Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C034402.293ON57957928890.0
Kpol_1003.422.293ON49053813001e-175
Skud_9.832.293ON49154111921e-158
NDAI0B035202.293ON50153111921e-158
SAKL0E07524g2.293ON47953411871e-158
Suva_9.1092.293ON49154011871e-157
Smik_9.892.293ON49154011851e-157
YIL090W (ICE2)2.293ON49154111721e-155
ZYRO0A02024g2.293ON48653911631e-154
CAGL0D04202g2.293ON49953611631e-154
NCAS0B062202.293ON48652811581e-153
TDEL0G022302.293ON48855211511e-152
KAFR0J013302.293ON49153711491e-152
KNAG0A053902.293ON49753411361e-150
KLTH0G10516g2.293ON47453711221e-148
Kwal_27.115002.293ON47553710881e-143
ADL208W2.293ON50254610771e-141
Ecym_33322.293ON51355510641e-139
TBLA0B069902.293ON5365589601e-123
TBLA0B059802.293ON4935379331e-119
KLLA0E08207g2.293ON4863518671e-109
NCAS0B083601.172ON504155850.11
KLLA0A10395gna 1ON29448696.9
Smik_16.4073.502ON61685699.2
KAFR0B025408.233ON539118699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C03440
         (579 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...  1117   0.0  
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   505   e-175
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   463   e-158
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   463   e-158
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   461   e-158
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   461   e-157
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   461   e-157
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   456   e-155
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   452   e-154
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   452   e-154
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   450   e-153
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   447   e-152
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   447   e-152
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   442   e-150
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   436   e-148
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   423   e-143
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   419   e-141
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   414   e-139
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            374   e-123
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   363   e-119
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   338   e-109
NCAS0B08360 Chr2 complement(1595487..1597001) [1515 bp, 504 aa] ...    37   0.11 
KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {O...    31   6.9  
Smik_16.407 Chr16 complement(707447..709297) [1851 bp, 616 aa] {...    31   9.2  
KAFR0B02540 Chr2 complement(505010..506629) [1620 bp, 539 aa] {O...    31   9.6  

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score = 1117 bits (2889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/579 (95%), Positives = 555/579 (95%)

Query: 1   MTSDNKLFSFQEGTXXXXXXXXXXXXXEKLMQETVVVRQPSRRKYILQNLIPRGVINSGH 60
           MTSDNKLFSFQEGT             EKLMQETVVVRQPSRRKYILQNLIPRGVINSGH
Sbjct: 1   MTSDNKLFSFQEGTKKKKRQRQKQKQREKLMQETVVVRQPSRRKYILQNLIPRGVINSGH 60

Query: 61  AVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLTHNTTLRLL 120
           AVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLTHNTTLRLL
Sbjct: 61  AVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLTHNTTLRLL 120

Query: 121 ASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQILFIIKDYF 180
           ASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQILFIIKDYF
Sbjct: 121 ASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQILFIIKDYF 180

Query: 181 VNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXXXKPWKFLLINS 240
           VNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSW           KPWKFLLINS
Sbjct: 181 VNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWILFFYYYYIFIKPWKFLLINS 240

Query: 241 TPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLYYLNRIYVT 300
           TPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLYYLNRIYVT
Sbjct: 241 TPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLYYLNRIYVT 300

Query: 301 PFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEMSPELAISA 360
           PFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEMSPELAISA
Sbjct: 301 PFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEMSPELAISA 360

Query: 361 TDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLFPKTIELGISKNL 420
           TDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLFPKTIELGISKNL
Sbjct: 361 TDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLFPKTIELGISKNL 420

Query: 421 IVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIINLSFRLMIFYSATRIIPAI 480
           IVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIINLSFRLMIFYSATRIIPAI
Sbjct: 421 IVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIINLSFRLMIFYSATRIIPAI 480

Query: 481 QRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELKKNICLWNCENWLSSSSDV 540
           QRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELKKNICLWNCENWLSSSSDV
Sbjct: 481 QRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELKKNICLWNCENWLSSSSDV 540

Query: 541 KSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGRS 579
           KSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGRS
Sbjct: 541 KSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGRS 579

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  505 bits (1300), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 277/538 (51%), Positives = 354/538 (65%), Gaps = 66/538 (12%)

Query: 53  RGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLT 112
           + +I S   VLV FYLLNIV TIPISFKIGG+YCGL+FT TLF LYF ST++ II +R  
Sbjct: 6   KNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNIIARRWG 65

Query: 113 HNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQI 172
               + ++ SS FY QNFII SLL ++L GF N+DLI ++          ++G   K   
Sbjct: 66  SKPAI-IITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSI----------RSGIQPK--- 111

Query: 173 LFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXXXKP 232
                + F++     L R D                    P  + +W           KP
Sbjct: 112 -----ETFLD-----LLRGD-------------------IPVSVKNWLLFYYYYSYTVKP 142

Query: 233 WKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLY 292
           W+ +L  STP FTLLEGFFTILGIQTIGE N WLK +++S+ W+I SLL+SGG+IT +LY
Sbjct: 143 WQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNIWIISSLLTSGGLITGSLY 202

Query: 293 YLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEM 352
           YL RIY TP W+L+V  A++LGFTLS+VG LG++GIVS NGS IESSLFFAYIVRCIYE+
Sbjct: 203 YLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGSVIESSLFFAYIVRCIYEI 262

Query: 353 SPELAISATDEFLEGFNEVWQMNQNRITVADNVLTY-CKKYIMDA------FSSFSSIEH 405
           +PELA +AT+EFLEG  EVWQ +   + VAD  ++Y    + M A      F+S +    
Sbjct: 263 APELATTATEEFLEGIKEVWQSHHANLNVADGFISYFYDSFHMQAHKFWTLFTSRTPYYG 322

Query: 406 HLFPKTIELGISKNLIVKQF---WVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIIN 462
           +L    ++   S  +I   F   W  LK  T +VP+SI++L  +T +MA+DS+SPAIIIN
Sbjct: 323 YLHNYCMDYP-SLVMIRSNFYPIWETLKTLTFSVPTSISELFHLTVRMAIDSVSPAIIIN 381

Query: 463 LSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELK 522
           L FRLMIFYSATRIIPAIQ+RT+ +   + G M A+YW+SPC+LIAMYTHLILQ+SGELK
Sbjct: 382 LCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWYSPCILIAMYTHLILQYSGELK 441

Query: 523 KNICLWNCENWLSSSSDVKSTNLGDNS--IIVDSWSFWNWCNIFWTIIIYASELIGGR 578
           K++CLW C+          ST  G++   I VD+WSFWNWCNIFWTIIIY SELIGG+
Sbjct: 442 KDLCLWGCD----------STWFGEDQERINVDAWSFWNWCNIFWTIIIYGSELIGGK 489

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  463 bits (1192), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 257/541 (47%), Positives = 338/541 (62%), Gaps = 65/541 (12%)

Query: 51  IPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKR 110
           + +  + SG      FYLL  +++IPISFK+GG+ CGLSFT TLF LYFI+T++ ++ KR
Sbjct: 4   LSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLAKR 63

Query: 111 LTHNTTLRL-LASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTK 169
             H   L + L + L+Y Q+F+I+SLL ++L GF+N +L   L          KN +N  
Sbjct: 64  --HGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVL----------KNRSNES 111

