + +++A++   T
Sbjct: 212 NELIANKRINLDYAYKEGHT 231

>TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5.76
           YGR250C
          Length = 939

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (53%)

Query: 167 NLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDK 226
           NL++  +  D+  + L   F  F   +   ++ D+ TG S GYGFISF    +A   ++K
Sbjct: 230 NLYIRGIPKDLTIDDLKPIFDTFGKVLSLKIICDLITGESLGYGFISFKLGSEASNCINK 289

Query: 227 MQSTELNGRQIRINWASKRE 246
           +  T +NG  + IN+  +R+
Sbjct: 290 LNGTAMNGSTLFINYHVERK 309

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 207 RGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWA 242
           +GYGFI F   E A  AM K++   L G ++ IN A
Sbjct: 436 KGYGFIKFQEHEHAIDAMTKLEDLRLFGNKLIINKA 471

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 2/92 (2%)

Query: 69  AINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVIND--KNNSVNYAFVEYL 126
           +IN    T    LY+  + K +  + LK  F   G + ++K+I D     S+ Y F+ + 
Sbjct: 219 SINKHALTHPGNLYIRGIPKDLTIDDLKPIFDTFGKVLSLKIICDLITGESLGYGFISFK 278

Query: 127 QHHDADVAFKNLNGKTIETKVLKINWAFQSQQ 158
              +A      LNG  +    L IN+  + ++
Sbjct: 279 LGSEASNCINKLNGTAMNGSTLFINYHVERKE 310

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 87/186 (46%), Gaps = 30/186 (16%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDAD--VAF 135
           ++ +Y+GNL K +  E +    + GG + ++K+++D++      FV ++    A    A 
Sbjct: 341 NRTIYLGNLPKDVKLEEICNSVR-GGLLQHIKLLSDRH----VCFVTFIDPTAAAQFYAM 395

Query: 136 KNLNGKTIETKVLKINWAFQSQQTTSDESLF-------NLFVGDLNVDVDDET------- 181
            +L+G TI  K  KI W   S    +  +L        N+++G+++   D ++       
Sbjct: 396 SSLHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFAADKKSQHPIFTE 455

Query: 182 --LGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
             L   F EF    Q + +++      R   FI+F+N   A  A+DK++S     + ++I
Sbjct: 456 AALRAVFQEFGEVEQINFLYE------RNCCFINFANISSAILAIDKIKSIP-TFKDLKI 508

Query: 240 NWASKR 245
           N+   R
Sbjct: 509 NFGKDR 514

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 43/80 (53%), Gaps = 7/80 (8%)

Query: 320 APLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCI-- 377
           AP R  TVY+GN+P + T  +L+  +++ G + + K  PEK   FI +   E +A+    
Sbjct: 100 APSR--TVYLGNVPPYITTKELLDHVRS-GVVEEVKILPEKMCAFISF-VEENSALLFHS 155

Query: 378 -VVLANYPFQGRNLKTGWGK 396
             +L       R++K GWGK
Sbjct: 156 DAILKRLNIDDRDIKIGWGK 175

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 12/83 (14%)

Query: 327 VYIGNI----------PHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVC 376
           +Y+GNI          P F TEA L  + Q FG +    +  E+  CFI +     A + 
Sbjct: 435 IYLGNIDFAADKKSQHPIF-TEAALRAVFQEFGEVEQINFLYERNCCFINFANISSAILA 493

Query: 377 IVVLANYPFQGRNLKTGWGKEKA 399
           I  + + P   ++LK  +GK++ 
Sbjct: 494 IDKIKSIP-TFKDLKINFGKDRC 515

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 337 TEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANY-PFQGRNLKTGWG 395
           TE  L   L +FG + + K  PEKG  F+ + +   A   +  LAN  P+  +  K  +G
Sbjct: 221 TEEKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANLANINPYYAQK-KIFYG 279

Query: 396 KEKAVFI 402
           K++  FI
Sbjct: 280 KDRCAFI 286

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 88/188 (46%), Gaps = 26/188 (13%)

Query: 72  GGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDA 131
           G     ++ +Y+GNL K +  E +    + GG + N+K+++D+       F+ ++    A
Sbjct: 349 GPNNLGNRTIYLGNLPKGVKIEEICNVVR-GGLLQNIKLLSDRF----ACFITFIDPTAA 403

Query: 132 D--VAFKNLNGKTIETKVLKINWAFQSQQTTSDESLF-------NLFVGDLNVD-----V 177
               A  +L+G TI+    K+ W   S   ++  +L        N+++G+++ +      
Sbjct: 404 AQFYAMSSLHGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYF 463

Query: 178 DDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQI 237
           ++E L   F EF    Q + +      R +G  F++F+N   A  A+DK++S       +
Sbjct: 464 NEEHLREIFEEFGEVEQINFL------REKGCCFVNFTNINHAILALDKIKSLP-EFEDL 516

Query: 238 RINWASKR 245
           +IN+   R
Sbjct: 517 KINFGKDR 524

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 320 APLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCI-- 377
           AP R  TVY+GNIP   T  +L+  +++ G +   K  P K   FI +   E+ A+    
Sbjct: 125 APSR--TVYLGNIPQGLTIKELLDHVRS-GVVESVKILPTKLCAFISF-IDERGALLFHS 180

Query: 378 -VVLANYPFQGRNLKTGWGKEKAV 400
             +L     +G+++K GWGK   +
Sbjct: 181 DAILKRLNIRGKDIKIGWGKSNHI 204

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 327 VYIGNI---PHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANY 383
           VYIG +   P   TE +L   +Q FG I   K+   KG  F+ + +   A   +  L+  
Sbjct: 221 VYIGQLNDDPTITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNLSKL 280

Query: 384 PFQGRNLKTGWGKEKAVFI 402
             + +N +  +GK++  FI
Sbjct: 281 NEKYKNKRIFYGKDRCAFI 299

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 6/78 (7%)

Query: 327 VYIGNIP-----HFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLA 381
           +YIGN+       +  E  L  + + FG +    +  EKG CF+ +     A + +  + 
Sbjct: 449 IYIGNVDFEKKNEYFNEEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKIK 508

Query: 382 NYPFQGRNLKTGWGKEKA 399
           + P +  +LK  +GK++ 
Sbjct: 509 SLP-EFEDLKINFGKDRC 525

>CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON}
           similar to uniprot|P53883 Saccharomyces cerevisiae
           YNL175c NOP13
          Length = 380

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 63/137 (45%), Gaps = 14/137 (10%)

Query: 120 YAFVEYLQHHDADVAFK----NLNGKTIETKVLKINWAFQSQQTTSDESLFN-------L 168
           + +V++      + A K     LNG+ +   ++K + +++ +   +D    +       L
Sbjct: 169 FCYVDFKTQEQVEAAIKLSESQLNGRNL---LIKNSKSYEGRPDKTDLVSMSKNPPSRIL 225

Query: 169 FVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQ 228
           FVG+L+ D  DE L   F      V+  +     +G+ +G+ F+ F N+E A  A+    
Sbjct: 226 FVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALKDKS 285

Query: 229 STELNGRQIRINWASKR 245
             ++ GR +R+ +   R
Sbjct: 286 CRKIAGRPLRMEFGEDR 302

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKV--INDKNNSVNYAFVEYLQHHDADVAFK 136
           +IL+VGNL     +E L+++FQ  G I  +++    D      +AFV++     A  A K
Sbjct: 223 RILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALK 282

Query: 137 NLNGKTIETKVLKINWA 153
           + + + I  + L++ + 
Sbjct: 283 DKSCRKIAGRPLRMEFG 299

>Kwal_33.13496 s33 complement(251014..252006) [993 bp, 330 aa] {ON}
           [contig 116] FULL
          Length = 330

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LF+  LN     + L   FS F +  +  ++ D +TG S  YGFI F+N+   + A  KM
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 228 QSTELNGRQIRINWASKRENA 248
           +   ++ R+I +++      A
Sbjct: 309 EGVLIDDRRIHVDFCQSTRRA 329

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 73  GRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQHHD 130
           G + S+K+L++  L+     + L   F   G I  V+++ DK    S++Y F+E+     
Sbjct: 241 GIKPSEKVLFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSS 300

Query: 131 ADVAFKNLNGKTIETKVLKINWA 153
            + A+  + G  I+ + + +++ 
Sbjct: 301 CEAAYSKMEGVLIDDRRIHVDFC 323

>TDEL0F02850 Chr6 (516483..517322) [840 bp, 279 aa] {ON} Anc_4.66
           YGL044C
          Length = 279

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (48%), Gaps = 2/121 (1%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFK 136
           K++Y+G++     EE +       GP++N+K++ D     S  YAFVEY     +  A +
Sbjct: 16  KVVYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLESSASAVR 75

Query: 137 NLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAH 196
           NLNG    +++LK  +A  S  + SD S  +   G  N    ++     F E P+ +  +
Sbjct: 76  NLNGYQFGSRLLKCGYASNSDISVSDSSQQHSGPGLQNSTSFEDNATLRFPELPAGIDVN 135

Query: 197 V 197
           +
Sbjct: 136 I 136

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 8/89 (8%)

Query: 320 APLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFK--YYPE----KGNCFIKYDTHEQA 373
           AP +V  VY+G+IP+  TE  ++ L  N G + + K  + P+    KG  F++Y   E +
Sbjct: 13  APSKV--VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLESS 70

Query: 374 AVCIVVLANYPFQGRNLKTGWGKEKAVFI 402
           A  +  L  Y F  R LK G+     + +
Sbjct: 71  ASAVRNLNGYQFGSRLLKCGYASNSDISV 99

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 39/76 (51%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +++G +  D  +E +    S         +M+D QTG+S+GY F+ + + E + +A+  +
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLESSASAVRNL 77

Query: 228 QSTELNGRQIRINWAS 243
              +   R ++  +AS
Sbjct: 78  NGYQFGSRLLKCGYAS 93

>CAGL0B04807g Chr2 (460721..461980) [1260 bp, 419 aa] {ON} similar
           to uniprot|P25555 Saccharomyces cerevisiae YCL011c GBP2
           or uniprot|P38922 Saccharomyces cerevisiae YNL004w HRB1
          Length = 419

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/178 (20%), Positives = 71/178 (39%), Gaps = 17/178 (9%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKN 137
           D  +++GNL      E L  +F   G +    +I  +        VE+      D A ++
Sbjct: 118 DNSIFIGNLSFDATPEDLHDFFGQAGEVLRADIITSRGRHRGMGTVEFTSPEGVDNAIRD 177

