Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C034102.287ON37137119570.0
YIL094C (LYS12)2.287ON37136915330.0
Kpol_1003.392.287ON37037115310.0
Smik_9.852.287ON37137115290.0
NCAS0B062502.287ON37335915290.0
KNAG0A054202.287ON37237115240.0
Suva_9.1052.287ON37137115220.0
TDEL0G021802.287ON36937115180.0
Skud_9.792.287ON37136915140.0
NDAI0B035502.287ON37237215030.0
SAKL0E07656g2.287ON36837114910.0
KLTH0G10384g2.287ON36737114890.0
TBLA0B059402.287ON36937114860.0
CAGL0G02585g2.287ON37237514830.0
Kwal_27.115282.287ON36737114790.0
KLLA0E08339g2.287ON36935314750.0
KAFR0J013602.287ON37337214730.0
ZYRO0A01914g2.287ON36837114710.0
Ecym_33262.287ON36634914260.0
ADL214C2.287ON36734813330.0
NCAS0H022505.473ON4223874765e-55
Ecym_23135.473ON3703914692e-54
KLLA0E03125g5.473ON3683954682e-54
SAKL0G03520g5.473ON3693874595e-53
Skud_15.3005.473ON3693964595e-53
NDAI0C014105.473ON3693794561e-52
Smik_15.3165.473ON3693904561e-52
Skud_14.2932.278ON3613824542e-52
Suva_8.1885.473ON3693964543e-52
AFR137C5.473ON3673924543e-52
CAGL0I07227g5.473ON3683774533e-52
YOR136W (IDH2)5.473ON3693964516e-52
YNL037C (IDH1)2.278ON3603854508e-52
TDEL0C038402.278ON3613814491e-51
TPHA0D015602.278ON3603864491e-51
ADL223W2.278ON3623524482e-51
TPHA0J027705.473ON3763864457e-51
Smik_14.2902.278ON3603514412e-50
NDAI0B035902.278ON3593844393e-50
KNAG0B040705.473ON3733914395e-50
KLLA0F04103g2.278ON3613524376e-50
SAKL0E07876g2.278ON3613554368e-50
Kpol_440.125.473ON3683974351e-49
KLTH0F15048g5.473ON3683734342e-49
Kpol_543.85.473ON3683734342e-49
KLTH0G10186g2.278ON3603564332e-49
TBLA0B069102.278ON3653564333e-49
Kwal_23.50122.278ON3613564324e-49
KAFR0B063705.473ON3783794325e-49
ZYRO0D11220g5.473ON3683854291e-48
TDEL0A033705.473ON3713984291e-48
NCAS0B062902.278ON3593854253e-48
Kwal_55.212735.473ON3683794254e-48
Ecym_33162.278ON3623864245e-48
Kpol_1039.352.278ON3593884192e-47
TPHA0E014805.473ON3773694194e-47
TBLA0B022405.473ON3733544186e-47
ZYRO0D02838g2.278ON3613554167e-47
KNAG0A052802.278ON3613824132e-46
KAFR0J014102.278ON3503844122e-46
TBLA0C015001.402ON3653684115e-46
CAGL0G02673g2.278ON3583524071e-45
TDEL0B060001.402ON3623663872e-42
KLLA0D04906g1.402ON3623603826e-42
AAL012C1.402ON3723773759e-41
NDAI0G042301.402ON3633603713e-40
Ecym_12961.402ON3633663687e-40
KAFR0I022001.402ON3653763626e-39
Kpol_1048.631.402ON3643713601e-38
Smik_3.661.402ON3643683591e-38
ZYRO0E04796g1.402ON3623683582e-38
YCL018W (LEU2)1.402ON3643603573e-38
KLTH0H12188g1.402ON3643683565e-38
KNAG0I012801.402ON4473603606e-38
Skud_3.431.402ON3643683548e-38
CAGL0H03795g1.402ON3653683531e-37
Kwal_0.2251.402ON3643703503e-37
Suva_3.31.402ON3643683442e-36
Suva_14.3022.278ON3003253384e-36
SAKL0D08690g1.402ON3643663331e-34
NCAS0C048701.402ON3653613312e-34
TPHA0B037301.402ON3653693293e-34
TDEL0E011604.254ON4232861631e-11
TPHA0B022104.254ON4333001471e-09
KLLA0F12342g1.396ON4152831461e-09
Kwal_23.42104.254ON4222041452e-09
CAGL0D00770g4.254ON4232981443e-09
KAFR0H031601.396ON4211261443e-09
NCAS0A025104.254ON4262861425e-09
KAFR0G032604.254ON4211911416e-09
Kpol_1055.784.254ON4271821372e-08
KNAG0D044104.254ON4282131372e-08
KLTH0H12012g1.396ON4132201372e-08
SAKL0H02860g4.254ON4212801363e-08
AER061C4.254ON4252861328e-08
NDAI0D043604.254ON4242071329e-08
TBLA0C012901.396ON4181261301e-07
NCAS0A087201.396ON4131301302e-07
CAGL0H03663g1.396ON4182191292e-07
Ecym_13061.396ON4152721282e-07
KLLA0B03355g4.254ON4292861283e-07
SAKL0D08426g1.396ON4112211273e-07
KNAG0H016701.396ON4241261273e-07
AAL022W1.396ON4151931274e-07
KLTH0D14476g4.254ON4202881264e-07
TDEL0B061001.396ON4141261257e-07
KAFR0I021301.396ON4081261231e-06
YDL066W (IDP1)4.254ON4281151221e-06
Kwal_0.1911.396ON4111261222e-06
Skud_4.1894.254ON4291151212e-06
Skud_12.2391.396ON4122181212e-06
TBLA0A080104.254ON4282091203e-06
KNAG0I013201.396ON4121261193e-06
Smik_12.2351.396ON4122061194e-06
ZYRO0B12496g4.254ON4222871194e-06
Skud_14.3181.396ON4201261184e-06
ZYRO0E05016g1.396ON4111261185e-06
Suva_10.2711.396ON4121311177e-06
CAGL0B04917g1.396ON4111301177e-06
YNL009W (IDP3)1.396ON4201261177e-06
Suva_14.3391.396ON4171291167e-06
Smik_4.1694.254ON4281151168e-06
Suva_4.1844.254ON4291871169e-06
YLR174W (IDP2)1.396ON4122061169e-06
Ecym_32654.254ON4242111169e-06
Smik_14.3191.396ON4181311169e-06
Kpol_1048.701.396ON4192011141e-05
NDAI0G008501.396ON4192051142e-05
NCAS0G036201.396ON4181511132e-05
TPHA0B036601.396ON4221281113e-05
Suva_14.303singletonON5350951e-04
NDAI0G051601.396ON420104980.001
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C03410
         (371 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   758   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   595   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   594   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   593   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   593   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              591   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   590   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   589   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   587   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   583   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   578   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   578   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   577   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   575   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   574   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   572   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   572   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   571   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   553   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   518   0.0  
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    187   5e-55
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   185   2e-54
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   184   2e-54
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   181   5e-53
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   181   5e-53
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   180   1e-52
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   180   1e-52
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   179   2e-52
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   179   3e-52
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   179   3e-52
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   179   3e-52
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   178   6e-52
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   177   8e-52
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   177   1e-51
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   177   1e-51
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   177   2e-51
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   176   7e-51
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   174   2e-50
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   173   3e-50
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   173   5e-50
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   172   6e-50
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   172   8e-50
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   172   1e-49
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   171   2e-49
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   171   2e-49
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   171   2e-49
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            171   3e-49
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   171   4e-49
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   171   5e-49
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   169   1e-48
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   169   1e-48
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   168   3e-48
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   168   4e-48
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   167   5e-48
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   166   2e-47
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   166   4e-47
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   165   6e-47
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   164   7e-47
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              163   2e-46
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   163   2e-46
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   162   5e-46
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   161   1e-45
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   153   2e-42
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   151   6e-42
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   149   9e-41
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   147   3e-40
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   146   7e-40
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   144   6e-39
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   143   1e-38
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   142   1e-38
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   142   2e-38
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   142   3e-38
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   141   5e-38
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   143   6e-38
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   140   8e-38
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             140   1e-37
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   139   3e-37
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      137   2e-36
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   134   4e-36
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   132   1e-34
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   132   2e-34
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   131   3e-34
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    67   1e-11
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    61   1e-09
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    61   1e-09
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    60   2e-09
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    60   3e-09
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    60   3e-09
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    59   5e-09
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    59   6e-09
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    57   2e-08
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    57   2e-08
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    57   2e-08
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    57   3e-08
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    55   8e-08
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    55   9e-08
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    55   1e-07
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    55   2e-07
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    54   2e-07
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    54   2e-07
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    54   3e-07
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    54   3e-07
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    54   3e-07
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    54   4e-07
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    53   4e-07
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    53   7e-07
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    52   1e-06
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    52   1e-06
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    52   2e-06
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    51   2e-06
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    51   2e-06
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    51   3e-06
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    50   3e-06
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    50   4e-06
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    50   4e-06
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    50   4e-06
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    50   5e-06
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    50   7e-06
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    50   7e-06
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    50   7e-06
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    49   7e-06
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    49   8e-06
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    49   9e-06
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    49   9e-06
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    49   9e-06
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    49   9e-06
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    49   1e-05
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     49   2e-05
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    48   2e-05
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    47   3e-05
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    41   1e-04
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    42   0.001

