Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C034202.290ON26826813530.0
Kpol_1003.402.290ON2612668241e-111
SAKL0E07590g2.290ON2602407371e-97
TDEL0G022002.290ON2612497249e-96
Skud_9.802.290ON2642447204e-95
Suva_9.1062.290ON2642637101e-93
KLTH0G10450g2.290ON2612507092e-93
Smik_9.862.290ON2642607022e-92
NDAI0B035402.290ON2612597004e-92
YIL093C (RSM25)2.290ON2642446996e-92
ZYRO0A01958g2.290ON2632496971e-91
NCAS0B062402.290ON2602446971e-91
TBLA0B059602.290ON2662636945e-91
KAFR0J013502.290ON2642516841e-89
Kwal_27.115092.290ON2612386736e-88
KNAG0A054102.290ON2662436702e-87
Ecym_33292.290ON2582526613e-86
CAGL0D04158g2.290ON2722426554e-85
KLLA0E08273g2.290ON2612556529e-85
ADL211C2.290ON2251835108e-64
YML114C (TAF8)8.838ON510106730.92
KNAG0F010202.40ON30670721.0
KLTH0G12056gsingletonON606102693.0
TDEL0C031507.451ON24954657.0
KLLA0E11595g5.267ON184871667.0
SAKL0B05192g8.765ON131799659.3
Kpol_480.113.498ON46360659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C03420
         (268 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   525   0.0  
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   322   e-111
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   288   1e-97
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   283   9e-96
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   281   4e-95
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   278   1e-93
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   277   2e-93
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   275   2e-92
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   274   4e-92
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   273   6e-92
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   273   1e-91
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   273   1e-91
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   271   5e-91
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   268   1e-89
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   263   6e-88
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   262   2e-87
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   259   3e-86
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   256   4e-85
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   255   9e-85
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   201   8e-64
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...    33   0.92 
KNAG0F01020 Chr6 (184201..185121) [921 bp, 306 aa] {ON} Anc_2.40...    32   1.0  
KLTH0G12056g Chr7 complement(1012940..1014760) [1821 bp, 606 aa]...    31   3.0  
TDEL0C03150 Chr3 complement(562981..563730) [750 bp, 249 aa] {ON...    30   7.0  
KLLA0E11595g Chr5 complement(1018972..1024518) [5547 bp, 1848 aa...    30   7.0  
SAKL0B05192g Chr2 (447273..451226) [3954 bp, 1317 aa] {ON} simil...    30   9.3  
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...    30   9.9  

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/268 (95%), Positives = 256/268 (95%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
           RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180
           PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV
Sbjct: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180

Query: 181 RMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS 240
           RMQS            MFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS
Sbjct: 181 RMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS 240

Query: 241 ETWAQEKEEDVNYPDGEQITEEATGITL 268
           ETWAQEKEEDVNYPDGEQITEEATGITL
Sbjct: 241 ETWAQEKEEDVNYPDGEQITEEATGITL 268

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  322 bits (824), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 158/266 (59%), Positives = 198/266 (74%), Gaps = 12/266 (4%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MKIQ+NAVNVLERTS+YLR+GLLTKQPAWYNVVA +PP KKFER PK TNPSN++   +L
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
             +D    +  NG  +FK+RY   D+ ++SK +Y  +KL+YIEDQLRE+FY QHPWELSR
Sbjct: 61  HSLDSS--AGNNG--MFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSR 116

Query: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKK----LIMIFQKHTIKARYE 176
           PKI++ENNGDE YDWSH+QQ+GK LDGE+VVQR +YLMK K    L++ +      ARYE
Sbjct: 117 PKILIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYD----MARYE 172

Query: 177 FYRVRMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKR 236
           FYR+RMQ             MFGSVFGPS IE+G+ +EQKVID WKRKAI +TE+M A+R
Sbjct: 173 FYRLRMQQHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARR 232

Query: 237 TNPSETWAQEKEEDVNYPDGEQITEE 262
            NPSE+WA ++++     D E+  EE
Sbjct: 233 INPSESWATDEKDPKKNDDIEEDVEE 258

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  288 bits (737), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 139/240 (57%), Positives = 177/240 (73%), Gaps = 3/240 (1%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MK+Q NAVN+LERTS+YLR+GLLTK PAWYNVVA +PPSK F R PK TNPSNNK +  L
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
               E  V  +NGT+  K+R +  D+K S   +YK  KL+Y ED+LRE+FY QHPWELSR
Sbjct: 61  SEYSE-TVGIKNGTY--KTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSR 117