Query: 138 LNGKTIETKVL----------------KINWAFQSQQTTSDESLFNLFVGDLNVDVDDET 181
            NG     + L                 +   F          +F +F+ +L   +  +T
Sbjct: 178 FNGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYSMTWQT 237

Query: 182 LGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           L   F E    ++A +  D + G SRG+G + +  QE+   A+++    +++GR +++
Sbjct: 238 LKDLFREAGDVIRADIELD-RNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRILQV 294

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 7/80 (8%)

Query: 323 RVTTVYIGNIPHFATEADLIPLLQNFGFI------LDFKYYPEKGNCFIKYDTHEQAAVC 376
           R T +Y  N+P      DL  L +  G +       D    P  G   I+Y+  E A  C
Sbjct: 339 RSTLIYCSNLPLTTATGDLYDLFETIGRVRHAELKFDESGAP-TGIAVIEYENVEDADFC 397

Query: 377 IVVLANYPFQGRNLKTGWGK 396
           I  L NY + G +L   + K
Sbjct: 398 IQRLNNYNYGGCDLDISYAK 417

>ZYRO0G07216g Chr7 (568877..569692) [816 bp, 271 aa] {ON} similar to
           uniprot|P25299 Saccharomyces cerevisiae YGL044C RNA15
           Cleavage and polyadenylation factor I (CF I) component
           involved in cleavage and polyadenylation of mRNA 3' ends
           interacts with the A-rich polyadenylation signal in
           complex with Rna14p and Hrp1p
          Length = 271

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 47/88 (53%), Gaps = 2/88 (2%)

Query: 68  NAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEY 125
           N  +GG+    +++Y+G++     EE +       GP++N+K++ D     S  YAFVEY
Sbjct: 2   NRTSGGQHLPSRVVYLGSIPYDQTEEQILDLCSNVGPVNNLKMMFDPQTGKSKGYAFVEY 61

Query: 126 LQHHDADVAFKNLNGKTIETKVLKINWA 153
                +  A +NLNG    +++LK  +A
Sbjct: 62  KDLESSASAVRNLNGYQFGSRLLKCGYA 89

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 41/81 (50%), Gaps = 8/81 (9%)

Query: 321 PLRVTTVYIGNIPHFATEADLIPLLQNFGFI--LDFKYYPE----KGNCFIKYDTHEQAA 374
           P RV  VY+G+IP+  TE  ++ L  N G +  L   + P+    KG  F++Y   E +A
Sbjct: 11  PSRV--VYLGSIPYDQTEEQILDLCSNVGPVNNLKMMFDPQTGKSKGYAFVEYKDLESSA 68

Query: 375 VCIVVLANYPFQGRNLKTGWG 395
             +  L  Y F  R LK G+ 
Sbjct: 69  SAVRNLNGYQFGSRLLKCGYA 89

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 39/76 (51%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +++G +  D  +E +    S         +M+D QTG+S+GY F+ + + E + +A+  +
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVNNLKMMFDPQTGKSKGYAFVEYKDLESSASAVRNL 74

Query: 228 QSTELNGRQIRINWAS 243
              +   R ++  +A+
Sbjct: 75  NGYQFGSRLLKCGYAT 90

>KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326
           bp, 441 aa] {ON} Anc_1.408 YNL004W intron location
           uncertain
          Length = 441

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 81/195 (41%), Gaps = 37/195 (18%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNG 140
           ++VGNL      + L+ +F   G +    +I  + +      VE+  + D   A +  +G
Sbjct: 121 IFVGNLTYDCTPDDLRDFFSQIGEVVRADIITSRGHHRGMGTVEFTNNDDVTEAIRQYDG 180

Query: 141 KTI--------------ETKVLKI--------NWAFQ------------SQQTTSDESL- 165
                            E++  ++         +A              S+ T SD +  
Sbjct: 181 SDFMERQIFVRQDNPPPESRRERVPPSNDHRDRYAASNDRHSRPYDRASSRNTPSDGNYD 240

Query: 166 -FNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAM 224
            F +FV +L   V+ + L   F    + ++A V  D   GRSRG+G + FSNQED + A+
Sbjct: 241 GFEIFVANLPFSVNWQALKDMFKPCGNVLRADVELD-HVGRSRGFGTVLFSNQEDMRRAI 299

Query: 225 DKMQSTELNGRQIRI 239
           D     E+ GR++ +
Sbjct: 300 DDYNGYEIEGRRLDV 314

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

Query: 323 RVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGN-----CFIKYDTHEQAAVCI 377
           R   +Y  N+P     +DL  L +  G +++ +   +  N       I+Y+  E A VCI
Sbjct: 361 RNNFIYCSNLPFSTDRSDLYDLFETIGKVINAELRYDSANQPTGVAVIEYENIEDADVCI 420

Query: 378 VVLANYPFQGRNLKTGWGKEK 398
             L NY + G +L   + K++
Sbjct: 421 ERLNNYNYGGCDLVISYAKKE 441

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 87/186 (46%), Gaps = 30/186 (16%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDAD--VAF 135
           ++ +Y+GNL K +  E +    + GG + ++K++ D++      FV ++    A    A 
Sbjct: 387 NRTIYLGNLPKDVKIEEICNAVR-GGLLQSIKLLTDRH----VCFVTFIDPTAAAQLYAM 441

Query: 136 KNLNGKTIETKVLKINWAFQSQQTTSDESLF-------NLFVGDLNVDVDDE-------- 180
            +L+G TI  K  KI W   S   ++  +L        N+++G+++   D E        
Sbjct: 442 TSLHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFKADSERDVPVFTE 501

Query: 181 -TLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
             L   F E+    Q + + +      R   F++F+N  +A  A+DK++S E   + ++I
Sbjct: 502 QNLRKLFEEYGEVEQINFLPE------RSCCFVNFTNISNAILAIDKIKSNE-QFKDLKI 554

Query: 240 NWASKR 245
           N+   R
Sbjct: 555 NFGKDR 560

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 7/84 (8%)

Query: 320 APLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCI-- 377
           AP R  TVY+GNIP      +L+  +++ G + D +   EK   FI +   E +A+    
Sbjct: 145 APSR--TVYLGNIPPNLEVRELLDHVRS-GVVEDVRILREKMCAFISF-LDESSALLFHS 200

Query: 378 -VVLANYPFQGRNLKTGWGKEKAV 400
             +L      GR++K GWGK   +
Sbjct: 201 DAILKRLNIGGRDIKVGWGKPTPI 224

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 14/84 (16%)

Query: 327 VYIGNI----------PHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVC 376
           +Y+GNI          P F TE +L  L + +G +    + PE+  CF+ +     A + 
Sbjct: 481 IYLGNIDFKADSERDVPVF-TEQNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILA 539

Query: 377 I-VVLANYPFQGRNLKTGWGKEKA 399
           I  + +N  F  ++LK  +GK++ 
Sbjct: 540 IDKIKSNEQF--KDLKINFGKDRC 561

>TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.80
           YNL175C
          Length = 400

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFVG+L+ D  DE L   F      V+  +     +G+ +G+ F+ F N+E A  A+   
Sbjct: 235 LFVGNLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGFAFVDFKNEEGATKALSDK 294

Query: 228 QSTELNGRQIRINWASKR 245
              ++ GR +R+ +   R
Sbjct: 295 SCRKIAGRPLRMEFGEDR 312

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 2/77 (2%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKV--INDKNNSVNYAFVEYLQHHDADVAFK 136
           +IL+VGNL     +E L+++FQ  G I  +++    D      +AFV++     A  A  
Sbjct: 233 RILFVGNLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGFAFVDFKNEEGATKALS 292

Query: 137 NLNGKTIETKVLKINWA 153
           + + + I  + L++ + 
Sbjct: 293 DKSCRKIAGRPLRMEFG 309

>KLLA0D13420g Chr4 complement(1157491..1157991) [501 bp, 166 aa]
           {ON} similar to uniprot|P40565 YIR005W Saccharomyces
           cerevisiae IST3 Component of the U2 snRNP required for
           the first catalytic step of splicing and for
           spliceosomal assembly
          Length = 166

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 60/112 (53%), Gaps = 4/112 (3%)

Query: 134 AFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFV 193
           + + L+ + +E  +LK   ++  +    D++  N   G +++++ +  +   FS++   V
Sbjct: 6   SIQKLSERELECGILKPESSWHHE--YKDQAYINF--GGMHLELTEADILTIFSQYGCPV 61

Query: 194 QAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
              ++ D  TG+S+G+GF+ + +Q     A+D +   ++ GR IR++ A  R
Sbjct: 62  DIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRVDHAFYR 113

>ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON}
           conserved hypothetical protein
          Length = 330

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 43/82 (52%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LF+  LN     + +   F  F +     ++ D  TG S GYGFI F++++  + A  KM
Sbjct: 244 LFICKLNPLTRAKDIATIFQRFGAIASVEIVRDKSTGHSLGYGFIQFTDRKSCEQAYKKM 303

Query: 228 QSTELNGRQIRINWASKRENAT 249
           +   ++ R+I ++++   + AT
Sbjct: 304 EGVIIDDRRIHVDFSQSVKAAT 325

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 47/83 (56%), Gaps = 2/83 (2%)

Query: 73  GRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN--NSVNYAFVEYLQHHD 130
           G + S ++L++  L+     + +   FQ  G I++V+++ DK+  +S+ Y F+++     
Sbjct: 236 GIKPSPRVLFICKLNPLTRAKDIATIFQRFGAIASVEIVRDKSTGHSLGYGFIQFTDRKS 295

Query: 131 ADVAFKNLNGKTIETKVLKINWA 153
            + A+K + G  I+ + + ++++
Sbjct: 296 CEQAYKKMEGVIIDDRRIHVDFS 318

>Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 80/180 (44%), Gaps = 13/180 (7%)

Query: 77  SDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVA 134
           SD  +YVGN+D  I ++ L + F    P+  +K   DK       YAF+E+    DA+  
Sbjct: 7   SDSTVYVGNIDPRITKDQLYELFIQINPVLRIKYPKDKVLQTYQGYAFIEFYNKEDAEYV 66

Query: 135 FKNLNGKT-IETKVLKINWAFQSQQTTSDES---------LFNLFVGDLNVDVDDETLGH 184
            + +N    +  +++K+     S  T +  S         +  LFV +L   +D + L  
Sbjct: 67  IQIMNNTVKLYDRLIKVRQVTNSVGTANLSSNNSKDIALPIAKLFVKNLADSIDIDQLAK 126

Query: 185 AFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASK 244
            F +F   +    ++ +  G+ +    + F + E A  A+  + +  +   +I I++A K
Sbjct: 127 IFGKFGKTISKPEIFHLSNGKLKC-ACVYFEDFEKADLAIKSLNNQLVANSRITIDYAFK 185