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/371 (100%), Positives = 371/371 (100%)

Query: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60
           MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI
Sbjct: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60

Query: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY
Sbjct: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180
           ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR
Sbjct: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240
           IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ
Sbjct: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240

Query: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300
           IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG
Sbjct: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300

Query: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360
           SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST
Sbjct: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360

Query: 361 SDVVNDVIRRL 371
           SDVVNDVIRRL
Sbjct: 361 SDVVNDVIRRL 371

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/369 (78%), Positives = 324/369 (87%), Gaps = 1/369 (0%)

Query: 4   RSVYNR-QFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDL 62
           RSV  R    R + + + + +LTIGLIPGDGIGKEVIP+G+QVLE +  KHGL+FNFIDL
Sbjct: 3   RSVATRLSACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDL 62

Query: 63  QAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 122
            AG+QTF +TGKALP ETVK L+E C GALFGAVQSPTTKVEGYSSPIVALR+E+GL+AN
Sbjct: 63  YAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFAN 122

Query: 123 IRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIA 182
           +RPVKSV+    K +DMVIVRENTEDLYIK+EKTYID+ TGTRVADATKRISE+ATRRIA
Sbjct: 123 VRPVKSVEGEKGKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIA 182

Query: 183 KIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQII 242
            IALDIAL+RL+  G   LTVTHKSNVLSQSDGLFRE+CKEV+ESNK  Y  I+YNEQI+
Sbjct: 183 TIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIV 242

Query: 243 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHGSA 302
           DSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHGSA
Sbjct: 243 DSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 302

Query: 303 PDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSD 362
           PDIAGKGI+NPIATIRSTALMLEFLGH++AAQDI  AVD+NLRE  IKTPDLGGK ST  
Sbjct: 303 PDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKASTQQ 362

Query: 363 VVNDVIRRL 371
           VV+DV+ RL
Sbjct: 363 VVDDVLSRL 371

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/371 (76%), Positives = 327/371 (88%), Gaps = 1/371 (0%)

Query: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60
           MLR  VY    +RT+ N   +SNLTIGLIPGDGIGKEVIP+G++VLETIG K+ + F FI
Sbjct: 1   MLRNGVYRACARRTVVN-GARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFI 59

Query: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           DL AGWQTFLDTGKALP ETV  L++ C GALFGAVQSPTTKVEGYSSPIVALRK+LGLY
Sbjct: 60  DLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLY 119

Query: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180
           ANIRPVKSV    ++ VDMVIVRENTEDLYIK E+TYIDE TGT+VA+ATKRISEVATR+
Sbjct: 120 ANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRK 179

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240
           IAKIALDIALQRLKN G   LTVTHKSNVLSQSDGLFREVC++V+E NK LY ++ YNEQ
Sbjct: 180 IAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQ 239

Query: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300
           I+DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP I+IGEPCHG
Sbjct: 240 IVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHG 299

Query: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360
           SAPDI+G+GISNP+ATIRS ALML+FLG+++AA+DIQ AVD N+R  KIKTPDLGG +ST
Sbjct: 300 SAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSST 359

Query: 361 SDVVNDVIRRL 371
           ++V +D++ +L
Sbjct: 360 TEVTDDILSKL 370

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/371 (77%), Positives = 321/371 (86%)

Query: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60
           MLR         R +   + + +LTIGLIPGDGIGKEVIP+G+QVLE +  KHGL+FNFI
Sbjct: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           DL AG+QTF +TGKALP ETVK L+E C GALFGAVQSPTTKVEGYSSPIVALR+E+GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180
           AN+RPVKSV+   +K +DMVIVRENTEDLYIK+EKTYID+ TGTRVADATKRISE+ATRR
Sbjct: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240
           IA IA+DIAL+RL+  G   LTVTHKSNVLSQSDGLFRE+CKEV+ESNK  Y  I+YNEQ
Sbjct: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300
           I+DSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360
           SAPDIAGKGI+NPIATIRSTALMLEFLGH+ AAQDI  AVD+NLRE  IKTPDLGGK ST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360

Query: 361 SDVVNDVIRRL 371
             VV DV+ RL
Sbjct: 361 QQVVEDVLSRL 371

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/359 (79%), Positives = 318/359 (88%)

Query: 13  RTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDT 72
           RT    + + NLTIGLIPGDGIGKEVIP+G+QVLE +  KHGL F+FIDLQAG+QTFLDT
Sbjct: 15  RTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDT 74

Query: 73  GKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTP 132
           GKALP ETV+ L+  C GALFGAVQSPTTKVEGYSSPIVALRKE+GL+AN+RPVKSV   
Sbjct: 75  GKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGT 134

Query: 133 GNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQR 192
            ++ VDMVIVRENTEDLYIK+EKTYID+ TGTRVA+ATKRISE+ATRRIA IALDIALQR
Sbjct: 135 KDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQR 194

Query: 193 LKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFRE 252
           LK NG   LTVTHKSNVLSQSDGLFRE+CK+V+ESNK  Y  I YNEQI+DSMVYR+FRE
Sbjct: 195 LKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFRE 254

Query: 253 PECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISN 312
           P+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHGSAPDIAGKGI+N
Sbjct: 255 PQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIAN 314

Query: 313 PIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371
           PIATIRSTALMLEFLGH+ AAQDI  AV++N+RE+KIKTPDLGG ++T  V  DV+ RL
Sbjct: 315 PIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/371 (76%), Positives = 325/371 (87%)

Query: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60
           MLR +       R +   + + +LTIGLIPGDGIGKEVIP+G+QVL+++ PKHGL F+FI
Sbjct: 2   MLRSAANKLAGCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFI 61

Query: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           DLQAG+QTF DTGKALP ETV+ L+E C GALFGAVQSPTTKVEGYSSPIVALRK +GLY
Sbjct: 62  DLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLY 121

Query: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180
           ANIRPVKSV+    + VDM+IVRENTEDLYIK+EKTYID+ TGTRVA+ATKRISE+AT+R
Sbjct: 122 ANIRPVKSVEGSNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQR 181

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240
           IA IALDIALQRL+NNG   LTVTHKSNVLSQSDGLFREVC+E++E+NK  Y+ I YNEQ
Sbjct: 182 IATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQ 241

Query: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300
           I+DSMVYR+FREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHG
Sbjct: 242 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 301

Query: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360
           SAPDIAGKGI+NPIATIRSTALMLEFLGH++AAQDI  AVD+NLR+  +KT DLGG  +T
Sbjct: 302 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNATT 361