Query: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180
           PK+++EN G+E+YDWS IQQLGK LDGE+VVQR +YL+K+K  +       +AR+EFYRV
Sbjct: 118 PKVLIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRV 177

Query: 181 RMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS 240
           R+Q             MFGSVFG S+IE+G+++EQKVI+ WK+KAI +TELM A+ + PS
Sbjct: 178 RVQQEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPS 237

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  283 bits (724), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 175/249 (70%), Gaps = 4/249 (1%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MKIQ NAVNVLERTS+YLRSGLL   PAWY+VVA IPP  KF R P+  NPSN KKL  L
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
           +        + N    FK+R + LDKK ++  +Y+  KL ++EDQLREVFY QHPWELSR
Sbjct: 61  K----DHADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSR 116

Query: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180
           PK++VEN+ +E +DWSHIQQL K LDGE+V+QR ++L+K        +   +AR+EFYR+
Sbjct: 117 PKVLVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRL 176

Query: 181 RMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS 240
           RMQ             MFGS++GPS I+FG+ QEQK ID+WK+KAI ET+L+ A+R NPS
Sbjct: 177 RMQQEVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPS 236

Query: 241 ETWAQEKEE 249
           E WA  +E+
Sbjct: 237 EAWAAGEEQ 245

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  281 bits (720), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 138/244 (56%), Positives = 174/244 (71%), Gaps = 3/244 (1%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MKIQ NAVNVL+RTS+YL+SGLL + PAWYNVVA IPPS KF R P+F NPSN   + EL
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
             + +R  +++NG  L+K+R N  DK+ S K +YKP KL+Y+ED+LR +FY QHPWELSR
Sbjct: 61  DDVTQRQHANKNG--LYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSR 118

Query: 121 PKIVVENN-GDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYR 179
           PKI+VEN  GDE YDW  + QLGK LDGE+VVQR M+L+K K      +    ARYEFY 
Sbjct: 119 PKILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYA 178

Query: 180 VRMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNP 239
           +RMQ             MFGS+FG S IE G+ +EQ+V+DVW++K I ETELM AK +NP
Sbjct: 179 LRMQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNP 238

Query: 240 SETW 243
           + +W
Sbjct: 239 AGSW 242

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  278 bits (710), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 139/263 (52%), Positives = 182/263 (69%), Gaps = 4/263 (1%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MKIQ NAVNVL+RTS+YL+SGLL   PAWYNVVA IPPS KF R P+F NPSN + + +L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
             + ER  ++ NG  L+K+R N  D++   K +YKP KL+Y+ED+LR +FY QHPWELSR
Sbjct: 61  VDVTERQQANANG--LYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSR 118

Query: 121 PKIVVENN-GDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYR 179
           PKI+VEN  GDE YDWSH+ QLGK LDGE+V+QR M+L+K +      +    ARYEFY 
Sbjct: 119 PKILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYA 178

Query: 180 VRMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNP 239
           +RM+             MFGS+FG S+IE G+ +EQ+V+DVW++K I ETELM A+ +NP
Sbjct: 179 LRMEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSSNP 238

Query: 240 SETWAQEKEEDVNYPDGEQITEE 262
           + +W  +   D    D E +T E
Sbjct: 239 AGSWKDDATLDTAQ-DEEPVTTE 260

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  277 bits (709), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 180/250 (72%), Gaps = 6/250 (2%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MK+QQNAVNVLERTSSYL++GLL K PAWY+VVA +PPSK+F R P+  NPS NK+  +L
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  RIIDERL-VSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELS 119
               E+  V +R+    +K+R ++ +++ S   ++   KL Y ED+LREVFY QHPWELS
Sbjct: 61  SEFAEQYSVENRS----YKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELS 116

Query: 120 RPKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYR 179
           RPK++VEN+G   YDWS IQQLGK LDGE+VVQR +YL++ K          +AR+EFYR
Sbjct: 117 RPKMLVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYR 176

Query: 180 VRMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNP 239
           +R+Q             MFGSVFGPS I+FG+++EQK+IDVWK+KAI +TE+M A+  NP
Sbjct: 177 LRIQEEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINP 236