 Score = 36.2 bits (82), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 81  LYVGNLDKSINEETLKQYF-QIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLN 139
           L+V NL  SI+ + L + F + G  IS  ++ +  N  +  A V +     AD+A K+LN
Sbjct: 110 LFVKNLADSIDIDQLAKIFGKFGKTISKPEIFHLSNGKLKCACVYFEDFEKADLAIKSLN 169

Query: 140 GKTIETKVLKINWAFQSQQTTS 161
            + +    + I++AF+     S
Sbjct: 170 NQLVANSRITIDYAFKENGKAS 191

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query: 159 TTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQE 218
           T SD +++   VG+++  +  + L   F +    ++     D      +GY FI F N+E
Sbjct: 5   TDSDSTVY---VGNIDPRITKDQLYELFIQINPVLRIKYPKDKVLQTYQGYAFIEFYNKE 61

Query: 219 DAQTAMDKMQST-ELNGRQIRI 239
           DA+  +  M +T +L  R I++
Sbjct: 62  DAEYVIQIMNNTVKLYDRLIKV 83

>KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [1332
           bp, 443 aa] {ON} similar to uniprot|P38922 Saccharomyces
           cerevisiae YNL004W
          Length = 443

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 16/174 (9%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKN--- 137
           +++GNL  +   E LK+YF   G +    +I  + +      VE+    D D A ++   
Sbjct: 143 IFIGNLTYNTTPEDLKEYFGKIGEVRRADIITSRGHHRGMGTVEFNNSTDVDTAIRDCDG 202

Query: 138 --LNGKTI----------ETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHA 185
             LNG+ I          E      N         + +  F +FV  L   V+ + L   
Sbjct: 203 AFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDEGFEVFVAQLPFSVNWQELKDM 262

Query: 186 FSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           F      + A V+ D + G+SRG+G +  + +E    A+     TE  GR + +
Sbjct: 263 FKPCGDVLHADVVTD-RDGKSRGFGTVYMATKEQQNDAIRHWTGTEYKGRVLDV 315

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 87/186 (46%), Gaps = 30/186 (16%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDAD--VAF 135
           ++ +Y+GNL K +  E +    + GG + +VK+++D++      FV ++    A    A 
Sbjct: 400 NRTVYLGNLPKDVKIEEICNAVR-GGLLQSVKLLSDRH----VCFVTFIDPTAAAQFYAM 454

Query: 136 KNLNGKTIETKVLKINWAFQSQQTTSDESLF-------NLFVGDLNVDVDDET------- 181
            +L+G TI  K  KI W   S    +  +L        N++VG+++ +  DET       
Sbjct: 455 SSLHGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAIDETGETIFTE 514

Query: 182 --LGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
             L   F EF    Q + + +      +   FI+F+N  +A  A+DK++      + +++
Sbjct: 515 QNLRETFQEFGEVEQINFLHE------KNCCFINFTNISNAILAIDKIKCNPY-FKNLKV 567

Query: 240 NWASKR 245
           N+   R
Sbjct: 568 NFGKDR 573

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 7/84 (8%)

Query: 320 APLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCI-- 377
           AP R  TVY+GNIP F     L+  +++ G I + K  P++   FI +   E +A+    
Sbjct: 158 APSR--TVYLGNIPPFLPAKQLLDHVRS-GVIEELKILPDRMCAFISF-VDESSALLFHS 213

Query: 378 -VVLANYPFQGRNLKTGWGKEKAV 400
             +L     +GR++K GWGK   +
Sbjct: 214 DAILKRLNIEGRDIKVGWGKPTPI 237

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 10/82 (12%)

Query: 327 VYIGNIPHFA---------TEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCI 377
           +Y+GNI   A         TE +L    Q FG +    +  EK  CFI +     A + I
Sbjct: 494 IYVGNIDFNAIDETGETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAI 553

Query: 378 VVLANYPFQGRNLKTGWGKEKA 399
             +   P+  +NLK  +GK++ 
Sbjct: 554 DKIKCNPY-FKNLKVNFGKDRC 574

>Kpol_2000.44 s2000 (86199..87215) [1017 bp, 338 aa] {ON}
           (86199..87215) [1017 nt, 339 aa]
          Length = 338

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LF+  LN     + +   F  F       ++ D ++G S GYGFI F+ +   + A  KM
Sbjct: 249 LFICKLNPSTKAKDIAMIFQRFGEIKSVEIIKDKESGYSLGYGFIEFTTKHSCELAYTKM 308

Query: 228 QSTELNGRQIRINWA 242
           +ST ++ R+I +++ 
Sbjct: 309 ESTIIDDRRIHVDFC 323

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 73  GRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQHHD 130
           G    + +L++  L+ S   + +   FQ  G I +V++I DK +  S+ Y F+E+   H 
Sbjct: 241 GVRPLENVLFICKLNPSTKAKDIAMIFQRFGEIKSVEIIKDKESGYSLGYGFIEFTTKHS 300

Query: 131 ADVAFKNLNGKTIETKVLKINWA 153
            ++A+  +    I+ + + +++ 
Sbjct: 301 CELAYTKMESTIIDDRRIHVDFC 323

>SAKL0C03234g Chr3 complement(306710..307732) [1023 bp, 340 aa] {ON}
           conserved hypothetical protein
          Length = 340

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFV  LN     + L   F  F   V   ++ D  TG S GYGFI FS Q+  + A  KM
Sbjct: 246 LFVCKLNPMTRAQDLAVIFHRFGEIVSVEIVRDKDTGGSLGYGFIEFSEQKACELAYSKM 305

Query: 228 QSTELNGRQIRINWA 242
               ++ R+I ++++
Sbjct: 306 DGVLVDDRRIHVDFS 320

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 50/94 (53%), Gaps = 3/94 (3%)

Query: 71  NGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQH 128
           + G +  + +L+V  L+     + L   F   G I +V+++ DK+   S+ Y F+E+ + 
Sbjct: 236 SAGVKPLENVLFVCKLNPMTRAQDLAVIFHRFGEIVSVEIVRDKDTGGSLGYGFIEFSEQ 295

Query: 129 HDADVAFKNLNGKTIETKVLKINWAFQSQQTTSD 162
              ++A+  ++G  ++ + + ++++ QS    +D
Sbjct: 296 KACELAYSKMDGVLVDDRRIHVDFS-QSVSRLAD 328

>KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {ON}
           Anc_5.76 YGR250C
          Length = 625

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 85/195 (43%), Gaps = 34/195 (17%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVIND-----KNNSVNYAFVEYLQHHDADVAF 135
           L++G +DK+I    L   F + GPI ++K+I+D     KNN  NY FV Y     A    
Sbjct: 170 LFIGGIDKAITLSQLTTIFSVYGPIISIKLISDTNNNSKNNETNYGFVSYQFGSQAANCI 229

Query: 136 KNLNGKTIETKVLKINWA-----------FQSQQTTSDESLFNLFVGDL-NVDVDDET-- 181
            +LNGK I    L IN+              + +  + ++   +F+G+L  V V+ E   
Sbjct: 230 NDLNGKKIHDSNLFINYHVDVKERERIQWLDADENNNAKNFKCVFIGNLPKVAVNGEPIT 289

Query: 182 -----------LGHAFSEFPSFVQAHVMWDMQTGRS---RGYGFISFSNQEDAQTAMDKM 227
                      L   F+ F   +  +   D    RS   +GYGF+  +  E+A   ++  
Sbjct: 290 CGMILETIKDRLKEQFANF-EILSHYFPEDTVDDRSELLKGYGFVKVATHEEAIEIINSF 348

Query: 228 QSTELNGRQIRINWA 242
              E +G ++ +N A
Sbjct: 349 NGYEFHGSKLIVNRA 363

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 18/82 (21%)

Query: 161 SDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVM------------------WDMQ 202
           SD+   NL+V  + ++  D  L   + +F   + A V+                    + 
Sbjct: 434 SDQQESNLYVKHIPLEWRDTELFDFYRKFGEIISAKVITVGGSRNNSHVDIGESESGTLV 493

Query: 203 TGRSRGYGFISFSNQEDAQTAM 224
            G+SRGYGF+ F N  DA  A+
Sbjct: 494 HGQSRGYGFVCFENPVDASRAI 515

>TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {ON}
           Anc_2.80 YNL175C
          Length = 389

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 37/78 (47%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFVG+L+ D  DE L   F      V+        TG+ +G+ FI F  +E A  A+   
Sbjct: 224 LFVGNLSYDTTDELLRSHFQHCGEIVKIRTATFEDTGKCKGFSFIDFLTEESATKALKDK 283

Query: 228 QSTELNGRQIRINWASKR 245
              ++ GR IR+ +   R
Sbjct: 284 SCRKIAGRPIRMEYGEDR 301

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 39/77 (50%), Gaps = 2/77 (2%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVK--VINDKNNSVNYAFVEYLQHHDADVAFK 136
           +IL+VGNL     +E L+ +FQ  G I  ++     D      ++F+++L    A  A K
Sbjct: 222 RILFVGNLSYDTTDELLRSHFQHCGEIVKIRTATFEDTGKCKGFSFIDFLTEESATKALK 281

Query: 137 NLNGKTIETKVLKINWA 153
           + + + I  + +++ + 
Sbjct: 282 DKSCRKIAGRPIRMEYG 298

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 86/187 (45%), Gaps = 20/187 (10%)

Query: 72  GGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDA 131
           G     ++ +Y+GNL K +  E +    + GG + NVKV++D++      FV ++    A
Sbjct: 444 GPNNLGNRTVYLGNLPKDVKVEEICNVVR-GGLLQNVKVLSDRH----VCFVTFIDPTAA 498

Query: 132 D--VAFKNLNGKTIETKVLKINWAFQSQQ-------TTSDESLFNLFVGDLNVDVDDETL 182
               A  +L+G TI+ +  ++ W               S+ +  N++VG++N D D +  
Sbjct: 499 AQFYAMSSLHGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFDEDSKRE 558

Query: 183 GHAFSEFPSFVQAHVMW----DMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIR 238
              F+E  S       W     +     R   F++++N  +A  A+DK++   +  + ++
Sbjct: 559 DPIFTE-SSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKIKGHPVF-KDLK 616

Query: 239 INWASKR 245
           IN+   R
Sbjct: 617 INFGKDR 623

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 326 TVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCI---VVLAN 382
           TVY+GN P   T  +L+  +++ G + D +  P+K   F+ +   E AA+      +L  
Sbjct: 211 TVYLGNTPITLTVKELLDHVRS-GVVEDVRILPDKMCAFVSF-VDESAALLFHSDAILKR 268