Query: 361 SDVVNDVIRRL 371
            +VV+D++ RL
Sbjct: 362 QNVVDDILARL 372

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/371 (77%), Positives = 324/371 (87%), Gaps = 1/371 (0%)

Query: 2   LRRSVYNR-QFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60
           + RSV  R    R + + + + +LTIGLIPGDGIGKEVIP+G+Q+LE +  KHGL+FNFI
Sbjct: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60

Query: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           DL AG+QTF +TGKALP ET+K L++ C GALFGAVQSPTTKVEGYSSPIVALR+E+GLY
Sbjct: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120

Query: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180
           AN+RPVKSV+   +K +DMVIVRENTEDLYIK+EKTYID+ TGTRVADA KRISEVATRR
Sbjct: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240
           IAKIALDIALQRL+  G   LTVTHKSNVLSQSDGLFRE+CK+V+ESNK  Y  I+YNEQ
Sbjct: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240

Query: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300
           I+DSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300

Query: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360
           SAPDIAGKGI+NPIATIRSTALMLEFLGH+ AAQDI  AVD+NLRE  I TPDLGGK ST
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 361 SDVVNDVIRRL 371
             VV+DV+ RL
Sbjct: 361 QQVVDDVLSRL 371

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/371 (76%), Positives = 322/371 (86%), Gaps = 2/371 (0%)

Query: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60
           MLR ++     +R   +  K  ++ IGLIPGDGIGKEVIP+G+QVLE +  KHGL F+FI
Sbjct: 1   MLRSAIGRLATRRAYASAPK--SMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFI 58

Query: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           DLQAGW TF +TGKALP +TV+ L+  C GALFGAVQSPTTKVEGYSSPIVALRKELGLY
Sbjct: 59  DLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLY 118

Query: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180
           AN+RPVKSV+   ++ VDMVIVRENTEDLYIKLEKTY+D+ TGTRVA+ATKRISEVATRR
Sbjct: 119 ANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRR 178

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240
           IA IALDIALQRLK NG+  LTVTHKSNVLSQSDGLFRE+CK+V+ESNK  Y  + YNEQ
Sbjct: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQ 238

Query: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300
           I+DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHG
Sbjct: 239 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 298

Query: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360
           SAPDIAGKGISNPIATIRST LMLEFLGH++ AQDI  AVD+NLREDK+KTPDLGG ++T
Sbjct: 299 SAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTT 358

Query: 361 SDVVNDVIRRL 371
             VV D++ +L
Sbjct: 359 QQVVEDILSKL 369

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/369 (77%), Positives = 321/369 (86%), Gaps = 1/369 (0%)

Query: 4   RSVYNR-QFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDL 62
           RSV  R    R +   + + +LTIGLIPGDGIGKEVIP+G+QVLE +  KHGL+FNFIDL
Sbjct: 3   RSVATRVSACRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDL 62

Query: 63  QAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 122
            AG+QTF +TGKALP ETV  L++ C GALFGAVQSPTTKVEGYSSPIVALR+E+GL+AN
Sbjct: 63  YAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFAN 122

Query: 123 IRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIA 182
           +RPVKSV+   NK +DMVIVRENTEDLYIK+EKTYID+ TGTRVADATKRISE+ATRRIA
Sbjct: 123 VRPVKSVEGSRNKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIA 182

Query: 183 KIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQII 242
            IALDIAL+RL+  G   LTVTHKSNVLSQ+DGLFRE+CKEV+ESNK  Y  I+YNEQI+
Sbjct: 183 TIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQIV 242

Query: 243 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHGSA 302
           DSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHGSA
Sbjct: 243 DSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 302

Query: 303 PDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSD 362
           PDIAGKGI+NPIATIRSTALMLEFLGH+ AAQDI  AVD+NLRE  I TPDLGGK ST  
Sbjct: 303 PDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKASTQQ 362

Query: 363 VVNDVIRRL 371
           VV+DV+ RL
Sbjct: 363 VVDDVLSRL 371

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/372 (76%), Positives = 320/372 (86%), Gaps = 1/372 (0%)

Query: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60
           MLR +       R     + + NLTIGLIPGDGIGKEVIP+G+QVL+ +  KHGL F+FI
Sbjct: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60

Query: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           DLQAG+QTFLDTGKALP ET++ L+  C GALFGAVQSPTTKVEGYSSPIVALRKE+GLY
Sbjct: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120

Query: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLY-IKLEKTYIDEKTGTRVADATKRISEVATR 179
           AN+RPVKSV+   +K VDMVIVRENT     IKLE+TYID  TGTRVA+ATKRISE+ATR
Sbjct: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180

Query: 180 RIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNE 239
           RIA IALDIALQRLK NG   LTVTHKSNVLSQSDGLFRE+CK+V+ESNK  Y  I YNE
Sbjct: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240

Query: 240 QIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCH 299
           QI+DSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 300 GSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNS 359
           GSAPDIAGKGISNPIATIRSTALMLEFLGH++AAQDI  AV++NL+E+K+KTPDLGGK++
Sbjct: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360

Query: 360 TSDVVNDVIRRL 371
           T +V  DV+ RL
Sbjct: 361 TQEVTEDVLARL 372

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/371 (76%), Positives = 318/371 (85%), Gaps = 3/371 (0%)

Query: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60
           MLR +V   QF R     S    LTIGLIPGDGIGKEVIP+G+ VLE +  KH L FNFI
Sbjct: 1   MLRSTV--SQFARR-SYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFI 57

Query: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           DLQAGWQTFLDTGKALP ET++ L+ +C GALFGAVQSPT KVEGYSSPIVALRK+LGLY
Sbjct: 58  DLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117

Query: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180
           AN+RPVKSV    ++ VDM+IVRENTEDLYIK EKTYIDEKTGTRVA+A KRISE AT  
Sbjct: 118 ANVRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTD 177

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240
           IAKIAL+I+LQRLK NG   LTVTHKSNVLSQSDGLFREVCK V+ESNK  Y  I YNEQ
Sbjct: 178 IAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQ 237

Query: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300
           I+DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG   ++GEPCHG
Sbjct: 238 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHG 297

Query: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360
           SAPDIAGKGISNPIATIRSTALMLEF+G+++AAQDI  AVD+N+RE++IKTPDLGGK++T
Sbjct: 298 SAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTT 357

Query: 361 SDVVNDVIRRL 371
             VV+D++ ++
Sbjct: 358 QQVVDDILSKM 368

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/371 (76%), Positives = 319/371 (85%), Gaps = 4/371 (1%)

Query: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60
           MLR S + +  +R+  + SK  +LTIGLIPGDGIGKEVIP+GRQVLE +  KHGL F+FI
Sbjct: 1   MLRAS-FTQLARRSYASASK--SLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFI 57

Query: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           DLQAGWQTF +TGKALP ET+  LR  C GALFGAVQSPT KVEGYSSPIVALRK+LGLY
Sbjct: 58  DLQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117

Query: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180
           AN+RPVKSV  P  + VDM+IVRENTEDLYIK EKTYIDEKTGTRVA+A KRISE AT+ 
Sbjct: 118 ANVRPVKSV-LPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKN 176

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240
           IA IAL+IALQR K NG   LTVTHKSNVLSQSDGLFREVC++V+ESNK  +  I+YNEQ
Sbjct: 177 IANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQ 236

Query: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300
           I+DSMVYR+FREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG   V+GEPCHG
Sbjct: 237 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHG 296

Query: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360
           SAPDIAGKGISNP+ATIRSTALMLEF+GH +AAQDI  AVD+NLR++ IKTPDLGGK++T
Sbjct: 297 SAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTT 356

Query: 361 SDVVNDVIRRL 371
             VV DV+ R+
Sbjct: 357 QQVVEDVLSRM 367

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/371 (75%), Positives = 319/371 (85%), Gaps = 2/371 (0%)

Query: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60
           MLR SV  RQF  +  N S    LTIGLIPGDGIGKEVIP+G+QVL+ +  KHGL F FI
Sbjct: 1   MLRTSV--RQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFI 58