Query: 240 SETW-AQEKE 248
           SE+W AQE +
Sbjct: 237 SESWSAQESQ 246

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  275 bits (702), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 176/260 (67%), Gaps = 11/260 (4%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MKIQ NAVNVL+RTS+YL+SGLL   PAWYNVVA IPPS KF R P F NPSN   +  L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
             + E   ++ NG  L+K+R N  DK+   K +YKP KL+Y+ED+LR +FY QHPWELSR
Sbjct: 61  VDVIENQHTNSNG--LYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSR 118

Query: 121 PKIVVENN-GDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYR 179
           PKI+VEN  GDE YDWSH+ QLGK LDGE+V+QR MYL+K K      +    ARYEFY 
Sbjct: 119 PKILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYA 178

Query: 180 VRMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNP 239
           +RMQ             MFGS+FG S IE G+ +EQ+V+++W++K I ETELM A+ +NP
Sbjct: 179 LRMQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSSNP 238

Query: 240 SETW--------AQEKEEDV 251
           + +W        AQE+E + 
Sbjct: 239 AGSWKDDTTLHTAQEEESNT 258

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  274 bits (700), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 188/259 (72%), Gaps = 6/259 (2%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MKIQ NAVN++ERTS+YL SGLL   PAWY+VVA IPP+KKF R PK TNP+  +  N+ 
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGR--NKT 58

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
              D+R+  +  G  L+K+R N++D+K S+ N+YKP KL Y+ED+LR +F+ QHPWELSR
Sbjct: 59  FFKDDRIRVNNKG--LYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSR 116

Query: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180
           PKI++EN+ +E +DWSHIQQ  K LDGE+VVQR +YL+K +  +   +   KAR+EFYR+
Sbjct: 117 PKILIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRL 176

Query: 181 RMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS 240
           R+Q             MFGS+F  ++ E G+++EQKVI+ WK+KAI ET+LME + +NPS
Sbjct: 177 RIQQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPS 236

Query: 241 ETWAQEKEEDV--NYPDGE 257
           ++WA  +E+D+  ++ +GE
Sbjct: 237 DSWAAPEEQDLEEDFTEGE 255

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  273 bits (699), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 173/244 (70%), Gaps = 3/244 (1%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MKIQ NAVNVL+RTS+YL+SGLL + PAWYNVVA IPPS KF R P+F NPSN   + +L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
             + E+  ++  G  L+K+R N  DK+   K +Y+P KL+Y+ED+LR +FY QHPWELSR
Sbjct: 61  VDVTEQPHANNKG--LYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSR 118

Query: 121 PKIVVENN-GDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYR 179
           PKI+VEN  GDE YDWSH+ Q+G+ LDGE+V+QR MYL+K K      +    ARYEFY 
Sbjct: 119 PKILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYA 178

Query: 180 VRMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNP 239
           +RMQ             MFGS+FG S IE G+ +EQ+V+DVW++K + ETELM A+ +NP
Sbjct: 179 LRMQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNP 238

Query: 240 SETW 243
           + +W
Sbjct: 239 AGSW 242

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  273 bits (697), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 175/249 (70%), Gaps = 4/249 (1%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MK+Q NAVNVLERTS+YLRSGLL + PAWY VVA +PP+ KF R  +F NPS  KK  + 
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
           +  DE +  +R G   +K+R +  D+K     +YK  KL ++EDQLREVFY QHPWE SR
Sbjct: 61  KEFDEGI--NRKG--FYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSR 116

Query: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180
           PK++VEN  +E +DWS++ QLGK LDGE+VVQR +YL++K   +       + R+EFYR+
Sbjct: 117 PKMLVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRL 176

Query: 181 RMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS 240
           RMQ             MFGSVF  S I++G++QEQ+VIDVWK+KAI ETEL+ A+R +P+
Sbjct: 177 RMQEEIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPA 236

Query: 241 ETWAQEKEE 249
           E+W QEK+E
Sbjct: 237 ESWGQEKQE 245

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  273 bits (697), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 178/244 (72%), Gaps = 7/244 (2%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           M++Q NA+N++ERTS+YL+SGLL   PAWY VVA+IPP+KKF R P+  NPS N+ L  L
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
           R  D R   ++ G   +K+R NKLD+K +S  +YKP KL Y+EDQLR +F+ QHPWELSR
Sbjct: 61  R--DNREAVNKKG--FYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSR 116

Query: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMK-KKLIMIFQKHTIKARYEFYR 179
           PKI+VEN+ +E +DWSHIQQLGK LDGE+VVQR MYL+K  K+ MI   +  +AR+EFYR
Sbjct: 117 PKILVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKMDMITAYN--QARFEFYR 174