Query: 383 YPFQGRNLKTGWGKEKAV 400
               GR++K GWGK   +
Sbjct: 269 LHIDGRDIKIGWGKPTPI 286

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 12/83 (14%)

Query: 327 VYIGNI----------PHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVC 376
           VY+GNI          P F TE+ L  + Q +G +    Y PE+  CF+ Y     A + 
Sbjct: 544 VYVGNINFDEDSKREDPIF-TESSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILA 602

Query: 377 IVVLANYPFQGRNLKTGWGKEKA 399
           I  +  +P   ++LK  +GK++ 
Sbjct: 603 IDKIKGHPVF-KDLKINFGKDRC 624

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 31/66 (46%)

Query: 337 TEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYPFQGRNLKTGWGK 396
           TE  L   LQ FG I   K   EKG  F+ + +   A   +  LAN     RN K  +GK
Sbjct: 329 TEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLANINPYYRNKKIFYGK 388

Query: 397 EKAVFI 402
           ++  FI
Sbjct: 389 DRCAFI 394

>NDAI0G00180 Chr7 complement(23120..24514) [1395 bp, 464 aa] {ON}
           Anc_1.408 YCL011C
          Length = 464

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 79/191 (41%), Gaps = 33/191 (17%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNG 140
           ++VGNL      E L++YF   G +    +I  K +      VE+    D + A +  +G
Sbjct: 112 IFVGNLTYDCTPEDLREYFSGIGEVVRADIITSKGHHRGMGTVEFTNSKDVEDAIRQYDG 171

Query: 141 KTIETK---VLKINWAFQSQQTT--SDESL---------------------------FNL 168
                +   V + N      +++  SDES+                           + +
Sbjct: 172 SYFLDRQIFVRQDNPPPDGGRSSRRSDESISSSRGYQDKSSSSYDRAPSTRQPNRQGYKV 231

Query: 169 FVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQ 228
           F+ +L   ++ + L   F EF   ++A +  D + GRSRG+G +    +   + A+  + 
Sbjct: 232 FIANLPFSINWQALKDMFKEFGDVLRADIELDSR-GRSRGFGTVILREKSAMEKAIATLN 290

Query: 229 STELNGRQIRI 239
            TE+ GR+I +
Sbjct: 291 GTEMEGRRIDV 301

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 80  ILYVGNLDKSINEETLKQYFQIGGPISNVKV-INDKNNSVNYAFVEYLQHHDADVAFKNL 138
           ++Y  NL  S     L   F+  G ISN ++  NDK    + A VEY+   DADV  + L
Sbjct: 387 LIYCNNLPASTARSDLYDLFESIGRISNAELKYNDKGEPTSEAVVEYINLEDADVCIERL 446

Query: 139 NGKTIETKVLKINWAFQS 156
           NG       L+I++  +S
Sbjct: 447 NGYNYGGCELQISYGKRS 464

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 327 VYIGNIPHFATEADLIPLLQNFGFILDFKY-YPEKGN----CFIKYDTHEQAAVCIVVLA 381
           +Y  N+P     +DL  L ++ G I + +  Y +KG       ++Y   E A VCI  L 
Sbjct: 388 IYCNNLPASTARSDLYDLFESIGRISNAELKYNDKGEPTSEAVVEYINLEDADVCIERLN 447

Query: 382 NYPFQGRNLKTGWGKE 397
            Y + G  L+  +GK 
Sbjct: 448 GYNYGGCELQISYGKR 463

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 44/96 (45%), Gaps = 1/96 (1%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKV-INDKNNSVNYAFVEYLQHHDADVAFKNLN 139
           +++ NL  SIN + LK  F+  G +    + ++ +  S  +  V   +    + A   LN
Sbjct: 231 VFIANLPFSINWQALKDMFKEFGDVLRADIELDSRGRSRGFGTVILREKSAMEKAIATLN 290

Query: 140 GKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNV 175
           G  +E + + +   + ++Q  SD    N +  D+N 
Sbjct: 291 GTEMEGRRIDVKEGYSNRQDPSDYKYGNDYRNDINT 326

>CAGL0J01914g Chr10 complement(191912..192421) [510 bp, 169 aa] {ON}
           similar to uniprot|P40565 Saccharomyces cerevisiae
           YIR005w IST3
          Length = 169

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 56/107 (52%), Gaps = 4/107 (3%)

Query: 134 AFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFV 193
           A + +N K +E  +LK   ++   Q   D++   +F+G LN  + +  L   FS++   V
Sbjct: 6   AIQRINEKELEAGILKPEHSWH--QEYKDQAY--IFIGGLNRQLTEGDLLTIFSQYGVPV 61

Query: 194 QAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRIN 240
              ++ D +T  S+G+ F+ + +Q     A+D +    + GRQI+++
Sbjct: 62  DVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAGRQIKVD 108

 Score = 36.6 bits (83), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 43/77 (55%), Gaps = 4/77 (5%)

Query: 81  LYVGNLDKSINEETLKQYF-QIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKN 137
           +++G L++ + E  L   F Q G P+ +V ++ DK  + S  +AF++Y       +A  N
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPV-DVLLVRDKETHESKGFAFLKYEDQRSTILAVDN 94

Query: 138 LNGKTIETKVLKINWAF 154
           LNG T+  + +K++  F
Sbjct: 95  LNGITVAGRQIKVDHIF 111

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 31/71 (43%), Gaps = 6/71 (8%)

Query: 327 VYIGNIPHFATEADLIPLLQNFG------FILDFKYYPEKGNCFIKYDTHEQAAVCIVVL 380
           ++IG +    TE DL+ +   +G       + D + +  KG  F+KY+      + +  L
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 381 ANYPFQGRNLK 391
                 GR +K
Sbjct: 96  NGITVAGRQIK 106

>Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W
           (IST3) - U2 snRNP associated protein [contig 135] FULL
          Length = 135

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 57/109 (52%), Gaps = 8/109 (7%)

Query: 134 AFKNLNGKTIETKVLK--INWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPS 191
           + +NL+ + +E  +L    +W F+ +          +FVG L+ D+ +  +   FS++  
Sbjct: 6   SIQNLSFRELEQGILSPTASWHFEYKDQAY------IFVGGLHKDLTEGDILTIFSQYGI 59

Query: 192 FVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRIN 240
            V   ++ D ++G S+G+ ++ + +Q     A+D +   ++ GR IR++
Sbjct: 60  PVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNLNGVKIAGRSIRVD 108

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/72 (19%), Positives = 32/72 (44%), Gaps = 6/72 (8%)

Query: 327 VYIGNIPHFATEADLIPLLQNFGFILDFKYYPE------KGNCFIKYDTHEQAAVCIVVL 380
           +++G +    TE D++ +   +G  +D K   +      KG  ++KY+      + +  L
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 381 ANYPFQGRNLKT 392
                 GR+++ 
Sbjct: 96  NGVKIAGRSIRV 107

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 86/186 (46%), Gaps = 30/186 (16%)

Query: 78  DKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDAD--VAF 135
           ++ +Y+GNL K +  E +    + GG + ++K++ D++      FV ++    A    A 
Sbjct: 385 NRTIYLGNLPKDVKIEEICNVVR-GGLLQSIKLLTDRH----VCFVTFIDPTAAAQLYAM 439

Query: 136 KNLNGKTIETKVLKINWAFQSQQTTSDESLF-------NLFVGDLNVDVDDET------- 181
            +L+G TI  K  KI W   S   ++  +L        N+++G+++   D ET       
Sbjct: 440 ASLHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFKADSETEHPIFTE 499

Query: 182 --LGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
             L   F EF    Q + + +      R   F++F+N  +A  A+DK+++       ++I
Sbjct: 500 QNLRSIFEEFGEVEQINFLIE------RNCCFVNFTNISNAILAIDKIKNNP-QFSDLKI 552

Query: 240 NWASKR 245
           N+   R
Sbjct: 553 NFGKDR 558

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 320 APLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCI-- 377
           AP R  TVY+GNIP       L+  +++ G + D +   EK   FI +   E +A+    
Sbjct: 143 APSR--TVYLGNIPPNLEARQLLDHVRS-GVVEDIRILREKMCAFISF-LDESSALLFHS 198

Query: 378 -VVLANYPFQGRNLKTGWGKEKAV 400
             +L      GR++K GWGK   +
Sbjct: 199 DAILKRLNIDGRDIKIGWGKPTPI 222

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 12/83 (14%)

Query: 327 VYIGNI----------PHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVC 376
           +Y+GNI          P F TE +L  + + FG +    +  E+  CF+ +     A + 
Sbjct: 479 IYLGNIDFKADSETEHPIF-TEQNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILA 537

Query: 377 IVVLANYPFQGRNLKTGWGKEKA 399
           I  + N P Q  +LK  +GK++ 
Sbjct: 538 IDKIKNNP-QFSDLKINFGKDRC 559

>Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON}
           (12746..13900) [1155 nt, 385 aa]
          Length = 384

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFVG+L+ D  D+ L   F      ++  +     TG+ +G+ F+ F N+E A  A+   
Sbjct: 224 LFVGNLSFDTTDDLLRKHFQHCGEIIKIRMATFQDTGKCKGFAFVDFKNEEGATKALTDK 283

Query: 228 QSTELNGRQIRINWASKR 245
              ++ GR +R+ +   R
Sbjct: 284 SCRKIAGRPLRMEFGEDR 301

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 39/77 (50%), Gaps = 2/77 (2%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKV--INDKNNSVNYAFVEYLQHHDADVAFK 136
           +IL+VGNL     ++ L+++FQ  G I  +++    D      +AFV++     A  A  
Sbjct: 222 RILFVGNLSFDTTDDLLRKHFQHCGEIIKIRMATFQDTGKCKGFAFVDFKNEEGATKALT 281

Query: 137 NLNGKTIETKVLKINWA 153
           + + + I  + L++ + 
Sbjct: 282 DKSCRKIAGRPLRMEFG 298

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 90/192 (46%), Gaps = 30/192 (15%)

Query: 72  GGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDA 131
           G     ++ +Y+GNL K I  E +    + GG + +VK++ D+       FV ++    A
Sbjct: 492 GPNNLGNRTIYLGNLPKDIRVEEICNVVR-GGLLQSVKLLGDRY----VCFVTFIDPTAA 546

Query: 132 D--VAFKNLNGKTIETKVLKINWAFQSQQTTSDESLF-------NLFVGDLNVDVD---- 178
               A  +L+G TI+ K  K+ W   S   ++  +L        N+++G+++   D    
Sbjct: 547 AQFFAMSSLHGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFATDKKRD 606