Query: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           DLQAG+QTFLDTG ALP +TV  L+  C GALFGAVQSPTTKVEGYSSPIV LRKELGL+
Sbjct: 59  DLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLF 118

Query: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180
           AN+RPVK+V+    K +D+VIVRENTEDLYIK+EKTY D K G+R+A+ATKRI+E AT+R
Sbjct: 119 ANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKR 178

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240
           IAK ALDIALQRLK  G+  LTVTHKSNVLSQSDGLFREVCKEV+ESNK+LYS + YNEQ
Sbjct: 179 IAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQ 238

Query: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300
           I+DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCHG
Sbjct: 239 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHG 298

Query: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360
           SAPDIAGKGI+NPIATIRSTA MLE+LG+S  AQDI  AVD+N+R++KIKT DLGG ++T
Sbjct: 299 SAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTT 358

Query: 361 SDVVNDVIRRL 371
             V++D++ +L
Sbjct: 359 QQVIDDILGKL 369

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/375 (74%), Positives = 325/375 (86%), Gaps = 7/375 (1%)

Query: 1   MLR----RSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLT 56
           MLR    R    R F  T   +++K+ LTIGLIPGDGIGKEVIP+G+Q+LE +GPK  L 
Sbjct: 1   MLRGSATRLTAMRGFSST--RLAQKA-LTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLD 57

Query: 57  FNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKE 116
           F FIDL AGW+TF +TGKALP ETV+ LR +C GALFGAVQSPTTKVEGYSSPIVALRK 
Sbjct: 58  FKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKA 117

Query: 117 LGLYANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEV 176
           +GL+AN+RPVK+V+   ++ VDMVIVRENTEDLYIK+EKTY D  TGTRVA+ATKRISEV
Sbjct: 118 MGLFANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEV 177

Query: 177 ATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQ 236
           ATRRIA IALDIALQRL++ G+  LTVTHKSNVLSQSDGLFRE+CK+V+ESNK  Y  IQ
Sbjct: 178 ATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQ 237

Query: 237 YNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGE 296
           YNEQI+DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGE
Sbjct: 238 YNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGE 297

Query: 297 PCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGG 356
           PCHGSAPDIAG+GI+NPIATIRSTALMLEFLG+ +AAQ I  AVDSN+RE++IKTPDLGG
Sbjct: 298 PCHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGG 357

Query: 357 KNSTSDVVNDVIRRL 371
           K++T  VV+D++ ++
Sbjct: 358 KSTTQQVVDDILSKI 372

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/371 (75%), Positives = 322/371 (86%), Gaps = 4/371 (1%)

Query: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60
           MLR S +N+  +R+  + +K  +LTIGLIPGDGIG+EVIP+G+ VLE +  KHGL FNFI
Sbjct: 1   MLRTS-FNQLARRSYTSATK--SLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFI 57

Query: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           DL+AGWQTFLDTGKALP ET+  L+  C GALFGAVQSPT KVEGYSSPIVALRK+LGLY
Sbjct: 58  DLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLY 117

Query: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180
           AN+RPVKSV +   K +DMVIVRENTEDLYIK EKTYIDEKTGTRVA+A KRISEVATR 
Sbjct: 118 ANVRPVKSVLSQ-EKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRN 176

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240
           IA IAL+IALQR K NG+  LTVTHKSNVLSQSDGLFRE+C++V+ESN+  +  I YNEQ
Sbjct: 177 IANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQ 236

Query: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300
           I+DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG   V+GEPCHG
Sbjct: 237 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHG 296

Query: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360
           SAPDIAGKGISNP+ATIRSTALMLEF+GH +AAQDI  AVD+NLR++ +KTPDLGGK++T
Sbjct: 297 SAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTT 356

Query: 361 SDVVNDVIRRL 371
             VV+DV+ R+
Sbjct: 357 QQVVDDVLSRM 367

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/353 (76%), Positives = 312/353 (88%)

Query: 19  SKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDTGKALPV 78
           S   NLTIGLIPGDGIGKEVIP+G+++LE++ PK+GL+F FIDLQAGW+TF +TGKALP 
Sbjct: 16  SNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWETFQNTGKALPD 75

Query: 79  ETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPGNKKVD 138
           ET+  L+  C+GALFGAVQSPTTKVEGYSSPIVALRK LGL+AN+RPVKSVD   ++KVD
Sbjct: 76  ETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDGTKDRKVD 135

Query: 139 MVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGN 198
           +VIVRENTEDLYIKLEK+YIDE TGTRVADATKRI+E+AT+ IA IAL IA QRL+ NG+
Sbjct: 136 LVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQNGH 195

Query: 199 VQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFDV 258
             LTVTHKSNVLSQSDGLFREVC+E +E+NK  Y  +QYNEQI+DSMVYR+FREPECFDV
Sbjct: 196 ATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPECFDV 255

Query: 259 IVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIR 318
           +VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHGSAPDIAGKGISNPIATIR
Sbjct: 256 VVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAPDIAGKGISNPIATIR 315

Query: 319 STALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371
           STALMLEFLG+ + A+DI  AVD+N+RE K  TPDLGG ++T  V+ DV+ +L
Sbjct: 316 STALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQVLEDVLSKL 368

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/372 (75%), Positives = 318/372 (85%), Gaps = 2/372 (0%)

Query: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60
           MLR  V      R +       +LTIGLIPGDGIGKEVIP+G+QVL+ +  +HGL FNFI
Sbjct: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60

Query: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           DL+AG+QTFLDTGKALP ETVK L+E C G LFGAVQSPTT+V+ YSSPIVALRKEL LY
Sbjct: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120

Query: 121 ANIRPVKSV-DTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATR 179
           ANIRPVKSV      K VDMVIVRENTEDLYIK+EK+Y D+  G RVA+ATKRI+EVATR
Sbjct: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179

Query: 180 RIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNE 239
           +IAKIALD+ALQRLK NG   LTVTHKSNVLSQSDGLFRE+CK+V+++NK  Y+ I YNE
Sbjct: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239

Query: 240 QIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCH 299
           QIIDSMVYR+FREPE FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP IV+GEPCH
Sbjct: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299

Query: 300 GSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNS 359
           GSAPDIAGKGI+NPIATIRSTALMLEFLGH +AAQDI  AV+SN+RE+KIKTPDLGG +S
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359

Query: 360 TSDVVNDVIRRL 371
           T +VV+DV+ +L
Sbjct: 360 TQNVVDDVLEKL 371

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/371 (73%), Positives = 315/371 (84%), Gaps = 3/371 (0%)

Query: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60
           M R SV     +R     S   ++ IGLIPGDGIGKEVIP+G+QVLE +G KHGL F+FI
Sbjct: 1   MFRSSVAKVAARRAY---SAPKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFI 57

Query: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           DL+AGW+ F   GKALP +TVK L+E C GALFGAVQSPTTKV GYSSPIVALRKELGLY
Sbjct: 58  DLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLY 117

Query: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180
           AN+RPVKSV+   ++ VDM+IVRENTEDLYIK EKTY+DE TGTRVA+A KRISEVATR+
Sbjct: 118 ANVRPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRK 177

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240
           IA IALDI+LQRLK+ G+  LTVTHKSNVLSQSDGLFRE+CK+V+E NK  Y +++YNEQ
Sbjct: 178 IATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQ 237

Query: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300
           I+DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLGVVPSANVGP IVIGEPCHG
Sbjct: 238 IVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 297

Query: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360
           SAPDIAGKGISNPIATIRSTALMLEFLGH + AQDI  AVD+NL +  + TPDLGGK +T
Sbjct: 298 SAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATT 357

Query: 361 SDVVNDVIRRL 371
             VV+D++ ++
Sbjct: 358 QQVVDDILSKI 368

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/349 (76%), Positives = 306/349 (87%), Gaps = 1/349 (0%)

Query: 23  NLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVK 82
           + TIGLIPGDGIGKEVIP GR+VLE IGPK+G+ F +IDLQAGWQTFLDTGKALP +TV+
Sbjct: 19  SFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVE 78