Query: 180 VRMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNP 239
            R+Q             MFGSVF  S I+FG+++EQKVI  WK+KA  ETEL+ A+R NP
Sbjct: 175 FRIQQEVEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANP 234

Query: 240 SETW 243
           S++W
Sbjct: 235 SDSW 238

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  271 bits (694), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 187/263 (71%), Gaps = 15/263 (5%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MKIQQNAVNVLERTS+YL++G++ K P WY+VVA  PPSKKF R PKF NPS NK+  E 
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
           + + + L      T L+K+R N +DKK++  ++YK  KL+YIED+LR++FY QHPWEL+R
Sbjct: 61  KPLKDYL---NRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTR 117

Query: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMK----KKLIMIFQKHTIKARYE 176
           PKIV+EN+G+ TYDWS + QLGK LDGE+VVQR ++L+K    +KLI  +     +AR+E
Sbjct: 118 PKIVMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYN----QARFE 173

Query: 177 FYRVRMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKR 236
           FYR+RM              MFG+VFG +TIEFG+++EQ++ID WK +AI ETE+ EAKR
Sbjct: 174 FYRLRMAEEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKR 233

Query: 237 TNPSETWAQE----KEEDVNYPD 255
           +  S +W  +    KE++ N  D
Sbjct: 234 SKESVSWKTDSLEGKEDEFNTGD 256

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  268 bits (684), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 128/251 (50%), Positives = 175/251 (69%), Gaps = 5/251 (1%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MKIQ NA N+LERTS+YL++GLL   PA+Y+V+A++PPS KF R PK  NPS  +     
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
           R + +++    N   L+K+RY   D+ +S   +YK ++L Y+ED LR++FY QHPWELSR
Sbjct: 61  RELTDKV----NWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSR 116

Query: 121 PKIVVENNGD-ETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYR 179
           PKIV+ENN D  + DWS+IQQLGK +DGE+VVQR ++LMK K          +AR+EFY+
Sbjct: 117 PKIVIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQ 176

Query: 180 VRMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNP 239
           VRMQ             MFGS+FGP+ +E+G+ +EQ VI  WK++AI ETEL++AKR NP
Sbjct: 177 VRMQRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANP 236

Query: 240 SETWAQEKEED 250
           S++WAQE+  D
Sbjct: 237 SDSWAQEESSD 247

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  263 bits (673), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 128/238 (53%), Positives = 168/238 (70%), Gaps = 3/238 (1%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MK+QQNAVNVLERTSSYLR+G+L K PAWY VVA+IPPSK+F R P+  NPS N ++ +L
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
               E    +      +K+R ++ DK+ S   +YK  KL Y ED+LRE+F+ QHPWELSR
Sbjct: 61  SEFRESYNFENRS---YKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSR 117

Query: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180
           PK++VEN+G + YDWS +QQLGK LDGE+VVQR +YL+K K          +AR+EFYR+
Sbjct: 118 PKMLVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRL 177

Query: 181 RMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTN 238
           R+Q             M GSVFGPS I+FG+ +EQK+IDVWK+KAI ++EL+ A+ TN
Sbjct: 178 RIQEEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTN 235

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  262 bits (670), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 165/243 (67%), Gaps = 3/243 (1%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MKIQ NAVN+LERTS++L SG++ K PAWYNVVA  PP KKFER P F NPS  K    L
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
           +     L S RN   ++K+RY+  DK+ S   +Y+P KL Y+EDQLR++FY QHPWE SR
Sbjct: 61  KSF---LDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSR 117

Query: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180
           P I++ENN    +DWS IQQLGK LDGE+VVQRA++L++            KAR+EFYR+
Sbjct: 118 PMILIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRI 177

Query: 181 RMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS 240
           RMQ             M+GSV+  S IEFG+++E KVI+ WKR+ I ETE M A+R +PS
Sbjct: 178 RMQQELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237

Query: 241 ETW 243
           E+W
Sbjct: 238 ESW 240

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  259 bits (661), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 130/252 (51%), Positives = 167/252 (66%), Gaps = 4/252 (1%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MKIQ NA N+LERTSS+LR GLL + P WY+V+ + PPS KF R PK  NPS      +L
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
           R   +   S  +GT+  K+R NK +K+ S+  VY+  KL Y ED+LR +FY QHPWELSR
Sbjct: 61  REFSDNRNSS-SGTY--KTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSR 117