Query: 179 -----DETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELN 233
                +++L   FS +    Q + + +      +   FI+F+N  +A  A+DK++S  + 
Sbjct: 607 NPIFTEDSLRKMFSMYGEMEQINFLPE------KNCCFINFTNISNAILALDKIKSNPV- 659

Query: 234 GRQIRINWASKR 245
            + ++IN+   R
Sbjct: 660 FKDLKINFGKDR 671

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 45/84 (53%), Gaps = 7/84 (8%)

Query: 320 APLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCI-- 377
           AP R  TVY+GNIP   T  +L+  +++ G I D K  PEK   FI +   E +A+    
Sbjct: 219 APSR--TVYLGNIPSDLTVKELLDHVRS-GVIEDVKIIPEKLCAFISF-LDENSALLFHS 274

Query: 378 -VVLANYPFQGRNLKTGWGKEKAV 400
             +L      G+++K GWGK  AV
Sbjct: 275 DAILKRLNINGKDIKIGWGKSTAV 298

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 12/83 (14%)

Query: 327 VYIGNI----------PHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVC 376
           +YIGNI          P F TE  L  +   +G +    + PEK  CFI +     A + 
Sbjct: 592 IYIGNIDFATDKKRDNPIF-TEDSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILA 650

Query: 377 IVVLANYPFQGRNLKTGWGKEKA 399
           +  + + P   ++LK  +GK++ 
Sbjct: 651 LDKIKSNPVF-KDLKINFGKDRC 672

>YNL175C Chr14 complement(307401..308612) [1212 bp, 403 aa] {ON}
           NOP13Nucleolar protein found in preribosomal complexes;
           contains an RNA recognition motif (RRM)
          Length = 403

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFVG+L+ DV D+ L   F      V+  +     +G+ +G+ FI F N+E +  A+   
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 228 QSTELNGRQIRINWASKR 245
              ++ GR +R+ +   R
Sbjct: 301 SCRKIAGRPLRMEYGEDR 318

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKV--INDKNNSVNYAFVEYLQHHDADVAFK 136
           +IL+VGNL   + ++ L+++FQ  G I  +++    D      +AF+++     +  A K
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 137 NLNGKTIETKVLKINWA 153
           + + + I  + L++ + 
Sbjct: 299 DKSCRKIAGRPLRMEYG 315

>Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {ON}
           YNL175C (REAL)
          Length = 403

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFVG+L+ DV D+ L   F      V+  +     +G+ +G+ FI F N+E +  A+   
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 228 QSTELNGRQIRINWASKR 245
              ++ GR +R+ +   R
Sbjct: 301 SCRKIAGRPLRMEYGEDR 318

>Skud_14.159 Chr14 complement(298222..299424) [1203 bp, 400 aa] {ON}
           YNL175C (REAL)
          Length = 400

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFVG+L+ DV D+ L   F      V+  +     +G+ +G+ FI F N+E +  A+   
Sbjct: 238 LFVGNLSFDVTDDLLRKHFQHCGDVVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 297

Query: 228 QSTELNGRQIRINWASKR 245
              ++ GR +R+ +   R
Sbjct: 298 SCRKIAGRPLRMEYGEDR 315

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKV--INDKNNSVNYAFVEYLQHHDADVAFK 136
           +IL+VGNL   + ++ L+++FQ  G +  +++    D      +AF+++     +  A K
Sbjct: 236 RILFVGNLSFDVTDDLLRKHFQHCGDVVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 295

Query: 137 NLNGKTIETKVLKINWA 153
           + + + I  + L++ + 
Sbjct: 296 DKSCRKIAGRPLRMEYG 312

>TDEL0H01940 Chr8 complement(334207..335163) [957 bp, 318 aa] {ON}
           Anc_7.250 YIL061C
          Length = 318

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 57/116 (49%), Gaps = 6/116 (5%)

Query: 124 EYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFN-LFVGDLNVDVDDETL 182
           +YLQ ++     KN   + +E K+ +  W  Q+     D   +  +FVG L  D+ +  L
Sbjct: 66  KYLQDYEKAADSKNREQRELENKLSE--WDPQNDPNMKDTDPYRTIFVGRLPYDISEVEL 123

Query: 183 GHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM---QSTELNGR 235
              F+EF    +  V+ D    +S+GY FI F++ + +++A  +    +  E+ GR
Sbjct: 124 QRKFNEFGEIEKVRVVRDKINNQSKGYAFIVFTDPQSSKSACKEYGLHRGIEIKGR 179

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFK 136
           + ++VG L   I+E  L++ F   G I  V+V+ DK  N S  YAF+ +     +  A K
Sbjct: 107 RTIFVGRLPYDISEVELQRKFNEFGEIEKVRVVRDKINNQSKGYAFIVFTDPQSSKSACK 166

>KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} similar
           to uniprot|P53883 Saccharomyces cerevisiae YNL175C
          Length = 396

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFVG+L+ D  DE L   F      V+  +     TG+ +G+ F+ F N+E    A+   
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDTGKCKGFAFVDFKNEEGPTNALKDK 296

Query: 228 QSTELNGRQIRINWASKR 245
               + GR +R+ +   R
Sbjct: 297 TCRRIAGRPLRMEFGEDR 314

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 2/86 (2%)

Query: 70  INGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKV--INDKNNSVNYAFVEYLQ 127
           I+  +    +IL+VGNL     +E LK++FQ  G I  +++    D      +AFV++  
Sbjct: 226 ISMSKNPPSRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDTGKCKGFAFVDFKN 285

Query: 128 HHDADVAFKNLNGKTIETKVLKINWA 153
                 A K+   + I  + L++ + 
Sbjct: 286 EEGPTNALKDKTCRRIAGRPLRMEFG 311

>ZYRO0F12716g Chr6 (1035111..1035743) [633 bp, 210 aa] {ON} similar
           to uniprot|Q99181 Saccharomyces cerevisiae YOR319W
          Length = 210

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 84/186 (45%), Gaps = 18/186 (9%)

Query: 71  NGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVN--YAFVEYLQH 128
           N  R+TS   +YVGN+D  + +  L + F    PI  ++   DK   ++  YAFVE+   
Sbjct: 4   NSNRDTS---IYVGNIDPKVTKAQLYELFVQISPIRRIRYPKDKVLQIHQGYAFVEFYSV 60

Query: 129 HDADVAFKNLNG------KTIETKVLKINWAFQSQQTTSDE----SLFNLFVGDLNVDVD 178
            D     + +N       +T+  ++ ++N    +    + E     L  +FV +++  +D
Sbjct: 61  EDVQYVLRVMNNVVSLYDRTL--RIRRVNGPGTNNSVNAKELSLLPLAKVFVKNVDESID 118

Query: 179 DETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIR 238
           +  L   F +F        ++ +  G+ R   F+ F +   +  A+  + +  +  R+I 
Sbjct: 119 NVHLSKIFGKFGPLASLPEIFYLSHGQLRC-AFVYFRDYTHSDAAIKSLDNQLVVNRRIN 177

Query: 239 INWASK 244
           +++A K
Sbjct: 178 LDYAIK 183

>ZYRO0E04928g Chr5 complement(374326..375537,375710..375727) [1230
           bp, 409 aa] {ON} similar to uniprot|P38922 Saccharomyces
           cerevisiae YNL004W
          Length = 409

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 77/194 (39%), Gaps = 31/194 (15%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNG 140
           ++VGNL      E LK YF   G +    +I  + +      VE+    D D A +  +G
Sbjct: 105 VFVGNLTYDCAPEDLKDYFSQIGNVVRADIITSRGHHRGMGTVEFTNTEDVDEAIRRFDG 164

Query: 141 ----------------------KTIETKVLKINWAFQSQQTT--------SDESLFNLFV 170
                                 + ++ +  +  +A  S  +         S+  ++ +FV
Sbjct: 165 AYFMDRQIFVRQDNPPPESNSHERVQERRKERTFAGASSGSNNGTNAGGNSNGPIYEVFV 224

Query: 171 GDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQST 230
            +L   ++ + L   F E  + ++A V    + G SRG+G + +   E+ Q A+ +    
Sbjct: 225 ANLPYSINWQALKDMFKECGNVIRADVEL-ARNGYSRGFGTVIYGTPEEMQDAIARFHGY 283

Query: 231 ELNGRQIRINWASK 244
           EL GR + +    K
Sbjct: 284 ELEGRILEVREGRK 297

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 323 RVTTVYIGNIPHFATEADLIPLLQNFGFI------LDFKYYPEKGNCFIKYDTHEQAAVC 376
           R   +Y  N+P     +DL  L +  G +       D K  P  G   ++Y+  E A VC
Sbjct: 328 RNNLIYCANLPFSTATSDLYDLFETIGKLNNAELRFDSKGAP-TGVAIVEYENVEDADVC 386

Query: 377 IVVLANYPFQGRNLKTGWGKEK 398
           I  L NY + G +L+  +GK +
Sbjct: 387 IDRLNNYNYGGCDLEISYGKRE 408

>NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {ON} 
          Length = 474

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 72/159 (45%), Gaps = 20/159 (12%)

Query: 106 SNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNGKTI---------------ETKVLKI 150
           ++V  I  ++   NY  VE+    +A  A   LNG  +               +  V ++
Sbjct: 87  ASVDSIKSEHKQANYCLVEFESQQEAAEAL-TLNGLPLPNFFSRSRNSVINASQLSVFRL 145

Query: 151 NWA-FQSQQTTSDESLFNLFVGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRG 208
           NWA + +    S E  + LFVG+L+    +  L   F S + S     +M +   G+S  
Sbjct: 146 NWAVWPTVNGLSPE--YPLFVGNLSSITREADLLLLFRSRYKSVKTVRMMTEPIPGKSDS 203

Query: 209 YGFISFSNQEDAQTAMDKMQSTELNGRQIRINWASKREN 247
           +GFI F+N E+ + A ++M       + I++  A+ R+N
Sbjct: 204 FGFICFANCEERRLAAEEMNGICFQDKYIKVAIANPRDN 242

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 61/139 (43%), Gaps = 12/139 (8%)

Query: 104 PISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDE 163
           P+ N+  +    N +    +  +Q   A +A       T+ T  L+ N   + Q   S+ 
Sbjct: 252 PVKNIPPLIKTANDLLTNNLNAVQEQTAQLALS-----TVVTGNLRSNGNIR-QGLGSNS 305

Query: 164 SLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTA 223
               +FVG L+ DV ++ L   F  F       +M D++    +  GF++F  + DA+ A
Sbjct: 306 KNSTIFVGGLSTDVSEQELNELFRPF-----GEIM-DVKIPLGKKCGFVTFKRRIDAKAA 359