Query: 170 YQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXX 229
              L  +KD              N +N +L                              
Sbjct: 112 ESFLDALKDSL----------NSNQINYVLYYYYYR----------------------FV 139

Query: 230 XKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITA 289
            +PW+F+L  STPFFTL EGFFTIL IQ +GETN WL    +S+ W+I SLL+SGGVITA
Sbjct: 140 VQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTWIISSLLASGGVITA 199

Query: 290 TLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCI 349
           +LYYL RIYVTP W L++ TAS+LGF LS+V GLG++GIVS+ GS IESSLFFAYIVRCI
Sbjct: 200 SLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKGSVIESSLFFAYIVRCI 259

Query: 350 YEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIM-DAFSSFSSIEHHLF 408
           YE+SP+LA +ATDE L+ F +VWQ +Q  +  ADN+L Y    ++ +A   + S      
Sbjct: 260 YEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVVLKNAEMLWGSFIPRGR 319

Query: 409 PKTIE--------LGISK-NLIVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAI 459
            KT +        L   K +LI + FW F KNFT +VP SIN+  Q+T +MA +S+SPAI
Sbjct: 320 KKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAI 379

Query: 460 IINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSG 519
           +INL FR+++FYSATRIIPA+QR+           M  +YW+SPC+LIAMYTHLILQ+SG
Sbjct: 380 VINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYWYSPCILIAMYTHLILQYSG 439

Query: 520 ELKKNICLWNC-ENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGR 578
           ELKK++C+W C E W  +             IIVDSW FWNWCNIF TI++YA+ELIG  
Sbjct: 440 ELKKDLCIWGCSEKWFGAEQP---------EIIVDSWGFWNWCNIFCTILVYATELIGSG 490

Query: 579 S 579
           S
Sbjct: 491 S 491

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  463 bits (1192), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 253/531 (47%), Positives = 343/531 (64%), Gaps = 70/531 (13%)

Query: 64  VAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLTHNTTLRLLASS 123
            AFYLL  +++IPISFKIGG+ CGL+FT TLF +YF+ST+++++ ++   N ++  L   
Sbjct: 15  AAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARKYGSNFSI-FLTGF 73

Query: 124 LFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQILFIIKDYFVNI 183
           L+Y Q+ II+SLL ++L GF+++DL   L+  DD    +K                 V+I
Sbjct: 74  LYYSQHLIIASLLYLFLSGFSHEDLTIPLS--DD---TQK-----------------VDI 111

Query: 184 MNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXXXKPWKFLLINSTPF 243
           ++ ++ R  +  N                    ++W           +PWK+LL  STPF
Sbjct: 112 ISDVVRRNLSSTN--------------------SNWNLYHNYYTFFVQPWKYLLSYSTPF 151

Query: 244 FTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLYYLNRIYVTPFW 303
           FTL EGFFTIL IQ +GETN WL  + +S+ W+I SLL+SGGVITA+LYYL RIYVTP W
Sbjct: 152 FTLSEGFFTILAIQAVGETNKWLVNEINSNTWIISSLLTSGGVITASLYYLYRIYVTPIW 211

Query: 304 DLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEMSPELAISATDE 363
            L++ TAS+LGFTLS+VGGLG++GIV++ GS IESSLFFAYIVRCIYE+SP+LA +ATDE
Sbjct: 212 QLSIQTASLLGFTLSLVGGLGLYGIVTEKGSVIESSLFFAYIVRCIYEISPKLATTATDE 271

Query: 364 FLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSI---------EHHLFPKTIEL 414
            LE F EVWQ +Q  +   DN+L Y   +++        +          ++  P +  +
Sbjct: 272 ILEIFKEVWQRHQGNLPTTDNLLFYYNNFVLRHIDMLWELLVSKINQNDPNNTLPSSFNI 331

Query: 415 G-----ISKNL---IVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIINLSFR 466
                 +SK+L   I K  W   KNFT++VPSSI++L+ +T QMA +S+SPA++INL FR
Sbjct: 332 NFLTTFLSKDLLLRICKPIWKLFKNFTVSVPSSISELVLVTYQMARESVSPAVVINLCFR 391

Query: 467 LMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELKKNIC 526
           ++IFYSATRIIPA+QRR   +       M  +YW+SPC+LIAMYTHLILQ+SGELKK++C
Sbjct: 392 VLIFYSATRIIPALQRRNDSELKKSRRIMKILYWYSPCVLIAMYTHLILQYSGELKKDLC 451

Query: 527 LWNCE-NWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIG 576
           LW C   WL  +            +IVDSW FWNWCNIF+TIIIYASEL G
Sbjct: 452 LWGCNLKWLIPNQP---------ELIVDSWGFWNWCNIFFTIIIYASELFG 493

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  461 bits (1187), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 247/534 (46%), Positives = 340/534 (63%), Gaps = 60/534 (11%)

Query: 50  LIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITK 109
           ++PR +I S    L  FYLL +++TIPISF++GG+YCGLSFT TLF LYF++T++ I++K
Sbjct: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSK 60

Query: 110 RLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTK 169
           +  +N     + S ++Y+Q+FII SLL ++L GFNN +L                    K
Sbjct: 61  K--YNRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDEL--------------------K 98

Query: 170 YQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXX 229
            QI                   D  +N    L  +S  N + +    +SW          
Sbjct: 99  RQI-------------------DGDVN----LPRESLVNFLRNKSGKHSWIFYYYYYKFT 135

Query: 230 XKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITA 289
            KPW+F+L++STP+FTLLEGFFT+LGIQ IGETN WL+  K+S+ W+I+SLL SGGVIT 
Sbjct: 136 VKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNSNTWIIVSLLISGGVITT 195

Query: 290 TLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCI 349
           +LYYL RIYVTP W+L++ TAS+LGFTLSIV GLG++GIVS  GS IESSLFFAYIVRCI
Sbjct: 196 SLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGKGSVIESSLFFAYIVRCI 255

Query: 350 YEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLFP 409
           YE+SP+LA SA DE  +   + WQ +Q  +   DN+L+Y +  ++    +   I   +  
Sbjct: 256 YEISPQLATSAMDEIFKIVKDTWQKHQGNLP-TDNLLSYYRNVVLK---NGEMIWDAIVQ 311

Query: 410 KTIELGISKNLIV----KQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIINLSF 465
           KT     S   +V    +  W F KNFTI+VPSSI ++ ++T +MA +S++P ++INL F
Sbjct: 312 KTGTTSPSTTQMVWLRLQPLWKFTKNFTISVPSSIREIFRVTLKMATESVTPTVVINLVF 371

Query: 466 RLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELKKNI 525
           R+++FYSATRIIPA+Q+            M  +YW+SPC++IAMYTHLILQ+SGEL  ++
Sbjct: 372 RILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMYTHLILQYSGELNNDL 431

Query: 526 CLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGRS 579
           CLW C  W         TN   + ++VD+W FWNWCN+F T+ IY  ELIGG+S
Sbjct: 432 CLWGCFPW-------SHTNDPSSKVVVDAWGFWNWCNVFCTLAIYGLELIGGKS 478

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  461 bits (1187), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 258/540 (47%), Positives = 335/540 (62%), Gaps = 63/540 (11%)