Query: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180
           PKI+VEN GDE +DWS IQQLGK LDGE+VVQR +YL+             +AR+EFYR+
Sbjct: 118 PKILVENQGDEKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRL 177

Query: 181 RMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS 240
           RMQ             M GSVFGPS +EFG+ +EQ+VID WK+KA+ + ELM AKR++ S
Sbjct: 178 RMQQELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRSDQS 237

Query: 241 ETWAQEKEEDVN 252
             W   +E++ N
Sbjct: 238 ANWGT-REDNAN 248

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  256 bits (655), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 130/242 (53%), Positives = 170/242 (70%), Gaps = 3/242 (1%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MKIQ NAVNVLERTS+YLR+G++ + PAWYNVVA IPP  KF R P   NPS +KK++EL
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
           +  D   V +RNG  L+K+R+N L++K ++K +YKP KL Y+ED++R +FY QHPWEL+R
Sbjct: 61  KDPDLESV-NRNG--LYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELAR 117

Query: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180
           PKIV EN  +   DW ++ QLG+ LDGENVVQR +YL+K K          +AR EFYR+
Sbjct: 118 PKIVSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRL 177

Query: 181 RMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS 240
           RMQ             MFGSVFGPSTIE G+ +EQ+VI+ WKR A  ++EL+ AK+ N S
Sbjct: 178 RMQQELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENAS 237

Query: 241 ET 242
           + 
Sbjct: 238 KA 239

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  255 bits (652), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 179/255 (70%), Gaps = 12/255 (4%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MK+QQ AVNVLERTS+YL+SG+L K PAWYNV+A++PP+KKF RTP+ T+P N K    L
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
                      N + L+K+R N L+KK  +  +Y+  KL YIED+LR++F+ QHPWELSR
Sbjct: 61  PDYSNW---KANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSR 117

Query: 121 PKIVVENNGD-ETYDWSHIQQLGKALDGENVVQRAMYLM----KKKLIMIFQKHTIKARY 175
           PKI+VEN  + + YDWSHIQQLGK LDGE+VVQR ++L+    KK+LI  +     +AR+
Sbjct: 118 PKILVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYD----QARF 173

Query: 176 EFYRVRMQSXXXXXXXXXXXXMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAK 235
           EFYR+R+Q             MFGSVF  ++IE+G+ +EQKVID WKRKA+ + ELM A+
Sbjct: 174 EFYRLRIQQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAAR 233

Query: 236 RTNPSETWAQEKEED 250
            ++PS +W  E EE+
Sbjct: 234 ASSPSASWTNETEEE 248

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  201 bits (510), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 102/183 (55%), Positives = 133/183 (72%), Gaps = 5/183 (2%)

Query: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60
           MKIQ NAVNVL+RTS YL++GLL K PAWYNVVA IPP  KF R PK  +P + K   EL
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120
            I+ +RL  +RN T  +K+R    D+++++  V+KP+KL +IED+LR +F+ QHPWELSR
Sbjct: 61  DIMTDRL--NRN-TETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSR 115

Query: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180
           PK++VEN G+E YDWS + QLGK LDGE+VVQR +YL+K            +AR+EFYR+
Sbjct: 116 PKVLVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRL 175

Query: 181 RMQ 183
           RMQ
Sbjct: 176 RMQ 178

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 14/106 (13%)

Query: 4   QQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNELRII 63
           QQN +NVL   S+ L   +    P+W   +   PP   ++ TP+F +P  + K  +  I+
Sbjct: 157 QQNEINVLLPPSNPLEKQI----PSW---LPNFPPDHTYKFTPEFNHPITDLKTIKKEIV 209

Query: 64  DERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKL---SYIEDQL 106
            E   S++    L KS    L   SS+ N  +P  L     IE QL
Sbjct: 210 KESQESEKALLNLNKS----LSHISSASNTPQPPGLDDEDAIEQQL 251

>KNAG0F01020 Chr6 (184201..185121) [921 bp, 306 aa] {ON} Anc_2.40
           YNL210W
          Length = 306

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 38/70 (54%), Gaps = 9/70 (12%)

Query: 201 VFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPSETWAQEKEEDVNYPDGEQIT 260
           V  P T++ G+D+  +++ +  R+ ++  E +E + T PS T+       +  P G++I 
Sbjct: 193 VIPPITVKCGIDRSDRLMPLEYRRLVSSIETVELQLTKPSVTY-------LIGPQGQRIE 245