Query: 224 MDKMQSTELNGRQIRINWA 242
           +  +    + G  IR++W 
Sbjct: 360 IKGLHGFLVRGCPIRLSWG 378

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 4/81 (4%)

Query: 73  GRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDAD 132
           G  + +  ++VG L   ++E+ L + F+  G I +VK+   K       FV + +  DA 
Sbjct: 302 GSNSKNSTIFVGGLSTDVSEQELNELFRPFGEIMDVKIPLGK----KCGFVTFKRRIDAK 357

Query: 133 VAFKNLNGKTIETKVLKINWA 153
            A K L+G  +    ++++W 
Sbjct: 358 AAIKGLHGFLVRGCPIRLSWG 378

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%)

Query: 325 TTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYP 384
           +T+++G +    +E +L  L + FG I+D K    K   F+ +     A   I  L  + 
Sbjct: 308 STIFVGGLSTDVSEQELNELFRPFGEIMDVKIPLGKKCGFVTFKRRIDAKAAIKGLHGFL 367

Query: 385 FQGRNLKTGWGK 396
            +G  ++  WGK
Sbjct: 368 VRGCPIRLSWGK 379

>KLLA0C08019g Chr3 complement(704199..705104) [906 bp, 301 aa] {ON}
           weakly similar to uniprot|Q00916 Saccharomyces
           cerevisiae YIL061C SNP1 U1snRNP 70K protein homolog,
          Length = 301

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 4/87 (4%)

Query: 152 WAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGF 211
           W  +S    S +    LFVG L+  VD+  L  +F ++       ++ D Q G+SRGYGF
Sbjct: 101 WHPESDANISSDPYRTLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRD-QDGKSRGYGF 159

Query: 212 ISFSNQEDAQTAMDKM---QSTELNGR 235
           + F++ ED++    ++   +  E+ GR
Sbjct: 160 VQFTSYEDSKQCFRELGVRKGIEIMGR 186

>NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80
          Length = 399

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFVG+L+ D  DE L   F      ++  +     +G+ +G+ F+ F N+E A  A+   
Sbjct: 240 LFVGNLSFDTTDELLRKHFQHCGEIIKIRMATFEDSGKCKGFAFVDFKNEEGATNALKDK 299

Query: 228 QSTELNGRQIRINWASKR 245
              ++ GR +R+ +   R
Sbjct: 300 TCRKIAGRPLRMEFGEDR 317

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 2/77 (2%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKV--INDKNNSVNYAFVEYLQHHDADVAFK 136
           +IL+VGNL     +E L+++FQ  G I  +++    D      +AFV++     A  A K
Sbjct: 238 RILFVGNLSFDTTDELLRKHFQHCGEIIKIRMATFEDSGKCKGFAFVDFKNEEGATNALK 297

Query: 137 NLNGKTIETKVLKINWA 153
           +   + I  + L++ + 
Sbjct: 298 DKTCRKIAGRPLRMEFG 314

>Kpol_1026.16 s1026 (34514..35347) [834 bp, 277 aa] {ON}
           (34514..35347) [834 nt, 278 aa]
          Length = 277

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 8/80 (10%)

Query: 321 PLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFK--YYPE----KGNCFIKYDTHEQAA 374
           P RV  VY+G+IP+  TE  L+ L +N G +++ K  + P+    KG  F++Y   E +A
Sbjct: 12  PSRV--VYLGSIPYDQTEEQLLDLCRNVGPVVNLKLMFDPQTGKSKGYAFVEYKDLETSA 69

Query: 375 VCIVVLANYPFQGRNLKTGW 394
             +  L  YP   R LK G+
Sbjct: 70  SAVRNLNGYPIGSRFLKCGY 89

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHDADVAFK 136
           +++Y+G++     EE L    +  GP+ N+K++ D     S  YAFVEY     +  A +
Sbjct: 14  RVVYLGSIPYDQTEEQLLDLCRNVGPVVNLKLMFDPQTGKSKGYAFVEYKDLETSASAVR 73

Query: 137 NLNGKTIETKVLKINWAFQS 156
           NLNG  I ++ LK  ++  S
Sbjct: 74  NLNGYPIGSRFLKCGYSSNS 93

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 39/76 (51%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           +++G +  D  +E L          V   +M+D QTG+S+GY F+ + + E + +A+  +
Sbjct: 16  VYLGSIPYDQTEEQLLDLCRNVGPVVNLKLMFDPQTGKSKGYAFVEYKDLETSASAVRNL 75

Query: 228 QSTELNGRQIRINWAS 243
               +  R ++  ++S
Sbjct: 76  NGYPIGSRFLKCGYSS 91

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 90/192 (46%), Gaps = 30/192 (15%)

Query: 72  GGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDA 131
           G     ++ +Y+GNL K I  E +    + GG + +VK+++D+       FV ++    A
Sbjct: 441 GPNNLGNRTVYLGNLPKDIKIEEICNVVR-GGLLQSVKLLSDRY----VCFVTFIDPTAA 495

Query: 132 D--VAFKNLNGKTIETKVLKINWAFQSQQ-------TTSDESLFNLFVGDLNVDVD---- 178
               A  +L+G TI+ K  K+ W   S           S+ +  N+++G++N + D    
Sbjct: 496 AQFYAMSSLHGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIGNINFEKDAMRD 555

Query: 179 -----DETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELN 233
                +++L   F ++    Q + + +      +   FI+F+N  +A  A+DK++S   +
Sbjct: 556 PRIFTEDSLRKLFRQYGEVEQINFLPE------KNCCFINFTNISNAILALDKIKSNP-H 608

Query: 234 GRQIRINWASKR 245
              ++IN+   R
Sbjct: 609 FEDLKINFGKDR 620

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 44/84 (52%), Gaps = 7/84 (8%)

Query: 320 APLRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCI-- 377
           AP R  TVY+GNIP   T  +L+  +++ G + D K  PEK   FI +   E +A+    
Sbjct: 211 APSR--TVYLGNIPSNLTVKELLDHVRS-GVVEDVKIIPEKLCAFISF-VDESSALLFHS 266

Query: 378 -VVLANYPFQGRNLKTGWGKEKAV 400
             +L      G+++K GWGK   V
Sbjct: 267 DAILKRLNIGGKDIKIGWGKPTTV 290

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%)

Query: 337 TEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLANYPFQGRNLKTGWGK 396
           TEA L   L++FG I   K  PEKG  F+ + +   A  C+  L +      N K  +GK
Sbjct: 326 TEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNLRSMNPYYENKKIAYGK 385

Query: 397 EKAVFI 402
           ++  FI
Sbjct: 386 DRCAFI 391

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 10/82 (12%)

Query: 327 VYIGNI---------PHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCI 377
           VYIGNI         P   TE  L  L + +G +    + PEK  CFI +     A + +
Sbjct: 541 VYIGNINFEKDAMRDPRIFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILAL 600

Query: 378 VVLANYPFQGRNLKTGWGKEKA 399
             + + P    +LK  +GK++ 
Sbjct: 601 DKIKSNP-HFEDLKINFGKDRC 621

>KLTH0F02838g Chr6 complement(245748..246740) [993 bp, 330 aa] {ON}
           conserved hypothetical protein
          Length = 330

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFV  LN     + L   F  F       ++ D +TG S GYGFI F+ +E  + A  KM
Sbjct: 249 LFVCRLNPITRAKDLATIFHRFGEIDVIEIVRDKETGSSLGYGFIEFTKKESCEMAYSKM 308

Query: 228 QSTELNGRQIRINWA 242
               ++ R+I +++ 
Sbjct: 309 DGVLIDDRRIHVDFC 323

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query: 73  GRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK--NNSVNYAFVEYLQHHD 130
           G + S+++L+V  L+     + L   F   G I  ++++ DK   +S+ Y F+E+ +   
Sbjct: 241 GIKPSERVLFVCRLNPITRAKDLATIFHRFGEIDVIEIVRDKETGSSLGYGFIEFTKKES 300

Query: 131 ADVAFKNLNGKTIETKVLKINWA 153
            ++A+  ++G  I+ + + +++ 
Sbjct: 301 CEMAYSKMDGVLIDDRRIHVDFC 323

>TBLA0C05600 Chr3 complement(1357001..1357648) [648 bp, 215 aa] {ON}
           Anc_2.167 YNL110C
          Length = 215

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 42/77 (54%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           ++V  L     +  L   FS+F   +++ +  + ++G SR YGF+ F N+EDA+ A + M
Sbjct: 88  IYVSRLPQGFHERELNKYFSQFGDLIESRLARNKKSGNSRHYGFVEFVNKEDAKIAQETM 147

Query: 228 QSTELNGRQIRINWASK 244
            +  L G  +++   +K
Sbjct: 148 NNYLLMGHLLQVRLLAK 164

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 80  ILYVGNLDKSINEETLKQYF-QIGGPISNVKVINDKN-NSVNYAFVEYLQHHDADVAFKN 137
           I+YV  L +  +E  L +YF Q G  I +    N K+ NS +Y FVE++   DA +A + 
Sbjct: 87  IIYVSRLPQGFHERELNKYFSQFGDLIESRLARNKKSGNSRHYGFVEFVNKEDAKIAQET 146

Query: 138 LNGKTIETKVLKI 150
           +N   +   +L++
Sbjct: 147 MNNYLLMGHLLQV 159

>Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {ON}
           YNL175C (REAL)
          Length = 403

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFVG+L+ DV D+ L   F      ++  +     +G+ +G+ FI F N+E +  A+   
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIIKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 228 QSTELNGRQIRINWASKR 245
              ++ GR +R+ +   R
Sbjct: 301 GCRKIAGRPLRMEYGEDR 318

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKV--INDKNNSVNYAFVEYLQHHDADVAFK 136
           +IL+VGNL   + ++ L+++FQ  G I  +++    D      +AF+++     +  A K
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIIKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 137 NLNGKTIETKVLKINWA 153
           +   + I  + L++ + 
Sbjct: 299 DKGCRKIAGRPLRMEYG 315

>TDEL0B06060 Chr2 complement(1071469..1072506) [1038 bp, 345 aa]
           {ON} Anc_1.408 YNL004W
          Length = 345

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 69/179 (38%), Gaps = 21/179 (11%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLN- 139
           +++GNL      E LK +F   G +    +I  + +      VE+    D D A +  + 
Sbjct: 48  IFIGNLTYDCTPEDLKDHFSEVGEVVRADIITSRGHHRGMGTVEFTNSDDVDEAIRRYDS 107