Query: 51  IPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKR 110
           + +  + SG      FYLL  +++IPISFK+GG+ CGLSFT TLF LYFI+T++ ++ +R
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 111 LTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKY 170
                    L S L+Y Q+F+I+SLL ++L GF+N +L   L          KN +N   
Sbjct: 64  -NGGRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVL----------KNRSNESE 112

Query: 171 QILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXXX 230
             L  +K    N +N       N +N +L                               
Sbjct: 113 SFLEALK----NSLN------SNQINYVLYYYYYR----------------------FVV 140

Query: 231 KPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITAT 290
           +PW+F+L  STPFFTL EGFFTIL IQ +GETN WL    +S+ W+I SLL+SGGVITA+
Sbjct: 141 QPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTWIISSLLASGGVITAS 200

Query: 291 LYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIY 350
           LYYL RIYVTP W L++ TAS+LGF LS+V GLG++GIVS+ GS IESSLFFAYIVRCIY
Sbjct: 201 LYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQRGSVIESSLFFAYIVRCIY 260

Query: 351 EMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMD----AFSSF----SS 402
           E+SP+LA +ATDE L+ F +VWQ +Q  +  ADN+L Y    I+      + SF      
Sbjct: 261 EISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVILKNAEVLWGSFIPRRRK 320

Query: 403 IEHHLFPKTIE-LGISK-NLIVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAII 460
               L  K I  L   K +LI K FW F KNFT +VP SIN+  Q+T +MA +S+SPAI+
Sbjct: 321 TTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSINEFCQVTIKMASESVSPAIV 380

Query: 461 INLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGE 520
           INL FR+++FYSATRIIPA+QR+           M  +YW+SPC+LIAMYTHLILQ+SGE
Sbjct: 381 INLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGE 440

Query: 521 LKKNICLWNC-ENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGRS 579
           LKK++C+W C E W                IIVDSW FWNWCNIF TI++YA+EL+G  S
Sbjct: 441 LKKDLCIWGCSEKWFGPDQP---------EIIVDSWGFWNWCNIFCTILVYATELVGSGS 491

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  461 bits (1185), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 257/540 (47%), Positives = 337/540 (62%), Gaps = 63/540 (11%)

Query: 51  IPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKR 110
           + +  + SG      FYLL  +++IPISFK+GG+ CGLSFT TLF LYFI+T++ ++ +R
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 111 LTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKY 170
                 +  L S L+Y Q+FII+SLL ++L GF+N +L   L                  
Sbjct: 64  YGGKLYI-FLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLK----------------- 105

Query: 171 QILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXXX 230
                              +  N     L+ ALK+  NS     ++N +           
Sbjct: 106 -------------------KRPNESESFLE-ALKNSLNS----NQIN-YVLYYYYFRFVV 140

Query: 231 KPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITAT 290
           +PW+F+L  STPFFTL EGFFTIL IQ +GETN WL    +S+ W+I SLL+SGGVITA+
Sbjct: 141 QPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTWIISSLLASGGVITAS 200

Query: 291 LYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIY 350
           LYYL RIYVTP W L++ TAS+LGF LS+V GLG++GIVS+ GS IESSLFFAYIVRCIY
Sbjct: 201 LYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKGSVIESSLFFAYIVRCIY 260

Query: 351 EMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIM-DAFSSFSSIEHHLFP 409
           E+SP+LA +ATDE L+ F +VWQ +Q  +  ADN+L Y    I+ +A   + S       
Sbjct: 261 EISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVILKNAEMLWGSFIPRGRK 320

Query: 410 KTIE--------LGISK-NLIVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAII 460
           KT +        L   K +LI K FW F KNFT +VP SIN+  Q+T +MA +S+SPAI+
Sbjct: 321 KTGDFHDKLISVLSFEKVSLISKPFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIV 380

Query: 461 INLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGE 520
           +NL FR+++FYSATRIIPA+QR+           M  +YW+SPC+LIAMYTHLILQ+SGE
Sbjct: 381 VNLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGE 440

Query: 521 LKKNICLWNC-ENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGRS 579
           LKK++C+W C E W  S             IIVDSW FWNWCNIF TI++YA+ELIG  S
Sbjct: 441 LKKDLCIWGCSEKWFGSDQP---------EIIVDSWGFWNWCNIFCTILVYATELIGSGS 491

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  456 bits (1172), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 258/541 (47%), Positives = 336/541 (62%), Gaps = 65/541 (12%)

Query: 51  IPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKR 110
           + +  + SG      FYLL  +++IPISFK+GG+ CGLSFT TLF LYFI+T++ ++ +R
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 111 LTHNTTLRLL-ASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTK 169
             H   L +   + L+Y Q+FII+SLL ++L GF+N +L   L          KN  N  
Sbjct: 64  --HGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVL----------KNKYNES 111

Query: 170 YQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXX 229
              L  +K    N +N       N +N +L                              
Sbjct: 112 ESFLEALK----NSLN------SNQINYVLYYYYYR----------------------FV 139

Query: 230 XKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITA 289
            +PW+F+L  STPFFTL EGFFTIL IQ +GETN WL    +S+ W+I SLL+SGGVITA
Sbjct: 140 VQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTWIISSLLTSGGVITA 199

Query: 290 TLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCI 349
           +LYYL RIYVTP W L++ TAS+LG  LS+V GLG++GIVS+ GS IESSLFFAYIVRCI
Sbjct: 200 SLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVSQKGSVIESSLFFAYIVRCI 259

Query: 350 YEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIM-DAFSSFSSIEHHLF 408
           YE+SP+LA +ATDE L  F +VWQ +Q  +  ADN+L Y    I+ +A   + S      
Sbjct: 260 YEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFHNVILKNAEVLWGSFIPRGR 319

Query: 409 PKTIE--------LGISK-NLIVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAI 459
            KT +        L   K +LI K FW F KNFT +VP SIN+  Q+T +MA +S+SPAI
Sbjct: 320 KKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAI 379

Query: 460 IINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSG 519
           +INL FR+++FYSATRIIPA+QR+           M  +YW+SPC+LIAMYTHLILQ+SG
Sbjct: 380 VINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSG 439

Query: 520 ELKKNICLWNC-ENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGR 578
           ELKK++C+W C E W           +    IIVDSW FWNWCNIF TI++YA+ELIG  
Sbjct: 440 ELKKDLCIWGCSEKWF---------GVDQPEIIVDSWGFWNWCNIFCTILVYATELIGSG 490

Query: 579 S 579
           S
Sbjct: 491 S 491

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  452 bits (1163), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 247/539 (45%), Positives = 341/539 (63%), Gaps = 72/539 (13%)

Query: 55  VINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLTHN 114
           V+ S   +L  FYLL+I++TIPISFK+GG+YCGLSFT TLF LYF+ST++++  +     
Sbjct: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63

Query: 115 TTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQILF 174
             +    ++++Y Q+ II+SLL ++L GF+N++L   L          ++G+  +  +L 
Sbjct: 64  FYV-FSTATIYYSQHCIIASLLYLFLSGFSNEELTKIL----------ESGSQPEQSLLE 112

Query: 175 IIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNS-WXXXXXXXXXXXKPW 233
           ++K                                  +P   +S W           +PW
Sbjct: 113 VLKS---------------------------------NPFSAHSNWILYYYYYCYIVQPW 139

Query: 234 KFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLYY 293
           +++L +ST FF+L EGFFTIL IQ +GE++ WL  + +S+ W I SLL SGGVITA LYY
Sbjct: 140 QWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNITSLLISGGVITAALYY 199

Query: 294 LNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEMS 353
           L RIYVTP W+L++ TAS+LGFTLS+V GLG++GIVSKNGS IESSLFFAYIVRCIYE+S
Sbjct: 200 LYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIESSLFFAYIVRCIYEIS 259

Query: 354 PELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFS-----------SFSS 402
           P+LA +ATDE LE F E WQ +Q   +  +N+L+Y    ++D+             + S 
Sbjct: 260 PKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAEMMWESIVSKTVTTSD 319

Query: 403 IEHH--LFPKTIELGISKNLIVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAII 460
             +H  +FP   +       I K   +F KNFTI+VPSSI  L Q+T +MA DS+SPAI+
Sbjct: 320 PFYHTSMFPPLRKF----TDIFKPVGIFFKNFTISVPSSIEGLFQVTLKMASDSVSPAIV 375

Query: 461 INLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGE 520
           +NL FR++IFYSAT+IIPA+Q +     +     M+ +YW+SPC+LIAMYTHLILQ+SGE
Sbjct: 376 VNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILIAMYTHLILQYSGE 435

Query: 521 LKKNICLWNCEN-WLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGR 578
           L +++CLW C + W S         L    I+VDSW FWNWCNIFWTI++Y SELIGG+
Sbjct: 436 LNRDLCLWGCNSMWFS---------LNQTKIVVDSWGFWNWCNIFWTILVYGSELIGGK 485

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  452 bits (1163), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 245/536 (45%), Positives = 339/536 (63%), Gaps = 48/536 (8%)

Query: 49  NLIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIIT 108
            LI  GV  S      A YL+  +V+IPISFKIGG+ CGLSFT TLF LY IST+++++ 
Sbjct: 2   GLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLA 61

Query: 109 KRLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNT 168
           +R + N       S L+Y Q+ +I+ LL ++L GF+N++    L+ +  Y   + +G+  
Sbjct: 62  RR-SCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGS-- 118

Query: 169 KYQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXX 228
                      F+++           L   + +A  +E +         +W         
Sbjct: 119 -----------FLDL-----------LKHRILMATTAENS--------KNWTLYYYYFKF 148

Query: 229 XXKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVIT 288
             +PW++LL  STPFFTLLEGFFTIL IQ IGETN WL  + +S+ W+I SLL SGGVIT
Sbjct: 149 IVQPWQWLLSYSTPFFTLLEGFFTILAIQAIGETNKWLSYEMNSNTWIITSLLVSGGVIT 208

Query: 289 ATLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRC 348
            +LYYL RIYVTP W LT+ +AS+LGF LSIV  LG++GI+S+ GS IESSLFFAYIVRC
Sbjct: 209 GSLYYLYRIYVTPIWKLTIQSASLLGFVLSIVFCLGLYGIISRKGSVIESSLFFAYIVRC 268

Query: 349 IYEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLF 408
           IYE+SP+LA  AT+E L+   +VWQ +Q  +   DN+L Y    ++   ++    E  + 
Sbjct: 269 IYEISPKLATRATEEILDLVKDVWQTHQRNLLNRDNLLAYYHNVVLK--NAEMVWESFIL 326

Query: 409 PKTIELGISKN----LIVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIINLS 464
           P++  L   +     L V   W F KNFT++VPSSI +L+ +T +MA +S+SPA+I+NL 
Sbjct: 327 PRSRSLNAMEKIRFWLDVTPVWKFFKNFTVSVPSSIVELVSVTYKMASESLSPAVIVNLC 386

Query: 465 FRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELKKN 524
           FR++IFYSATRIIPA+QR +  +       +  +YW+SPC+LIAMYTHLILQ+SGELK+ 
Sbjct: 387 FRILIFYSATRIIPALQRSSYKEQRQSRRILKLLYWYSPCVLIAMYTHLILQYSGELKRE 446

Query: 525 ICLWNC-ENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGRS 579
           +CLW C  NW  S    +        I+ DSWSFWNWCNIFWT+++YA+ELIG ++
Sbjct: 447 LCLWGCTSNWFGSKDQPR--------IVTDSWSFWNWCNIFWTVLVYANELIGTQA 494

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  450 bits (1158), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 254/528 (48%), Positives = 330/528 (62%), Gaps = 82/528 (15%)

Query: 66  FYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLTHNTTLRLLASSLF 125
           FYLL  +++IPISFKIGG++CGL+FT +LF LYF+ST+++I  ++      + LL + L+
Sbjct: 17  FYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARKYGSRIHI-LLTNILY 75

Query: 126 YIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQILFIIKDYFVNIMN 185
           Y Q+FII+SLL ++L GF+N+ L + L          ++G      I  I K        
Sbjct: 76  YFQHFIIASLLYLFLSGFSNEQLSSML----------RDGNKPIDSIADIFKK------- 118

Query: 186 LILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXXXKPWKFLLINSTPFFT 245
                          +A  ++ N          W           +PW+F+L  STPFFT
Sbjct: 119 --------------NVASSTQAN----------WVLYYYYYRFFVQPWQFILSYSTPFFT 154

Query: 246 LLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLYYLNRIYVTPFWDL 305
           L EGFFTIL IQ IGETN WL  + +S+ WVI SLL+SGGVITA+LYYL RIYVTP W L
Sbjct: 155 LSEGFFTILAIQAIGETNKWLVYEINSNTWVISSLLASGGVITASLYYLYRIYVTPIWQL 214

Query: 306 TVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEMSPELAISATDEFL 365
           +V TAS+LGFTLS+VGGLG++GIV+  GS IESS+FFAYIVRCIYE+SP+LA +AT+E L
Sbjct: 215 SVQTASLLGFTLSLVGGLGIYGIVTDKGSVIESSVFFAYIVRCIYEISPKLATTATEEIL 274

Query: 366 EGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLFPKTIE-----LGISKNL 420
           E F EVWQ +Q  +T  +N+L+Y                H++  K IE       I+ N 
Sbjct: 275 EVFKEVWQRHQANLTSPNNLLSY---------------YHNVVLKNIETIWESFKINDNS 319

Query: 421 IVKQF------------WVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIINLSFRLM 468
            +  F            W  LK FTI VPSSIN+L  +T +MA +SISPA+I+NL FR++
Sbjct: 320 FITSFSTERVITIFMPIWKLLKTFTITVPSSINELCFVTYKMACESISPAVIVNLCFRVL 379

Query: 469 IFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELKKNICLW 528
           IFYSATRIIPA+QRR   +       M  +YW+SPC+LIAMY HLILQ+SGELK  +CLW
Sbjct: 380 IFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCILIAMYAHLILQYSGELKDELCLW 439

Query: 529 NCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIG 576
            C + +  S   K        IIVDSW FWNWCNIF+TI++YASELIG
Sbjct: 440 GCNSKIFPSDQPK--------IIVDSWGFWNWCNIFFTILVYASELIG 479

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  447 bits (1151), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 242/552 (43%), Positives = 339/552 (61%), Gaps = 92/552 (16%)

Query: 51  IPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKR 110
           I +  +      L  FYLL+ +VTIPISFK+GG+YCGLSFT TLF LY I+T+++++ + 
Sbjct: 4   ISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQS 63

Query: 111 LTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKY 170
              N    +  + ++Y+Q+F+I+SLL ++L GF+N++L   L          ++G+  + 
Sbjct: 64  Y-GNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVL----------EDGSQPEQ 112