Query: 83  TLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPGNKKVDMVIV 142
            LR NC GALFGAVQSPTTKV+GYSSPIVALRK LGLYANIRPVKSVD  G++ VD+VI 
Sbjct: 79  QLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVIA 138

Query: 143 RENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLT 202
           RENTEDLYIK E+TYID++TG RVA+A KRISE ATR IA IAL+IALQRLK  G+  LT
Sbjct: 139 RENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLT 198

Query: 203 VTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAP 262
           VTHKSNVLSQSDGLFRE+CK V++SNK  ++++QYNEQI+DSMVYRLF+EP+CFDVIVAP
Sbjct: 199 VTHKSNVLSQSDGLFREICKSVYQSNKK-FANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257

Query: 263 NLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTAL 322
           NLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCHGSAPDI G+GI+NPIATIRS AL
Sbjct: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRSAAL 317

Query: 323 MLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371
           +LEFLG  +AA+ I+  VD N+RE+KIKTPDLGG ++   V ND++ R+
Sbjct: 318 LLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/348 (70%), Positives = 296/348 (85%), Gaps = 1/348 (0%)

Query: 24  LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKT 83
           LTIGLIPGDGIGKEVIP+G++VLE IG KH + F++  L AGWQTFL+TG ALP  TV+ 
Sbjct: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80

Query: 84  LRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPGNKKVDMVIVR 143
           LRE C GALFGAVQSPTTKVEGYSSPIVALR++LGLYANIRPVKSV   G + VD+VIVR
Sbjct: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTG-QPVDLVIVR 139

Query: 144 ENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTV 203
           ENTEDLY++ E+TY+D  TG RVA+A KRISE AT RIA+I+L +ALQR +  G   LTV
Sbjct: 140 ENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALTV 199

Query: 204 THKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPN 263
           THKSNVLSQ+DGLF+EVC+EV+E+NK  Y  I+YNEQI+DSMVYRLF+EP CFDV+VAPN
Sbjct: 200 THKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVAPN 259

Query: 264 LYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALM 323
           LYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCHGSAPDIAG+GI+NPIATIRS +LM
Sbjct: 260 LYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRSVSLM 319

Query: 324 LEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371
           L+FLG  +AA DI  AV  NL++ ++ +PDLGGKN+T +V++D++ R+
Sbjct: 320 LQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  187 bits (476), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 138/387 (35%), Positives = 203/387 (52%), Gaps = 48/387 (12%)

Query: 4   RSVYNRQFQRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFN 58
           R + + + Q +IG  + K N      T+  I GDGIG E+  S +Q+           F+
Sbjct: 65  RRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQI-----------FS 113

Query: 59  FIDLQAGWQT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVA 112
              +   W+T      F+D    +P   V+++ +N   AL G + +P  K  G+ S  + 
Sbjct: 114 AAKVPIEWETCDVTPLFIDGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLT 170

Query: 113 LRKELGLYANIRPVKSVDTPGNK----KVDMVIVRENTEDLYIKLEKTYIDEKTGTRVAD 168
           LRK  GL+AN+RP +SV   G K     VD+V++RENTE  Y  +E           V  
Sbjct: 171 LRKTFGLFANVRPARSVK--GFKTTYPNVDLVLIRENTEGEYSGIEHVVTPG-----VVQ 223

Query: 169 ATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN 228
           + K I+  A+ R+ + A +      +  G  +L V HKS +   SDGLF  V KE+ +  
Sbjct: 224 SIKLITREASERVIRYAFEYC----RAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKE- 278

Query: 229 KTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPS 285
              Y DIQ+  ++ID+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+ PS
Sbjct: 279 ---YPDIQFETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPS 335

Query: 286 ANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLR 345
            N+G  I I E  HGSAPDIAGK ++NP A + S+ +ML  +G S+ A  I+ AV S + 
Sbjct: 336 GNIGNEISIFEAVHGSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIA 395

Query: 346 E-DKIKTPDLGGKNSTSDVVNDVIRRL 371
              + +T DL G  +TS   + VI++L
Sbjct: 396 SGPESRTGDLAGTATTSTFTDAVIKKL 422

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  185 bits (469), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 134/391 (34%), Positives = 208/391 (53%), Gaps = 41/391 (10%)

Query: 1   MLRRSVY--NRQF-------QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVL 46
           M ++S++  +R++       Q +IG  + K N      T+  I GDGIG E+  S + + 
Sbjct: 1   MFKQSIFKGSRRYLASASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDIF 60

Query: 47  ETIGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGY 106
                K  + + + D+      F++    +P   V+++ +N   AL G + +P  K  G+
Sbjct: 61  S--AAKVPVEWEYCDVTP---IFINGLTTIPDPAVQSINKNLV-ALKGPLATPIGK--GH 112

Query: 107 SSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGT 164
            S  + LRK  GL+AN+RP KS++      + VD+V++RENTE  Y  +E          
Sbjct: 113 RSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHV-----VSP 167

Query: 165 RVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEV 224
            V  + K I+  A+ R+ + A + A    +  G  ++ V HKS +   +DGLF  V +EV
Sbjct: 168 GVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVVVVHKSTIQRLADGLFVNVAQEV 223

Query: 225 FESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLG 281
            +     Y DI+   ++ID+ V  +  +PE +   V V PNLYGDILSD  + L  GSLG
Sbjct: 224 GKE----YPDIELQPELIDNTVLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLG 279

Query: 282 VVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVD 341
           + PSAN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A  I++AV 
Sbjct: 280 LTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVL 339

Query: 342 SNLREDKI-KTPDLGGKNSTSDVVNDVIRRL 371
           + +  DK  +T DL G  +TS     VI RL
Sbjct: 340 ATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  184 bits (468), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 132/395 (33%), Positives = 208/395 (52%), Gaps = 51/395 (12%)

Query: 1   MLRRSVYNRQF-------QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLET 48
           M R+S+  +         Q +IG  + K N      T+  I GDG+G E+  S + +   
Sbjct: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAI--- 57

Query: 49  IGPKHGLTFNFIDLQAGWQT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTTK 102
                   F+   +   W++      F++    +P   V ++ +N   AL G + +P  K
Sbjct: 58  --------FSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLI-ALKGPLATPIGK 108

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYIDE 160
             G+ S  + LRK  GL+AN+RP KS++      + V++V++RENTE  Y  +E      
Sbjct: 109 --GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHV---- 162

Query: 161 KTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREV 220
                V  + K I++ A+ R+ + A + A    +     ++ V HKS +   +DGLF +V
Sbjct: 163 -VAPGVVQSIKLITQDASERVIRYAFEYA----RAVDRSKVLVVHKSTIQRLADGLFVDV 217

Query: 221 CKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-V 277
            K++     + Y DI+   +++D+ V +  + PE +D  V+V PNLYGDILSD  + L  
Sbjct: 218 AKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSA 273

Query: 278 GSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQ 337
           GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G ++ A  I+
Sbjct: 274 GSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIE 333

Query: 338 TAVDSNLRED-KIKTPDLGGKNSTSDVVNDVIRRL 371
            AV + +  D K +T DLGG  STS   + VI RL
Sbjct: 334 KAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  181 bits (459), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 133/387 (34%), Positives = 200/387 (51%), Gaps = 44/387 (11%)

Query: 2   LRRSVYNRQFQRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLT 56
           L R   + + Q +IG  + K N      T+  I GDG+G E+  S + +           
Sbjct: 10  LPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDI----------- 58

Query: 57  FNFIDLQAGWQT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPI 110
           F   ++   W++      F++    +P   V ++ +N   AL G + +P  K  G+ S  
Sbjct: 59  FAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLI-ALKGPLATPIGK--GHRSLN 115

Query: 111 VALRKELGLYANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVAD 168
           + LRK  GL+AN+RP KSV+      + VD+V++RENTE  Y     + I+      V  
Sbjct: 116 LTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIEHVVSPGVVQ 170