Query: 261 E--EATGITL 268
           E   A+G T+
Sbjct: 246 EIRAASGATI 255

>KLTH0G12056g Chr7 complement(1012940..1014760) [1821 bp, 606 aa]
           {ON} some similarities with uniprot|P32319 Saccharomyces
           cerevisiae YBL017C PEP1 Type I transmembrane sorting
           receptor for multiple vacuolar hydrolases cycles between
           the late-Golgi and prevacuolar endosome-like
           compartments
          Length = 606

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 43/102 (42%), Gaps = 21/102 (20%)

Query: 38  PSKKFERTPKFTNPSNNKKLNELRIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPA 97
           P +   RTP+  +       +ELR  +E LVS+ +G  L  +    LD  S S       
Sbjct: 298 PKRLLVRTPRIVD-------DELR--EELLVSNAHGPLL--TSLVILDPYSQS------- 339

Query: 98  KLSYIEDQLREVFYIQHPWELSRPKIVVENNGDE--TYDWSH 137
            +++I+     V  I HPW L        N GD   T+D  H
Sbjct: 340 -VTFIDTDADRVATILHPWHLQSMTAFPANKGDALITFDDGH 380

>TDEL0C03150 Chr3 complement(562981..563730) [750 bp, 249 aa] {ON}
           Anc_7.451 YJR083C
          Length = 249

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%)

Query: 215 QKVIDVWKRKAIAETELMEAKRTNPSETWAQEKEEDVNYPDGEQITEEATGITL 268
           Q ++D +   ++AE E  E  RT   +      +E ++Y D E++  EATG TL
Sbjct: 182 QNLVDKFNEFSVAEDEEEEFDRTQNKQKDDFYLKEKLDYDDDEEVVNEATGSTL 235

>KLLA0E11595g Chr5 complement(1018972..1024518) [5547 bp, 1848 aa]
            {ON} similar to uniprot|P08964 Saccharomyces cerevisiae
            YHR023W MYO1 Type II myosin heavy chain required for
            wild- type cytokinesis and cell separation localizes to
            the actomyosin ring binds to myosin light chains Mlc1p
            and Mlc2p through its IQ1 and IQ2 motifs respectively
          Length = 1848

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 13/71 (18%)

Query: 4    QQNAVNVLERTSSYLRSGLL---------TKQPAWYNVVAEIPPSKKFERTPKFTNPSNN 54
            Q+NA   L + +  LR+ LL         ++  AW+N V  +  + + ERT KF     +
Sbjct: 1688 QENAS--LAKANEILRNDLLDAKNKLADTSENDAWFNKVQTLTTTLEEERTSKFEEIKKS 1745

Query: 55   KKLNELRIIDE 65
            KKL   RII+E
Sbjct: 1746 KKLE--RIIEE 1754

>SAKL0B05192g Chr2 (447273..451226) [3954 bp, 1317 aa] {ON} similar
           to uniprot|Q08748 Saccharomyces cerevisiae YOR296W
           Hypothetical ORF
          Length = 1317

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 45/99 (45%), Gaps = 3/99 (3%)

Query: 71  RNGTFLFK--SRYNKLDKKSSSKNV-YKPAKLSYIEDQLREVFYIQHPWELSRPKIVVEN 127
           ++ +F F   S+Y +LD  SS   + Y  A LS   D+  +   ++H ++L   K++  +
Sbjct: 397 KDASFFFTKCSKYWRLDMPSSKAAILYTAANLSLFTDEELDPSGVEHIFQLIHTKMLSRD 456

Query: 128 NGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIF 166
               T  W+ + Q    ++      + M  +K  L  I+
Sbjct: 457 EDLNTLTWNSVDQQQWLINLNQTFTKCMNSLKYLLTGIY 495

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 205 STIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPSETWAQEKEEDVNYPDGEQITEEAT 264
           ++I+ G+D     ID+ K K++  T L E  + +P  +W  + ++  N+PD  QIT+ +T
Sbjct: 213 NSIDHGLDSLDD-IDLEKSKSLF-TRLFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNST 270

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,120,681
Number of extensions: 1273356
Number of successful extensions: 4511
Number of sequences better than 10.0: 51
Number of HSP's gapped: 4621
Number of HSP's successfully gapped: 51
Length of query: 268
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 160
Effective length of database: 41,097,471
Effective search space: 6575595360
Effective search space used: 6575595360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 65 (29.6 bits)