Query: 140 -------------------GKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDE 180
                               +    +  +     + Q        + +FV +L   ++ +
Sbjct: 108 SYFMDRQVFVRQDNPPPESARERPPREARERVKARDQYPQHQYPAYEVFVANLPYSINWQ 167

Query: 181 TLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
            L   F E  + ++A V  D + G SRG+G   F   E+ Q A+++    EL GR + +
Sbjct: 168 ALKDMFKEVGNVIRADVELD-RNGYSRGFGTAIFGTSEEMQAAIERYNGYELEGRVLDV 225

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 167 NLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDK 226
           ++F+G+L  D   E L   FSE    V+A ++     G  RG G + F+N +D   A+ +
Sbjct: 47  SIFIGNLTYDCTPEDLKDHFSEVGEVVRADII--TSRGHHRGMGTVEFTNSDDVDEAIRR 104

Query: 227 MQSTELNGRQI 237
             S+    RQ+
Sbjct: 105 YDSSYFMDRQV 115

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 5/81 (6%)

Query: 323 RVTTVYIGNIPHFATEADLIPLLQNFGFI--LDFKYYPEK---GNCFIKYDTHEQAAVCI 377
           R   +Y  N+P     +DL  L +  G +   + KY  +    G   ++Y   E A VC+
Sbjct: 265 RNNLIYCTNLPLSTATSDLYDLFETIGKVNNAELKYDADGQPLGIAVVEYANIEDADVCM 324

Query: 378 VVLANYPFQGRNLKTGWGKEK 398
             L NY + G +L   + K +
Sbjct: 325 ERLNNYNYGGCDLDISYAKRE 345

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 2/86 (2%)

Query: 69  AINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN-SVNYAFVEYLQ 127
            + GG E ++ ++Y  NL  S     L   F+  G ++N ++  D +   +  A VEY  
Sbjct: 258 GVLGGGERNN-LIYCTNLPLSTATSDLYDLFETIGKVNNAELKYDADGQPLGIAVVEYAN 316

Query: 128 HHDADVAFKNLNGKTIETKVLKINWA 153
             DADV  + LN        L I++A
Sbjct: 317 IEDADVCMERLNNYNYGGCDLDISYA 342

>NCAS0F01150 Chr6 (227262..228401) [1140 bp, 379 aa] {ON} Anc_5.542
           YDR432W
          Length = 379

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 72/169 (42%), Gaps = 23/169 (13%)

Query: 75  ETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVA 134
           E S   L+V      + E  L + F   GP+  VK++N       +AFVE+ +   A  A
Sbjct: 79  ELSTTRLFVRPFPFDVQEAELNEIFTPFGPMKEVKILN------GFAFVEFEEADSAAKA 132

Query: 135 FKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQ 194
            + +NGKT   + L++ ++              L V    + + +   G ++ E     +
Sbjct: 133 IEEVNGKTFANQPLEVVYS-------------KLPVKRYRLTLRNLPEGCSWQELKDLAR 179

Query: 195 AHVM----WDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
            H +      + T    G G + F+N+E   TA++K+ + E  G  I +
Sbjct: 180 EHSLETTFSSVNTRDFDGTGALEFANEETLDTALEKLNNIEFRGSVITV 228

>TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON}
           Anc_1.102
          Length = 337

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 49/83 (59%), Gaps = 2/83 (2%)

Query: 73  GRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQHHD 130
           G + S+++L++  L+ S   + +   F   G + +V+++ DK +  S+ Y F+E+     
Sbjct: 246 GIKPSERVLFICRLNPSTKAKDIATIFHRFGEVHSVEIVRDKESGRSLCYGFIEFNDRKA 305

Query: 131 ADVAFKNLNGKTIETKVLKINWA 153
            + A+KN+NG  I+ K +K++++
Sbjct: 306 CESAYKNMNGVLIDDKRIKVDFS 328

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 40/75 (53%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LF+  LN     + +   F  F       ++ D ++GRS  YGFI F++++  ++A   M
Sbjct: 254 LFICRLNPSTKAKDIATIFHRFGEVHSVEIVRDKESGRSLCYGFIEFNDRKACESAYKNM 313

Query: 228 QSTELNGRQIRINWA 242
               ++ ++I+++++
Sbjct: 314 NGVLIDDKRIKVDFS 328

>NCAS0G01950 Chr7 complement(348633..349847) [1215 bp, 404 aa] {ON}
           Anc_2.80
          Length = 404

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFVG+L+ D  DE L   F      V+  +     +G+ +G+ FI F ++E A  A+   
Sbjct: 240 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDK 299

Query: 228 QSTELNGRQIRINWASKR 245
              ++  R IR+ +   R
Sbjct: 300 TCRKIAARPIRMEYGEDR 317

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 2/77 (2%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKV--INDKNNSVNYAFVEYLQHHDADVAFK 136
           +IL+VGNL     +E LK++FQ  G I  +++    D      +AF+++     A  A K
Sbjct: 238 RILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALK 297

Query: 137 NLNGKTIETKVLKINWA 153
           +   + I  + +++ + 
Sbjct: 298 DKTCRKIAARPIRMEYG 314

>Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {ON}
           YNL175C (NOP13) - nucleolar protein [contig 103] FULL
          Length = 393

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LFVG+L+ D  DE L   F      V+  +     TG+ +G+ F+ F ++E    A+   
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 228 QSTELNGRQIRINWASKR 245
              ++ GR +R+ +   R
Sbjct: 297 TCRKIAGRPLRMEFGEDR 314

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 2/77 (2%)

Query: 79  KILYVGNLDKSINEETLKQYFQIGGPISNVKV--INDKNNSVNYAFVEYLQHHDADVAFK 136
           +IL+VGNL     +E LK++FQ  G I  +++    D      +AFV++        A K
Sbjct: 235 RILFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALK 294

Query: 137 NLNGKTIETKVLKINWA 153
           +   + I  + L++ + 
Sbjct: 295 DKTCRKIAGRPLRMEFG 311

>ADR189W Chr4 (1034091..1034900) [810 bp, 269 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR429C (TIF35)
          Length = 269

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 166 FNLFVGDLNVDVDDETLGHAF-SEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAM 224
             L +  LN + D+ T+     S FP+  +  V+ + +TGRSRG  +++F++++DA+TA+
Sbjct: 188 MTLKIMQLNENADEMTIKQKLLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAETAL 247

Query: 225 DKMQSTELNGRQIRINWASKRE 246
             +         ++++W+  ++
Sbjct: 248 RLLHGRGFMNLILQVDWSKPKK 269

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 51/112 (45%), Gaps = 15/112 (13%)

Query: 57  AAEDDSDVVPANAINGGRETSDKI------------LYVGNLDKSINEETLKQYFQIGGP 104
           AA      VP +   GGR+ S  +            L +  L+++ +E T+KQ      P
Sbjct: 154 AASAPGKYVPPSRRAGGRDPSSDVYKDQRERDDAMTLKIMQLNENADEMTIKQKLLSPFP 213

Query: 105 -ISNVKVINDK--NNSVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWA 153
            +  V V+ +K    S   A+V +    DA+ A + L+G+     +L+++W+
Sbjct: 214 NVPRVAVVRNKETGRSRGIAYVTFASEKDAETALRLLHGRGFMNLILQVDWS 265

>NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON}
           Anc_2.167
          Length = 224

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           L+V  L     +  L   FS+F    +  +  + +TG SR YGFI F+N++DA  A D M
Sbjct: 96  LYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQDAM 155

Query: 228 QSTELNGRQIRINWASK 244
            +  + G  +++    K
Sbjct: 156 NNYLVMGHLLQVRLLPK 172

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 80  ILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN--NSVNYAFVEYLQHHDADVAFKN 137
           ILYV  L +  +E  L +YF   G +  V++  +K   NS +Y F+E+    DA++A   
Sbjct: 95  ILYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQDA 154

Query: 138 LNGKTIETKVLKI 150
           +N   +   +L++
Sbjct: 155 MNNYLVMGHLLQV 167

>NCAS0E03880 Chr5 complement(761175..763328) [2154 bp, 717 aa] {ON}
           Anc_5.76 YGR250C
          Length = 717

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/214 (20%), Positives = 87/214 (40%), Gaps = 40/214 (18%)

Query: 69  AINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDK-----------NNS 117
           +IN    T    +++G ++  I+E  ++  F+  G I ++K+ +D+           +N 
Sbjct: 171 SINKHALTHPGNIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNP 230

Query: 118 VNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQS-----------QQTTSDESLF 166
           + Y F+ ++    A       NGK IE   L +N+  +            ++   DE   
Sbjct: 231 IGYGFISFVLGSQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFK 290

Query: 167 NLFVG-------DLNVDVDDETLGHAFSE-----------FPSFVQAHVMWDMQTGRSRG 208
            +F+G       DL +D+  + +    SE           FP     +   + ++   +G
Sbjct: 291 CIFIGNLPTTLTDLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINNKSSPLKG 350

Query: 209 YGFISFSNQEDAQTAMDKMQSTELNGRQIRINWA 242
           YGF++  + E A   +  +   E  G ++ +N A
Sbjct: 351 YGFVNLGSHEQALKVIQTLDGLEWKGNRLVVNKA 384

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 40/89 (44%), Gaps = 9/89 (10%)

Query: 167 NLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSR---------GYGFISFSNQ 217
           N+F+G +N  +D+  +   F +F S +   +  D     +          GYGFISF   
Sbjct: 182 NIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLG 241

Query: 218 EDAQTAMDKMQSTELNGRQIRINWASKRE 246
             A   +++     + G ++ +N+  +R+
Sbjct: 242 SQASECINEFNGKIIEGTKLFLNYHVERK 270

>SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some
           similarities with uniprot|P53316 Saccharomyces
           cerevisiae YGR250C Hypothetical ORF
          Length = 817

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 89/218 (40%), Gaps = 58/218 (26%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN--SVNYAFVEYLQHHDADVAFKNL 138
           LY+  + K +  + L   F   GP+ ++K+I   +   S+ Y F+ +     A +  K L
Sbjct: 199 LYIRGIPKDLTVDDLVPVFSKFGPVLSLKIICHPSTGQSLGYGFISFPLGSQAALCIKEL 258

Query: 139 NGKTIETKVLKINWAFQSQQT-----------TSDESLFNLFVGDLNV------------ 175
           NG  + +  L IN+  + ++              DE    +F+G+L              
Sbjct: 259 NGNLMNSSPLFINYHVERKERERIHWDHVKEDNDDERFRGIFIGNLPTNDASGELLTPEG 318