Query: 171 QILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXXX 230
            +        VN++   +F   +                        SW           
Sbjct: 113 SL--------VNVLRNNVFSNHS------------------------SWMLYYYYYRYVV 140

Query: 231 KPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITAT 290
           +PW+ +L +ST FF L EGFFT+LGIQ IGETN WL  + +S+ W+I SLL+SGGVITA+
Sbjct: 141 QPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNSNTWIIASLLTSGGVITAS 200

Query: 291 LYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIY 350
           LYYL RIYVTP W+L+V TAS+LGFTLSIV G+G+FGIVSKNGS IESSLFFAYIVRCIY
Sbjct: 201 LYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKNGSVIESSLFFAYIVRCIY 260

Query: 351 EMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIM---------------- 394
           E+SP+LA +ATDE LE     WQ +Q  ++  +N+L+Y +  ++                
Sbjct: 261 EISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDVVLKNAEMVWESIVLRTKN 320

Query: 395 -DAFSSFSSIE------HHLFPKTIELGISKNLIVKQFWVFLKNFTINVPSSINDLIQIT 447
            DA ++F++I+      H   P                W F K F ++VPSSI  + Q+T
Sbjct: 321 SDA-TTFTAIQPLNKLWHAFTP---------------IWKFFKGFVLSVPSSIGGVFQVT 364

Query: 448 AQMAVDSISPAIIINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLI 507
            ++A +S+SPAI++NL FR+++FYSATRIIPA+QR+   +       M+ +YW+SPC+LI
Sbjct: 365 LKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCILI 424

Query: 508 AMYTHLILQFSGELKKNICLWNC-ENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWT 566
           AMYTHLILQ+SGEL  ++CLW C E W  S         G   I +++W FWNWCNIFWT
Sbjct: 425 AMYTHLILQYSGELNSDLCLWGCSEKWFGS---------GQPKIEINTWVFWNWCNIFWT 475

Query: 567 IIIYASELIGGR 578
           ++IY SELIGG+
Sbjct: 476 VLIYGSELIGGK 487

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  447 bits (1149), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 248/537 (46%), Positives = 337/537 (62%), Gaps = 61/537 (11%)

Query: 49  NLIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIIT 108
            L+ + +I         FYLL  +++IP+SFKIGG++CGLSFT TLF  YF+ST+++I+ 
Sbjct: 2   TLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILA 61

Query: 109 KRLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNT 168
           ++ + +    +L S ++Y Q+ II+SLL  +L GF+N +L   L          K+GT  
Sbjct: 62  RQ-SGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVL----------KDGTE- 109

Query: 169 KYQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXX 228
           K ++L   +D  V                       SE N          W         
Sbjct: 110 KIEVLVANQDLMV-----------------------SESN----------WLLYCYYYSY 136

Query: 229 XXKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVIT 288
             KPWKF+L  STPFF L EGFFTIL IQ IGETN WL  +K+S+ W+I SLL+S GV+T
Sbjct: 137 VVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNSNSWIISSLLASSGVVT 196

Query: 289 ATLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRC 348
           A+LYYL RIYVTP W+L+  TA++LG  LS+  GLG+ GI+S+ GS +ESSLFFAYIVRC
Sbjct: 197 ASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISERGSVVESSLFFAYIVRC 256

Query: 349 IYEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIM-------DAFSSFS 401
           IYE+SP+LA +ATDE LE F EVWQ +Q ++ + DN+L Y +  I+       +AF   S
Sbjct: 257 IYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSVILKNTEMIWEAF--LS 314

Query: 402 SIEHHLFPKTIELGISKNLIVK--QFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAI 459
             + H          ++N  +     W F KNFTI+VP SI++L  +  QMA +SISPA+
Sbjct: 315 KTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSGMMLQMASESISPAV 374

Query: 460 IINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSG 519
           ++NL FR++IFYSATRIIP++QR+   D+      M  +YW+SPC+LIAMYTHLILQ+SG
Sbjct: 375 VVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCILIAMYTHLILQYSG 434

Query: 520 ELKKNICLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIG 576
           ELK+ + LW  ++ LS   D +     +N+I+VDSWSFWNWCNIFWTI+IY  EL G
Sbjct: 435 ELKRELYLWGPDSKLSFLVDKE-----ENNIVVDSWSFWNWCNIFWTILIYGGELFG 486

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  442 bits (1136), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 246/534 (46%), Positives = 336/534 (62%), Gaps = 63/534 (11%)

Query: 54  GVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLTH 113
           G I        A YLL  +++IPISFK+GG+YCGL+FT TLF LYF+ST+++II ++   
Sbjct: 8   GFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARK-NG 66

Query: 114 NTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQIL 173
           N    +L+S L+Y Q+FII+SLL ++L GF+N +L                         
Sbjct: 67  NRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHK----------------------- 103

Query: 174 FIIKDYFVNIMNLILFREDNGLNKMLQLALKS-EGNSVPDPQKLNSWXXXXXXXXXXXKP 232
            II++  + I           L  +L +++ S E N          W            P
Sbjct: 104 -IIENDAIPI---------ESLTSILNVSMSSSEAN----------WIFYYYYYKYVVTP 143

Query: 233 WKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLY 292
           WKF+L +STPFFTL EGFFTIL IQ IGETN WL  +K+S+ W+I SLL+S  VI+A LY
Sbjct: 144 WKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNAWIISSLLTSSAVISAALY 203

Query: 293 YLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEM 352
           YL RIYVTP W+LTV TAS+LGF LS+V GLG++GIVS +GS IESSLFFAYIVRCIYE+
Sbjct: 204 YLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIVSDSGSVIESSLFFAYIVRCIYEI 263

Query: 353 SPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMD----AFSSF-----SSI 403
           SP+LA +ATDE LE F +VWQ  Q  + + +N++ Y    I+     A+ +F     +S 
Sbjct: 264 SPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYYNNVILKNIEMAWDNFILRTGTSG 323

Query: 404 EHHLFPKTIELGISKNLIVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIINL 463
             +  P  +     K    K  W F KNFT++VP SI +++ +T +M+++S+SPA++INL
Sbjct: 324 TFNYNPSLLLNNTWK--FCKPIWKFFKNFTLSVPFSIREILLMTWKMSLESVSPAVVINL 381

Query: 464 SFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELKK 523
            FR++IFYSATRI+P++QR+   +       M  VYW+SPC+LIAMY HLILQ+S ELK 
Sbjct: 382 CFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCILIAMYAHLILQYSSELKN 441

Query: 524 NICLWNCEN-WLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIG 576
            +CLW C N  L  ++D   T      ++VD+W FWNWCN+F TI++YA+ELIG
Sbjct: 442 ELCLWGCNNILLGYNTDQNET------VVVDAWRFWNWCNVFCTILVYANELIG 489

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  436 bits (1122), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 244/537 (45%), Positives = 332/537 (61%), Gaps = 70/537 (13%)

Query: 50  LIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITK 109
           + PR VI S    L +FYLL I++TIPISF++GG+YCGLSFT TLF LY I+T++ I  +
Sbjct: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 110 RLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTK 169
                  L  LAS+ +Y Q+F I SLL ++L GF+N +L              +  TNT 
Sbjct: 61  ----ARGLAKLASAAYYAQHFFIPSLLFLFLSGFSNDEL------------KRQIDTNT- 103