Query: 169 ATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN 228
           + K I+  A+ R+ + A + A    +  G  ++ V HKS +   +DGLF +V KE+    
Sbjct: 171 SIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVDVAKEL---- 222

Query: 229 KTLYSDIQYNEQIIDSMVYRLFREPECF--DVIVAPNLYGDILSDGAAAL-VGSLGVVPS 285
            + Y DIQ   Q++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PS
Sbjct: 223 SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPS 282

Query: 286 ANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLR 345
           AN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A  I+ AV S + 
Sbjct: 283 ANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIA 342

Query: 346 E-DKIKTPDLGGKNSTSDVVNDVIRRL 371
              + +T DL G  STS     VI+RL
Sbjct: 343 SGPENRTADLAGSASTSSFTEAVIKRL 369

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  181 bits (459), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 138/396 (34%), Positives = 206/396 (52%), Gaps = 52/396 (13%)

Query: 1   MLRRSVY---NRQF-----QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLE 47
           MLR +++   +R+F     Q +IG  + K N      T+  I GDGIG E+  S +++  
Sbjct: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKI-- 58

Query: 48  TIGPKHGLTFNFIDLQAGWQT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTT 101
                    FN  ++   W++      F++    +P   V+++  N   AL G + +P  
Sbjct: 59  ---------FNAANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLI-ALKGPLATPIG 108

Query: 102 KVEGYSSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYID 159
           K  G+ S  + LRK  GL+AN+RP KSV+      + VD+V++RENTE  Y  +E     
Sbjct: 109 K--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCP 166

Query: 160 EKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFRE 219
                 V  + K I+  A+ R+ + A + A    +  G  ++ V HKS +   +DGLF  
Sbjct: 167 G-----VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVN 217

Query: 220 VCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL- 276
           V KE+ +     Y DI    ++ID+ V ++   P  +   V V PNLYGDILSD  + L 
Sbjct: 218 VAKELSKE----YPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLS 273

Query: 277 VGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDI 336
            GSLG+ PSAN+G  I I E  HGSAPDIAG+  +NP A + S+ +ML  +G +  A  I
Sbjct: 274 AGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQI 333

Query: 337 QTAVDSNLRE-DKIKTPDLGGKNSTSDVVNDVIRRL 371
           Q AV S +    + +T DL G  +TS     VI+RL
Sbjct: 334 QNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  180 bits (456), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 135/379 (35%), Positives = 198/379 (52%), Gaps = 48/379 (12%)

Query: 12  QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGW 66
           Q +IG  + K N      T+  I GDGIG E+  S +Q+           F+   +   W
Sbjct: 20  QPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQI-----------FDAAKVPIDW 68

Query: 67  QT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           +       F++    +P   V+++ +N   AL G + +P  K  G+ S  + LRK  GL+
Sbjct: 69  EPCDVSPLFINGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLF 125

Query: 121 ANIRPVKSVDTPGNK----KVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEV 176
           AN+RP KS++  G K     VD+VI+RENTE  Y  +E           V  + K I+  
Sbjct: 126 ANVRPAKSIE--GFKTIYDNVDLVIIRENTEGEYSGIEHVVTPG-----VVQSIKLITRD 178

Query: 177 ATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQ 236
           A+ R+ + A + A    +  G  ++ V HKS +   +DGLF +V KE+ +     Y DIQ
Sbjct: 179 ASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQE----YPDIQ 230

Query: 237 YNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPGIV 293
              ++ID+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  + 
Sbjct: 231 LETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVS 290

Query: 294 IGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLRE-DKIKTP 352
           I E  HGSAPDIAG+  +NP A + S+ +ML  +G +  A  I+ AV S +    + +T 
Sbjct: 291 IFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTG 350

Query: 353 DLGGKNSTSDVVNDVIRRL 371
           DL GK +TS   + VI RL
Sbjct: 351 DLAGKATTSSFTDAVIGRL 369

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  180 bits (456), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 137/390 (35%), Positives = 204/390 (52%), Gaps = 40/390 (10%)

Query: 1   MLRRSVY---NRQF-----QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLE 47
           MLR + +   +R+F     Q +IG  + K N      T+  I GDGIG E+  S +++  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 48  TIGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYS 107
                  + + F D+      F++    +P   V+++ +N   AL G + +P  K  G+ 
Sbjct: 61  AANVP--IEWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHR 112

Query: 108 SPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTR 165
           S  + LRK  GL+AN+RP KSV+      + VD+V++RENTE  Y  +E           
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPG----- 167

Query: 166 VADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVF 225
           V  + K I+  A+ R+ + A + A    +  G  ++ V HKS +   +DGLF  V KE+ 
Sbjct: 168 VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKELS 223

Query: 226 ESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGV 282
           +     Y DI    ++ID+ V ++   P  +   V V PNLYGDILSD  + L  GSLG+
Sbjct: 224 KE----YPDITLETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 283 VPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDS 342
            PSAN+G  I I E  HGSAPDIAG+  +NP A + S+ +ML  +G +  A  IQ AV S
Sbjct: 280 TPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLS 339

Query: 343 NLRE-DKIKTPDLGGKNSTSDVVNDVIRRL 371
            +    + +T DL G  +TS     VI+RL
Sbjct: 340 TIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  179 bits (454), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 132/382 (34%), Positives = 201/382 (52%), Gaps = 36/382 (9%)

Query: 1   MLRRSVYNR------QFQRTIGNISKK--SNLTIGLIPGDGIGKEVIPSGRQVLETIGPK 52
           ML R++  R      Q +RT+    KK     T+ LIPGDG+GKE+  S R + E    +
Sbjct: 1   MLNRTIAKRTLATAAQAERTL---PKKYGGRFTVTLIPGDGVGKEITDSVRTIFE--AER 55

Query: 53  HGLTFNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVA 112
             + +  I+++   QT    G     E V++L+ N  G L G   +P  +  G+ S  VA
Sbjct: 56  IPVDWETINIK---QTDHKEG---VYEAVESLKRNKIG-LKGLWHTPADQT-GHGSLNVA 107

Query: 113 LRKELGLYANIRPVKSVDTPGNK--KVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADAT 170
           LRK+L +YAN+   KS+     +   +D++++RENTE  +  LE   +       V ++ 
Sbjct: 108 LRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPG-----VVESL 162

Query: 171 KRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKT 230
           K +++  T RIA+ A D A    K      +T  HK+N++   DGLFR +  E+    +T
Sbjct: 163 KVMTKPKTERIARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNIITEI---GQT 215

Query: 231 LYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
            Y DI  +  I+D+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G 
Sbjct: 216 EYPDIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFGR 275

Query: 291 GIVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKI 349
              + EP       DI G+ ++NP A I S+ LML  LG ++ A  I  AV   + E K 
Sbjct: 276 DYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNENATRISKAVHETIAEGKH 335

Query: 350 KTPDLGGKNSTSDVVNDVIRRL 371
            T D+GG +ST+D  N+VI +L
Sbjct: 336 TTRDIGGSSSTTDFTNEVINKL 357

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  179 bits (454), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 136/396 (34%), Positives = 204/396 (51%), Gaps = 52/396 (13%)

Query: 1   MLRRSVY---NRQF-----QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLE 47
           MLR +     +R+F     Q +IG  + K +      T+  I GDGIG E+  S +++  
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKI-- 58

Query: 48  TIGPKHGLTFNFIDLQAGWQ------TFLDTGKALPVETVKTLRENCDGALFGAVQSPTT 101
                    F+  D+   W+       F++    +P   V+++ +N   AL G + +P  
Sbjct: 59  ---------FSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIG 108

Query: 102 KVEGYSSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYID 159
           K  G+ S  + LRK  GL+AN+RP KS++      + VD+V++RENTE  Y  +E     
Sbjct: 109 K--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCP 166

Query: 160 EKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFRE 219
                 V  + K I+  A+ R+ + A + A    +  G  ++ V HKS +   +DGLF  
Sbjct: 167 G-----VVQSIKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVN 217