Query: 176 ----------DVDD------ETLGHAFSEFPSFVQAHVMW--------DMQTGRS----- 206
                     D +D      E + + F +  S  ++H+ +        +++T  S     
Sbjct: 319 VITKFKQELNDGEDGEQKEYEIVSYCFPKRNS--KSHIEYKDEDDMRDNVETCESQYEES 376

Query: 207 --RGYGFISFSNQEDAQTAMDKMQSTELNGRQIRINWA 242
             RGYGFI FS  + A  A++K +  E +G ++ +N A
Sbjct: 377 PLRGYGFIKFSTHDQALKAIEKCRELEWSGNKLIVNKA 414

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%)

Query: 167 NLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDK 226
           NL++  +  D+  + L   FS+F   +   ++    TG+S GYGFISF     A   + +
Sbjct: 198 NLYIRGIPKDLTVDDLVPVFSKFGPVLSLKIICHPSTGQSLGYGFISFPLGSQAALCIKE 257

Query: 227 MQSTELNGRQIRINWASKRE 246
           +    +N   + IN+  +R+
Sbjct: 258 LNGNLMNSSPLFINYHVERK 277

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 6/60 (10%)

Query: 327 VYIGNIPHFATEADLIPLLQNFGFILDFK--YYPEKGNC----FIKYDTHEQAAVCIVVL 380
           +YI  IP   T  DL+P+   FG +L  K   +P  G      FI +    QAA+CI  L
Sbjct: 199 LYIRGIPKDLTVDDLVPVFSKFGPVLSLKIICHPSTGQSLGYGFISFPLGSQAALCIKEL 258

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 44/111 (39%), Gaps = 27/111 (24%)

Query: 160 TSDESLFNLFVGDLNVDVDDETLGHAFSEFPSFVQAHVMW-------------------- 199
           T D+   NL++  L     D  L   + +F   + A ++                     
Sbjct: 568 TRDQQESNLYIKHLPFSWKDRDLYQFYEKFGEIISAKIITVGGSKNEDNISSDSTGKSKK 627

Query: 200 --DMQTGRSRGYGFISFSNQEDAQTAM---DKMQSTELNGRQIRINWASKR 245
             ++  G S+GYGF+ F N  DA  AM   D+ Q  E     + +++A KR
Sbjct: 628 QDELPLGTSKGYGFVCFKNPLDASRAMMATDRFQIDE--NHTLYVSFAQKR 676

>Kpol_487.6 s487 (35743..36873) [1131 bp, 376 aa] {ON}
           (35743..36873) [1131 nt, 377 aa]
          Length = 376

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 76/180 (42%), Gaps = 22/180 (12%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNSVNYAFVEYLQHHDADVAFKNLNG 140
           ++VGNL      E L+ +F   G +    +I  + +      VE+    D + A    +G
Sbjct: 70  VFVGNLTYDCTPEDLRDHFSTIGEVVRADIITSRGHHRGMGTVEFTNADDVNEAISQYDG 129

Query: 141 KTIETK---VLKINWAFQSQQTT-------------SDESL-----FNLFVGDLNVDVDD 179
             +  +   V + N   ++   +             +D SL     + +F+ +L   ++ 
Sbjct: 130 SYLLDRQIFVRQDNPPPEASHESEPPRERRERRTLGNDGSLHSHIGYEVFIANLPYSINW 189

Query: 180 ETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIRI 239
           + L   F E  S ++A V  D + G SRG+G +   +QED + A+      EL GR + +
Sbjct: 190 QALKDMFKECGSVIRADVELD-RNGYSRGFGTVILGSQEDMERAISMYNGYELEGRVLEV 248

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 76/200 (38%), Gaps = 35/200 (17%)

Query: 81  LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNN-SVNYAFVEYLQHHDADVAFKNLN 139
           +++ NL  SIN + LK  F+  G +    V  D+N  S  +  V      D + A    N
Sbjct: 178 VFIANLPYSINWQALKDMFKECGSVIRADVELDRNGYSRGFGTVILGSQEDMERAISMYN 237

Query: 140 GKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVDDETLGHA-------------- 185
           G  +E +VL++     + Q        ++ + D   D++DE  G +              
Sbjct: 238 GYELEGRVLEVREGRSNNQDEEMPISEDIEINDNGNDINDENAGTSDQFTDGVVGGGEKN 297

Query: 186 ----FSEFPSFVQAHVMWDM---------------QTGRSRGYGFISFSNQEDAQTAMDK 226
                S  P       ++D+               Q G   G   + + N +DAQ  +D+
Sbjct: 298 ELIYCSNLPFSTAKSDLFDLFETIGKLKNAELKFDQKGNPTGVAIVEYENVDDAQVCVDR 357

Query: 227 MQSTELNGRQIRINWASKRE 246
           + +    G  + I++  KRE
Sbjct: 358 LNNYNYGGCDLDISYG-KRE 376

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 327 VYIGNIPHFATEADLIPLLQNFGFILDFKY-YPEKGN----CFIKYDTHEQAAVCIVVLA 381
           +Y  N+P    ++DL  L +  G + + +  + +KGN      ++Y+  + A VC+  L 
Sbjct: 300 IYCSNLPFSTAKSDLFDLFETIGKLKNAELKFDQKGNPTGVAIVEYENVDDAQVCVDRLN 359

Query: 382 NYPFQGRNLKTGWGKEK 398
           NY + G +L   +GK +
Sbjct: 360 NYNYGGCDLDISYGKRE 376

>NCAS0A08980 Chr1 (1778830..1780647) [1818 bp, 605 aa] {ON}
           Anc_1.357 YFR023W
          Length = 605

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           LF+  L  DV +  L   FS++ S V   +  D  + +S  YG+++FS++ +A+ A+D  
Sbjct: 94  LFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFSDELEAKKAVDDF 153

Query: 228 QSTELNGRQIRI 239
             T L G +I++
Sbjct: 154 NYTILFGNEIKM 165

>TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {ON}
           Anc_2.80 YNL175C
          Length = 388

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 93/212 (43%), Gaps = 36/212 (16%)

Query: 67  ANAINGGRETSDKI-----LYVGNLDKSINEETLKQYF-------QIGGPISNVKVI--- 111
           +++ +G + T+DK      +++GNL     +E L ++F       + G  I+   ++   
Sbjct: 92  SSSADGEQPTADKKDKKYGVWIGNLSFDTTKEDLVRFFSAKTKESEDGAQITEETIVRVN 151

Query: 112 -----ND----KNNSVNYAFVEYLQHHDADVAFK--NLNGKTIETKVLKINWAFQSQQTT 160
                ND    +N    Y   E  +  +A ++    +LNG+ +   ++K + +F  +   
Sbjct: 152 MPLAQNDGKKIRNKGFCYMDFETTEQMEAAISLSESHLNGRNL---LIKNSKSFDGRPDK 208

Query: 161 SDESLFN-------LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFIS 213
           +D    +       LFVG+L+ D  DE L   F      V+  +     +G+ +G+ F+ 
Sbjct: 209 NDLVSLSKNPPSRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVD 268

Query: 214 FSNQEDAQTAMDKMQSTELNGRQIRINWASKR 245
           F ++E A  A+      ++  R IR+ +   R
Sbjct: 269 FKDEEGATNALKDKGCRKIAQRPIRMEYGEDR 300

>CAGL0L03806g Chr12 (440385..441152) [768 bp, 255 aa] {ON} similar
           to uniprot|P53927 Saccharomyces cerevisiae YNL110c
          Length = 255

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 39/77 (50%)

Query: 168 LFVGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKM 227
           ++VG L     +  L   FS+F    +  +  + +TG SR YGF+ F N +D++ A D M
Sbjct: 127 IYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAYDTM 186

Query: 228 QSTELNGRQIRINWASK 244
            +  L G  +++    K
Sbjct: 187 NNYLLMGHLLQVRLLPK 203

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 80  ILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKN--NSVNYAFVEYLQHHDADVAFKN 137
           I+YVG L K  +E  L +YF   G +  V++  +K   NS +Y FV+++   D+ VA+  
Sbjct: 126 IIYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAYDT 185

Query: 138 LNGKTIETKVLKIN 151
           +N   +   +L++ 
Sbjct: 186 MNNYLLMGHLLQVR 199

>KAFR0B03680 Chr2 (767040..768365) [1326 bp, 441 aa] {ON} Anc_8.822
           YMR268C
          Length = 441

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 77/185 (41%), Gaps = 29/185 (15%)

Query: 60  DDSDVVPANAINGGRETSDKI--LYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNS 117
           +D D++    +N    ++ ++  + V NL KS N+  +K++FQ  G I  V V++D    
Sbjct: 8   EDEDIIENKKLNSNTTSNREVSTVLVKNLPKSSNQNKVKKFFQDCGDIRYVDVLDDLKKL 67

Query: 118 VNYAFVEYLQHHDADVAF----KNLNGKTIETKVLK--INWA--FQSQQTTSDESLFNLF 169
              A VE+  H  A  A     K +    IE  +L+    WA  F    T  D       
Sbjct: 68  SRLARVEFESHDAALTALTKTSKKVGNNEIEVSLLENCTLWATNFPPTYTIKDIKALLKS 127

Query: 170 VGDLNVDVDDETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQS 229
           VG L + V           FPS         ++   +R + +I   + ED Q A+D ++ 
Sbjct: 128 VGLLAISV----------RFPS---------LRYNANRRFAYIDVPSNEDLQKAVDLLEG 168

Query: 230 TELNG 234
            E  G
Sbjct: 169 KEFEG 173

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 64/144 (44%), Gaps = 23/144 (15%)

Query: 115 NNSVNYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLF----NLFV 170
           N +  +A+++   + D   A   L GK  E   L +  +  S++T   ++       +F+
Sbjct: 143 NANRRFAYIDVPSNEDLQKAVDLLEGKEFEGYNLVMKKSNPSEKTRRTDAATIERREIFI 202

Query: 171 GDLNVD-VDDETLGHAFSEF--------PSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQ 221
            +L+   ++  TL  AF +F        P+FV+         G      FIS+  ++ A 
Sbjct: 203 RNLDPQFLNKTTLKKAFEKFGDIEYINIPTFVE---------GARNCCAFISYITKDAAI 253

Query: 222 TAMDKMQSTELNGRQIRINWASKR 245
            A++    TE+NGR I I  A K+
Sbjct: 254 KALE-ANKTEMNGRVISITLADKK 276

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,318,917
Number of extensions: 1442802
Number of successful extensions: 6684
Number of sequences better than 10.0: 592
Number of HSP's gapped: 6205
Number of HSP's successfully gapped: 1376
Length of query: 442
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 329
Effective length of database: 40,524,141
Effective search space: 13332442389
Effective search space used: 13332442389
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)