Query: 170 YQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXX 229
                               R D  L  +L+   +S+           +W          
Sbjct: 104 --------------------RPDESLIDLLRSTTQSQ-----------TWVFYYYYYQYV 132

Query: 230 XKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITA 289
            +PW+F+L+ STP+FTLLEGFFT+LGIQ +GETN WL +   S+ WVI  L++SGGVITA
Sbjct: 133 VRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMWVISGLMASGGVITA 192

Query: 290 TLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCI 349
            LYYL RIYVTP W+L+V TAS+LGFT SIV GLG++GIVS  GS IESSLFFAYIVRC+
Sbjct: 193 ALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGSTIESSLFFAYIVRCL 252

Query: 350 YEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLFP 409
           YE+SP+LA SA DE      E W      +  +D +LTY +  I+    +   +   +  
Sbjct: 253 YEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILK---NGEMVWDAILA 309

Query: 410 KT-IELGISKNLI------VKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIIN 462
           +T + +G S   +      V+  W F+K+FT +VPSSI ++  +T +MA ++I+PA++IN
Sbjct: 310 RTNVNVGASGTPVWASWNRVQPLWKFVKHFTSSVPSSIQEIFYLTLEMAREAIAPAVVIN 369

Query: 463 LSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELK 522
           L FR++IFYSATRIIPA+Q++ K  +     FM  +YW+SPC++IAMYTHLILQ+SG++ 
Sbjct: 370 LCFRILIFYSATRIIPALQKKHKRRSRR---FMRMLYWYSPCIVIAMYTHLILQYSGQIS 426

Query: 523 KNICLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGRS 579
            ++CLW C  W  S  D          ++VDSW FWNWCNIF T+ IYASEL+G +S
Sbjct: 427 NDLCLWGCFPW--SVPDTP-------KVVVDSWGFWNWCNIFCTMAIYASELLGSKS 474

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  423 bits (1088), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 240/537 (44%), Positives = 325/537 (60%), Gaps = 70/537 (13%)

Query: 50  LIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITK 109
           +IPR ++ S    L +FYLL I++TIPI+F++GG+YCGLSFT TLF LY I+T++ I  +
Sbjct: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 110 RLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTK 169
                     LAS+ +Y Q+F I SLL ++L GF+N +L              +  TNT 
Sbjct: 61  ----ARGFAKLASAAYYAQHFFIPSLLFLFLSGFSNDEL------------KHQIDTNT- 103

Query: 170 YQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXX 229
                               R D  L  +L    +S  +S P       W          
Sbjct: 104 --------------------RPDESLIDLL----RSSTHSQP-------WIFYYYYYHYV 132

Query: 230 XKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITA 289
            +PW+FLL+ STP+FTLLEGFFT+LGIQ +GETN WL +   S+ WVI  L++SGGVITA
Sbjct: 133 VRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVWVISGLMTSGGVITA 192

Query: 290 TLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCI 349
            LYYL RIYVTP W+L+V TAS+LGFT SIV GLG+FGIVS  GS IESSLFFAYIVRC+
Sbjct: 193 ALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGSTIESSLFFAYIVRCL 252

Query: 350 YEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIM-------DAFSSFSS 402
           YE+SP+LA SA DE      + W      +  +D  L Y +  I+       DA  + ++
Sbjct: 253 YEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILKNGEMIWDAVLARTN 312

Query: 403 IEHHLFPKTIELGISKNLIVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIIN 462
           +          +   +   V+  W F+K+FT +VPSSI ++  +T  MA ++I+PA++IN
Sbjct: 313 VNVSGAGPVAWISWHR---VQPLWKFVKHFTSSVPSSIQEIFLLTLSMAREAIAPAVVIN 369

Query: 463 LSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELK 522
           L FR++IFYSATRIIPA+QR+ K  +     FM  +YW+SPC++IAMYTHLI+Q+SG++ 
Sbjct: 370 LCFRILIFYSATRIIPALQRKHKRRSRR---FMRMLYWYSPCIVIAMYTHLIMQYSGQIS 426

Query: 523 KNICLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGRS 579
            ++CLW C  W              + ++VDSW FWNWCNIF T+ IYASEL G +S
Sbjct: 427 NDLCLWGCFPWSPPE---------GSKVVVDSWGFWNWCNIFCTMAIYASELFGSKS 474

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  419 bits (1077), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 226/546 (41%), Positives = 337/546 (61%), Gaps = 61/546 (11%)

Query: 50  LIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITK 109
           ++P+G++ S    L +FYL  +++T+PISF+IGG+YCGLSFT TLF LYF++T++ I   
Sbjct: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60

Query: 110 RLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTK 169
             T     + +AS+L+Y+Q+F++ S+L ++L GFNN  L   L   D      + G    
Sbjct: 61  --TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPK--GARGG---- 112

Query: 170 YQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXX 229
                              F  D  +N+ L   L+  G S  D   +             
Sbjct: 113 -------------------FIFDGNMNESL---LQLLGRSRDDRATM----AYLHYYRYV 146

Query: 230 XKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITA 289
            +PW+++L+++TP FTL EGFFT+L IQ IGET  WL+ +++S+ WVI SL+ SG VIT 
Sbjct: 147 VRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETGRWLRYKRNSTAWVISSLMVSGVVITT 206

Query: 290 TLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCI 349
           ++YYL RIYVTP W L+V TA++LGFTLS+V GLG++GI+S  GSAIESSLFFAY+V CI
Sbjct: 207 SMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGLGLYGIISGKGSAIESSLFFAYMVHCI 266

Query: 350 YEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLF- 408
           YE+SP+LA++A  E  +  +  WQM Q  +   +++L Y K +I++A + +  +    F 
Sbjct: 267 YEISPQLALTAMSEIFQVVHNTWQMQQGTLP-KNSLLAYYKNFILNAENLWDVLLKKAFL 325

Query: 409 PKTIELGISKNLIV----------------KQFWVFLKNFTINVPSSINDLIQITAQMAV 452
             ++EL  + + +V                +Q W F KNF+  +P SI+++  +T  +A 
Sbjct: 326 LHSVELDQAPSSVVVKDALVLVQQQWWNKSQQLWSFTKNFSAGIPRSIHEIFIVTLGLAR 385

Query: 453 DSISPAIIINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTH 512
           +SI+ A++ NL FR+++FYSATRIIPA+QR T          M  +YW+SPC++IAMYTH
Sbjct: 386 ESINAAVVSNLVFRVIVFYSATRIIPALQRAT--GGTQSRKLMRIIYWYSPCIVIAMYTH 443

Query: 513 LILQFSGELKKNICLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYAS 572
           +IL++SGEL   +C+W C  WL S ++        +  +VD+W FWNWCN+F+T++IYA 
Sbjct: 444 MILRYSGELNNELCIWGCFPWLQSEAN-------RDRWVVDAWGFWNWCNLFFTLLIYAV 496

Query: 573 ELIGGR 578
           ELIG R
Sbjct: 497 ELIGSR 502

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  414 bits (1064), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 237/555 (42%), Positives = 350/555 (63%), Gaps = 68/555 (12%)

Query: 50  LIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITK 109
           ++ RG++ S    L  FYL  +++TIPISF++GG+YCGLSFT TLF LYF +T++ I T 
Sbjct: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTT 60