Query: 220 VCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL- 276
           V KE+ +     Y DI +  ++ID+ V  +   P  +   V V PNLYGDILSD  + L 
Sbjct: 218 VAKELSKE----YPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLS 273

Query: 277 VGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDI 336
            GSLG+ PSAN+G  + I E  HGSAPDIAGK  +NP A + S+ +ML  +G +  A  I
Sbjct: 274 AGSLGLTPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQI 333

Query: 337 QTAVDSNLRE-DKIKTPDLGGKNSTSDVVNDVIRRL 371
           Q AV S +    + +T DL G  +TS     VI+RL
Sbjct: 334 QNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  179 bits (454), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 137/392 (34%), Positives = 207/392 (52%), Gaps = 46/392 (11%)

Query: 1   MLRRSVY--NRQF-----QRTIGNISKKSN----LTIGLIPGDGIGKEVIPSGRQVLETI 49
           MLR+ ++  +R++     Q +IG  + K N     T+  I GDG+G E+  S + +    
Sbjct: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60

Query: 50  GPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSP 109
                + + + D+       L T   +P   V ++ +N   AL G + +P  K  G+ S 
Sbjct: 61  SVP--VEWEYCDVTPLLVNGLTT---IPEPAVASINKNLV-ALKGPLATPIGK--GHRSL 112

Query: 110 IVALRKELGLYANIRPVKSVDTPGNKK----VDMVIVRENTEDLYIKLEKTYIDEKTGTR 165
            + LRK  GL+AN+RP KS++  G K     VD+V++RENTE  Y  +E           
Sbjct: 113 NLTLRKTFGLFANVRPAKSIE--GYKTTYSDVDLVLIRENTEGEYSGIEHV-----VSPG 165

Query: 166 VADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVF 225
           V  + K I+  A+ R+ + A + A    +  G  ++ V HKS +   +DGLF  V +E+ 
Sbjct: 166 VVQSIKLITREASERVIRYAFEYA----RTVGRPKVVVVHKSTIQRLADGLFVNVAQELG 221

Query: 226 ESNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVA--PNLYGDILSDGAAAL-VGSLGV 282
                 Y DI+   +++D+ V  +  +PE +  +VA  PNLYGDILSD  + L  GSLG+
Sbjct: 222 RE----YPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGL 277

Query: 283 VPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDS 342
            PSAN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A  I+ AV S
Sbjct: 278 TPSANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLS 337

Query: 343 NL---REDKIKTPDLGGKNSTSDVVNDVIRRL 371
            +   RE+  +T DL G  STS   N VI RL
Sbjct: 338 TIASSREN--RTADLAGTASTSSFTNAVIERL 367

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  179 bits (453), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 129/377 (34%), Positives = 196/377 (51%), Gaps = 44/377 (11%)

Query: 12  QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGW 66
           Q +IG  + K N      T+  I GDGIG E+  S +++           F   D+   W
Sbjct: 19  QPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRI-----------FQAADVPVEW 67

Query: 67  QT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           +T      F++    +P   V+++ +N   AL G + +P  K  G+ S  + LRK   L+
Sbjct: 68  ETCDVTPIFVNGLTTIPDPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFNLF 124

Query: 121 ANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVAT 178
           AN+RP KS++      + VD+V++RENTE  Y     + I+      V  + K I+  A+
Sbjct: 125 ANVRPAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHLVSPGVVQSIKLITRDAS 179

Query: 179 RRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYN 238
            R+ + A + A    +  G  +L V HKS +   +DGLF  V KE+       Y DIQ  
Sbjct: 180 ERVIRYAYEYA----RAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAE----YPDIQLE 231

Query: 239 EQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPGIVIG 295
            ++ID+    +   P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  + I 
Sbjct: 232 TELIDNTCLNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIF 291

Query: 296 EPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLR-EDKIKTPDL 354
           E  HGSAPDIAG+  +NP A + S+ +ML  +G ++ A  I+ AV   +    + +T DL
Sbjct: 292 EAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDL 351

Query: 355 GGKNSTSDVVNDVIRRL 371
           GG  ST+   + +I++L
Sbjct: 352 GGSASTTSFTDAIIKKL 368

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  178 bits (451), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 135/396 (34%), Positives = 206/396 (52%), Gaps = 52/396 (13%)

Query: 1   MLRRSVY---NRQF-----QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLE 47
           MLR + +   +R+F     Q +IG  + K N      T+  I GDGIG E+  S +++  
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKI-- 58

Query: 48  TIGPKHGLTFNFIDLQAGWQT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTT 101
                    F+  ++   W++      F++    +P   V+++ +N   AL G + +P  
Sbjct: 59  ---------FSAANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIG 108

Query: 102 KVEGYSSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYID 159
           K  G+ S  + LRK  GL+AN+RP KS++      + VD+V++RENTE  Y  +E     
Sbjct: 109 K--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCP 166

Query: 160 EKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFRE 219
                 V  + K I+  A+ R+ + A + A    +  G  ++ V HKS +   +DGLF  
Sbjct: 167 G-----VVQSIKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVN 217

Query: 220 VCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL- 276
           V KE+ +     Y D+    ++ID+ V ++   P  +   V V PNLYGDILSD  + L 
Sbjct: 218 VAKELSKE----YPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLS 273

Query: 277 VGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDI 336
            GSLG+ PSAN+G  I I E  HGSAPDIAG+  +NP A + S+ +ML  +G +  A  I
Sbjct: 274 AGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQI 333

Query: 337 QTAVDSNLRE-DKIKTPDLGGKNSTSDVVNDVIRRL 371
           Q AV S +    + +T DL G  +TS     VI+RL
Sbjct: 334 QNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  177 bits (450), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 129/385 (33%), Positives = 195/385 (50%), Gaps = 42/385 (10%)

Query: 1   MLRRSVYNR------QFQRTIGNISKK--SNLTIGLIPGDGIGKEVIPSGRQVLETIGPK 52
           ML R++  R      Q +RT+    KK     T+ LIPGDG+GKE+  S R + E     
Sbjct: 1   MLNRTIAKRTLATAAQAERTL---PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAE--- 54

Query: 53  HGLTFNFIDLQAGWQTF---LDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSP 109
                   ++   W+T        K    E V++L+ N  G L G   +P  +  G+ S 
Sbjct: 55  --------NIPIDWETINIKQTDHKEGVYEAVESLKRNKIG-LKGLWHTPADQT-GHGSL 104

Query: 110 IVALRKELGLYANIRPVKSVDTPGNK--KVDMVIVRENTEDLYIKLEKTYIDEKTGTRVA 167
            VALRK+L +YAN+   KS+     +   +D++++RENTE  +  LE   +       V 
Sbjct: 105 NVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESVPG-----VV 159

Query: 168 DATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFES 227
           ++ K ++   T RIA+ A D A    K      +T  HK+N++   DGLFR +  E+ + 
Sbjct: 160 ESLKVMTRPKTERIARFAFDFA----KKYNRKSVTAVHKANIMKLGDGLFRNIITEIGQK 215

Query: 228 NKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSAN 287
               Y DI  +  I+D+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN
Sbjct: 216 E---YPDIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGAN 272

Query: 288 VGPGIVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLRE 346
            G    + EP       DI G+ ++NP A I S+ LML  LG ++ A  I  AV   + E
Sbjct: 273 FGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNEYATRISKAVHETIAE 332

Query: 347 DKIKTPDLGGKNSTSDVVNDVIRRL 371
            K  T D+GG +ST+D  N++I +L
Sbjct: 333 GKHTTRDIGGSSSTTDFTNEIINKL 357

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  177 bits (449), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 137/381 (35%), Positives = 189/381 (49%), Gaps = 33/381 (8%)

Query: 1   MLRRSVYNRQFQRTIGN---ISKK--SNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGL 55
           MLR +V  R F         + KK      + LIPGDG+GKEV  S   + E       +
Sbjct: 1   MLRSAVGKRMFASVAAAEKVLPKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEA--ENLPI 58