Query: 110 RLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTK 169
               +   +LLAS ++Y+Q+F+I S+L ++L  FN+  L      L D   ++  G ++K
Sbjct: 61  N--GSGKFKLLASLIYYLQHFLIPSILFLFLSAFNSDQL----QRLVD---SDAVGASSK 111

Query: 170 YQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXX 229
             I                  E N    +LQL     GN         S           
Sbjct: 112 GFIF-----------------EGNVNESLLQLLSLPPGNE-------GSVASYYYYYKYI 147

Query: 230 XKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITA 289
            KPW+++L+++TP+FTL EGFFT+L IQ IGET  WL+ +K+S+ WVILSLL SG VIT 
Sbjct: 148 VKPWQYMLLHATPYFTLTEGFFTVLAIQAIGETGRWLRYKKNSNTWVILSLLVSGVVITT 207

Query: 290 TLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCI 349
           +++YL RIYVTP W L+V TA++LGFTLS+V GLG++GI+S  GS IESSLFFAY+VRCI
Sbjct: 208 SMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFGLGLYGIISGKGSTIESSLFFAYMVRCI 267

Query: 350 YEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSI------ 403
           YE+SP+LA++A  E  +  ++ WQ+ Q  ++  +N+LTY   ++ +A S + S+      
Sbjct: 268 YEISPQLALTAMTEIFQVVHDTWQLQQGTLS-KNNLLTYYNTFVSNAESFWDSLLKKTAI 326

Query: 404 --------EHHLFPKTIEL--GISKNLIV----------KQFWVFLKNFTINVPSSINDL 443
                    + +F  ++     I+K+ ++          +Q W F KNF++ +P SI+++
Sbjct: 327 GTAAAAEETYTIFGYSMPFTSTIAKDTLIILQTQWWLKCQQIWSFTKNFSVGIPRSIHEI 386

Query: 444 IQITAQMAVDSISPAIIINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSP 503
           + +T +MA +SI+PA+I NL FR+++FYSATRIIPA+Q+ T   A      M  +YW+SP
Sbjct: 387 LMVTLKMAKESINPAVITNLVFRVLVFYSATRIIPALQKAT--GATQSRKLMRIIYWYSP 444

Query: 504 CMLIAMYTHLILQFSGELKKNICLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNI 563
           C++IAMYTHLIL++SGEL  ++C+W C  WL+ S+  +S        +VD+WSFWNWCN+
Sbjct: 445 CIVIAMYTHLILRYSGELNNDLCIWGCFPWLNFSAKTRS------KWVVDAWSFWNWCNL 498

Query: 564 FWTIIIYASELIGGR 578
           F+T++IYA ELIG R
Sbjct: 499 FFTLLIYAVELIGSR 513

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  374 bits (960), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 228/558 (40%), Positives = 325/558 (58%), Gaps = 86/558 (15%)

Query: 65  AFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLTHNTTLRLLASSL 124
            FYL+++++TIP +FKIGG+YCGLSFT TLF LYF+ST++ +I KR T N    LL++ +
Sbjct: 18  CFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKR-TLNNFYILLSTLV 76

Query: 125 FYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQILFIIKDYFVNIM 184
           +Y+Q+ +I+SLL I++  F++ +L   L+          N T+    +L+ IK+      
Sbjct: 77  YYLQHIVIASLLYIFITIFSDGNLNEILS---------NNKTDQLPSLLYYIKN------ 121

Query: 185 NLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXXXKPWKFLLINSTPFF 244
                                   S    Q  +             +PW +LL +STPFF
Sbjct: 122 ----------------------DTSKSVSQNFHY-LLFYYYYYYAVQPWNYLLSHSTPFF 158

Query: 245 TLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLYYLNRIYVTPFWD 304
           TLLEGFFTILGIQ IGET  WL  +K    + +L+ L S GVI   +++L +IY    W+
Sbjct: 159 TLLEGFFTILGIQAIGETYCWLLLKKQKKIFKLLTWLISVGVIFTAIHFLYKIYEFQVWE 218

Query: 305 LTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEMSPELAISATDEF 364
           L++ TAS+LG T+S+V  +G+FGI S NGS IESSLF  YI+RC YE+SPEL+ SAT E 
Sbjct: 219 LSIQTASLLGVTMSLVLTVGIFGIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEI 278

Query: 365 LEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLFPKT----------IEL 414
           L+   E WQ +Q  ITV +++L Y    ++   +S S + +  F K+           E+
Sbjct: 279 LDNIKEAWQNHQGSITVTEHILFYYNNVLLKNINS-SYLFNSNFSKSNDTSAKNRTLAEI 337

Query: 415 GISKN------------LI-------VKQFWV--------FLKNFTINVPSSINDLIQIT 447
             S N            LI       + Q W+         LK+F +N+P+S+ +L Q+T
Sbjct: 338 QRSTNNYTLTDITKPSDLIHLIGFKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVT 397

Query: 448 AQMAVDSISPAIIINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLI 507
            ++A DS+SP+I+INL FR++IFYSATRIIPA+QR+   +      F+ A Y FSPC++I
Sbjct: 398 YKLAYDSVSPSIVINLCFRVLIFYSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVI 457

Query: 508 AMYTHLILQFSGELKKNICLWNCENWLSSSSDVKST---NLGDN------SIIVDSWSFW 558
           AMYT+LILQ+SGELK ++C+W C+    S S   ST   ++G +        IV+SW FW
Sbjct: 458 AMYTNLILQYSGELKNDLCIWGCDIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFW 517

Query: 559 NWCNIFWTIIIYASELIG 576
           NWCNIF TI IY  EL+G
Sbjct: 518 NWCNIFCTIFIYGCELMG 535

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  363 bits (933), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 219/537 (40%), Positives = 310/537 (57%), Gaps = 89/537 (16%)

Query: 67  YLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLTHNTTLRLLASS--L 124
           YLL++++T+PI+F++GG+ CGL+FT TLF  YFI+T++  I ++L      R +A +  L
Sbjct: 20  YLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAIARKLRWQ---RFIAWTNFL 76

Query: 125 FYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQILFIIKDYFVNIM 184
           +Y QNF I  +L I+L  F++ +L  +++       +E     T   IL           
Sbjct: 77  YYFQNFNIIGILHIFLSLFSHTELSISMS-------DENPSMETITSIL----------- 118

Query: 185 NLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWXXXXXXXXXXXKPWKFLLINSTPFF 244
                                  N+   P K  S+           + WKF L  STP F
Sbjct: 119 ----------------------KNNDTYPSKTISFIYKYFFYYAMPR-WKFCLSYSTPLF 155

Query: 245 TLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLYYLNRIYVTPFWD 304
            L+EGFFTIL IQ IGETNIWL   K+SS W+ILSL+ S  ++T ++YY+ +IYVTP W 
Sbjct: 156 ALVEGFFTILAIQVIGETNIWLTTVKNSSIWIILSLIMSSSMVTTSIYYIYKIYVTPLWH 215

Query: 305 LTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEMSPELAISATDEF 364
           L+   AS+L FT S+VGG+ ++GIVS  GS +ESSLFFAYIV CIYE+SP +A +A D+ 
Sbjct: 216 LSNQVASLLSFTFSLVGGVAIYGIVSHRGSVVESSLFFAYIVCCIYEISPIMATTAMDDI 275

Query: 365 LEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLFPKTIELGISKNL---- 420
            +   E WQ++Q    ++DN+L Y    ++     F  +      K I+L    N     
Sbjct: 276 FDTLKESWQIHQRNFFISDNLLIYYYNSLIKNVDEFIKL------KIIKLTTKDNFSNKF 329

Query: 421 ---------IVKQFWVFL----KNFTINVPSSINDLIQITAQMAVDSISPAIIINLSFRL 467
                    I K+ + F+    K FT+ +PSSI +L  IT +MA +SISP I++NL +R+
Sbjct: 330 NSLLFQCVKISKKSFKFILKLSKRFTLGIPSSIYELYSITLKMASESISPVILVNLCYRV 389

Query: 468 MIFYSATRIIPAIQRRTKPDAHD------LTGFMSAVYWFSPCMLIAMYTHLILQFSGEL 521
           +IFY+ATRIIPA++ R+   +++       + FM  +YW+SPC+LIAMYT+LILQ+SGEL
Sbjct: 390 LIFYAATRIIPALESRSNGFSNNNIKTKSNSKFMKVLYWYSPCILIAMYTNLILQYSGEL 449

Query: 522 KKNICLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGR 578
           K    LW               N  +N ++VDSW FWNWCNIFWTI +Y SELIGGR
Sbjct: 450 KSEFKLW--------------NNSNNNEVVVDSWRFWNWCNIFWTITLYGSELIGGR 492

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  338 bits (867), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 175/351 (49%), Positives = 241/351 (68%), Gaps = 22/351 (6%)

Query: 231 KPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITAT 290
           KPW+  LI+STP FTLLEG FTIL IQ IGET  WLK  + S+ WVILSLL SGG+IT +
Sbjct: 152 KPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRSNQWVILSLLISGGIITLS 211

Query: 291 LYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIY 350
           L+Y  RIYVTP W+L+  +AS+LGFT SIV G+G++GI + +GS +ESSLFFAY+VR +Y
Sbjct: 212 LFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGSGSVMESSLFFAYMVRNVY 270

Query: 351 EMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEH----H 406
           E+SP++A++A DE  +   E W+++Q  +   DN+L    K     +S    +EH    H
Sbjct: 271 EISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLLELMTKNYRAIWSQI--VEHTPRNH 328

Query: 407 LFPKTIELGISKNLIVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIINLSFR 466
              K I++      I+   W  +KNFT +VP SI ++  +T +MA +S+ PA++INL FR
Sbjct: 329 ---KYIKMMDQCKWILNPLWNSVKNFTKSVPISIQEIFVVTFKMAKESLIPAVVINLVFR 385

Query: 467 LMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELKKNIC 526
           L+IFYSATRIIP +QR TK +       M+ VYW+SPC++IAMYTHLIL++SG+LK ++C
Sbjct: 386 LLIFYSATRIIPTLQRNTK-ERRSFRRIMNFVYWYSPCIIIAMYTHLILRYSGQLKNDLC 444

Query: 527 LWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGG 577
           +W C  + +           +  I+VDSWSFWNWCNI+ T++IYA EL+G 
Sbjct: 445 IWGCFPYET-----------EPKIVVDSWSFWNWCNIYSTMLIYALELMGS 484

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 69/117 (58%), Gaps = 5/117 (4%)

Query: 31  MQETVVVRQPSRRKYILQNLIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSF 90
           ++ + + R  ++       LI + V+ +    L   YL  +++TIPISF++GG+ CGLSF
Sbjct: 23  LEPSTIARHCAKFNVSKMPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSF 82

Query: 91  TGTLFGLYFISTSVTIITKRLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKD 147
           T TLF LYF+ST+  ++   L   + L  L   ++Y+Q+ +I S+L ++L  F N D
Sbjct: 83  TVTLFALYFVSTTFKLVL--LDRGSALSTL---IYYLQHLLIPSILFMFLSYFENID 134

>NCAS0B08360 Chr2 complement(1595487..1597001) [1515 bp, 504 aa]
           {ON} Anc_1.172 YKL175W
          Length = 504

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 67/155 (43%), Gaps = 27/155 (17%)

Query: 243 FFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVI---LSLLSSGGVITATLYYLNRIYV 299
           F++L+     ILG   +   ++  K ++HS+  ++   LSL S+G +IT +L+ +     
Sbjct: 12  FYSLISSLLCILGSLCVPLLSVLFKTKQHSNSKLVNYGLSL-SAGSMITTSLFKM----- 65

Query: 300 TPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEMSP-ELAI 358
            P  D         GF    +GG             I +SLF  Y+V      S    + 
Sbjct: 66  LPEMDNDNKYTVFFGF----LGG-------------ICTSLFLNYVVHAFASESLIHCSH 108

Query: 359 SATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYI 393
             TDE     +E+   +Q+  TV DN  TY  +Y+
Sbjct: 109 EHTDEIASSSDELDHNHQHTHTVIDNDATYNGQYV 143

>KLLA0A10395g Chr1 complement(908097..908981) [885 bp, 294 aa] {ON}
           similar to uniprot|P53750 Saccharomyces cerevisiae
           YNR064C
          Length = 294

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 293 YLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSL 340
           +L  I VT F        S +GF L++     + GIV++NG+A E +L
Sbjct: 90  FLKEINVTRFAIYVFDYGSPVGFRLALKDPSSITGIVTQNGNAYEEAL 137

>Smik_16.407 Chr16 complement(707447..709297) [1851 bp, 616 aa] {ON}
           YPR155C (REAL)
          Length = 616

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 12/85 (14%)

Query: 342 FAYIVRCIYEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFS 401
           F YI+   Y        S T++ ++G   V++  Q   TV+D+ L   K ++    +S S
Sbjct: 108 FEYIILLCY-------YSVTNDCVQGLPSVYEAEQYYKTVSDSTL---KSFLYCLQTSVS 157

Query: 402 SIEHHLFPKTIELGISKNLIVKQFW 426
           +I  HL  +TI+  I K  ++ Q W
Sbjct: 158 TI--HLLSQTIQKEIHKKKLLHQKW 180

>KAFR0B02540 Chr2 complement(505010..506629) [1620 bp, 539 aa] {ON}
           Anc_8.233 YER168C
          Length = 539

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 51/118 (43%), Gaps = 11/118 (9%)

Query: 96  GLYFISTSVTIITKRLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNK-DLITALTF 154
           GL F      I++K +      + + +  F  +NF+  S L  +LR FN   +++   + 
Sbjct: 383 GLKFSKNDAAIVSKCVDSIQNYQRMMNKFFLKENFLKRSELGTFLRDFNGTWEIMHFTSL 442

Query: 155 LDDYYYNEKNGTNT--------KYQIL--FIIKDYFVNIMNLILFREDNGLNKMLQLA 202
           +D+Y  +  N  N         KY++   +II    V+  NL    +   L K L++ 
Sbjct: 443 VDEYLKSTHNAENDQSAEFIFRKYELFYDYIIDQDLVDCHNLKPLLDGKKLLKSLEMK 500

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,154,460
Number of extensions: 2485036
Number of successful extensions: 8750
Number of sequences better than 10.0: 33
Number of HSP's gapped: 8907
Number of HSP's successfully gapped: 50
Length of query: 579
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 464
Effective length of database: 40,294,809
Effective search space: 18696791376
Effective search space used: 18696791376
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)