Query: 56  TFNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRK 115
            ++ +D+       LD  + +    V +L+ N  G L G   +      G  S  VALRK
Sbjct: 59  DWDRVDISG-----LDHEEGVQA-AVDSLKRNKIG-LKGIWHTSAADQAGKGSLNVALRK 111

Query: 116 ELGLYANIRPVKSVDTPGNK----KVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATK 171
           EL +YAN+   KSV  PG K     VD+V++RENTE  Y  LE   +       V ++ K
Sbjct: 112 ELDIYANVALFKSV--PGVKTKIPNVDLVVIRENTEGEYSGLEHESV-----PGVVESLK 164

Query: 172 RISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTL 231
            ++E  T RIA+ A D A    K      +T  HK+N++   DGLFR V   V E     
Sbjct: 165 IMTEDKTERIARFAFDFA----KKYNRHAVTAVHKANIMKLGDGLFRNVVTRVGEQE--- 217

Query: 232 YSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG 291
           Y D++    I+D+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G  
Sbjct: 218 YPDVKVGSIIVDNASMQTVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYGRE 277

Query: 292 IVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIK 350
             + EP       DI  K I+NP A I S +LML+ LG S +A  I  AV   + E K  
Sbjct: 278 YAVFEPGSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIAEGKST 337

Query: 351 TPDLGGKNSTSDVVNDVIRRL 371
           TPD+GG  ST++    VI +L
Sbjct: 338 TPDIGGSASTTEFTQAVIEKL 358

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  177 bits (449), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 133/386 (34%), Positives = 195/386 (50%), Gaps = 44/386 (11%)

Query: 1   MLRRSVYNRQFQRTIGNISKKSNL---------TIGLIPGDGIGKEVIPSGRQVLETIGP 51
           MLR+ V     +R+I + +K  N+         T+ LIPGDGIGKEV  S  ++  + G 
Sbjct: 1   MLRQVVS----KRSIASFTKNHNIVPKKYGGRYTVTLIPGDGIGKEVTDSVVKIFASQG- 55

Query: 52  KHGLTFNFIDLQAGWQTFLDTGKALPVE---TVKTLRENCDGALFGAVQSPTTKVEGYSS 108
                     L   W+     G +   E    V++L+ N  G     +   +    GY S
Sbjct: 56  ----------LPIDWERIDVPGMSNENEVKKAVESLKRNKIG--LKGIWHTSADQTGYGS 103

Query: 109 PIVALRKELGLYANIRPVKSVDTPGNK--KVDMVIVRENTEDLYIKLEKTYIDEKTGTRV 166
             VALRK+L ++AN+   KS+     K   VD+V++RENTE  Y  LE   +       V
Sbjct: 104 LNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLVVIRENTEGEYSGLEHESV-----PGV 158

Query: 167 ADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFE 226
            ++ K I++  T RIA+ A D AL+    N    +T  HK+N++  SDGLF+    EV E
Sbjct: 159 VESLKIITKPKTERIARFAFDFALE----NNRSTVTAVHKANIMKLSDGLFKNTVAEVGE 214

Query: 227 SNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSA 286
                Y DI+ N  I+D+   +   +P  FDV+V P++YG IL +  AAL+G  G++P A
Sbjct: 215 KE---YPDIKVNTIIVDNASMQAVAKPHQFDVMVTPSMYGTILGNIGAALIGGPGLIPGA 271

Query: 287 NVGPGIVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLR 345
           N G    + EP       DI  + I+NP A I S  LML  LG  + ++ I  AV + + 
Sbjct: 272 NYGREHAVFEPGSRHVGLDIENQNIANPTAMILSATLMLNQLGLREESKRISNAVYAVIE 331

Query: 346 EDKIKTPDLGGKNSTSDVVNDVIRRL 371
           E K  T D+GG  ST++  + VI +L
Sbjct: 332 EGKTTTKDIGGNASTTEFTDAVIDKL 357

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 129/352 (36%), Positives = 184/352 (52%), Gaps = 28/352 (7%)

Query: 25  TIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKTL 84
           T+ LIPGDGIGKEV  S  Q+ E       + +  ++L A  +      KA     V++L
Sbjct: 31  TVTLIPGDGIGKEVTDSVVQIFEA--ENVPVDWESVELSALEENHEGVQKA-----VESL 83

Query: 85  RENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPGNKK----VDMV 140
           + N  G L G   +P  +  G+ S  VA RK+L ++AN+   KS   PG K     VD+V
Sbjct: 84  KRNKVG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKSF--PGVKTKLQDVDLV 139

Query: 141 IVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQ 200
           I+RENTE  Y  LE   +       V ++ K +++  + RIA+ A D AL   KNN    
Sbjct: 140 IIRENTEGEYSGLEHESV-----PGVVESLKIMTKAKSERIARFAFDFAL---KNNRKAV 191

Query: 201 LTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIV 260
             V HK+N++   DGLFR    E+       Y ++  +  I+D+   +   +P  FDV+V
Sbjct: 192 CAV-HKANIMKLGDGLFRNTVSEIGAKE---YPEVNVSSIIVDNASMQAVAKPHQFDVLV 247

Query: 261 APNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEP-CHGSAPDIAGKGISNPIATIRS 319
            PNLYG IL +  AAL+G  G+VP AN G    + EP C     DI G+ ++NP A I S
Sbjct: 248 TPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDIKGQDVANPTAMILS 307

Query: 320 TALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371
           + LML  LG ++ A  I  A    + E K  T D+GG  +T++  N VI +L
Sbjct: 308 STLMLRHLGLNEYADRISRATYETIAEGKRTTKDIGGTATTTEFTNAVIDKL 359

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  176 bits (445), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 134/386 (34%), Positives = 199/386 (51%), Gaps = 50/386 (12%)

Query: 4   RSVYNRQFQRTIGNISKKSN----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNF 59
           RS+ N   Q TIG  + K+N     T+  I GDG+G E+  S + +           F+ 
Sbjct: 23  RSISN---QPTIGRFTGKTNSSGTYTVPFIEGDGVGPEISKSVKDI-----------FSA 68

Query: 60  IDLQAGWQ------TFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVAL 113
            ++   WQ       F++    +P   VK ++E+   AL G + +P  K  G+ S  + L
Sbjct: 69  ANVPIQWQPCDVGPIFVNGLTTIPEPAVKAIKESLV-ALKGPLATPVGK--GHRSLNLTL 125

Query: 114 RKELGLYANIRPVKSVDTPGNKK----VDMVIVRENTEDLYIKLEKTYIDEKTGTRVADA 169
           RK   L+AN+RP KSV  P  K     VD+V++RENTE  Y  +E           V  +
Sbjct: 126 RKTFDLFANVRPAKSV--PNYKSTYENVDLVLIRENTEGEYSGIEHIVTP-----GVVQS 178

Query: 170 TKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNK 229
            K I+  A+ ++ + A + A+      G  +L V HKS +    DGLF ++  E+    +
Sbjct: 179 IKLITREASEKVIRYAYEYAIAV----GRPRLIVVHKSTIQRLGDGLFVQIANEL----Q 230

Query: 230 TLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSA 286
           + Y  I+   QI+D+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PSA
Sbjct: 231 SEYPSIKLETQILDNTVLNVVSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSA 290

Query: 287 NVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLRE 346
           N+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A  I+ AV S +  
Sbjct: 291 NIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIAS 350

Query: 347 -DKIKTPDLGGKNSTSDVVNDVIRRL 371
             + +T DLGG  +TS     VI++L
Sbjct: 351 GPESRTGDLGGSATTSSFTECVIKKL 376

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  174 bits (441), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 120/351 (34%), Positives = 186/351 (52%), Gaps = 25/351 (7%)

Query: 24  LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKT 83
            T+ LIPGDG+GKE+  S + + E    K  + +  ++++   QT    G     E V++
Sbjct: 29  FTVTLIPGDGVGKEITDSVKTIFE--AEKIPVDWETVNIK---QTDHKEG---VYEAVES 80

Query: 84  LRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPGNK--KVDMVI 141
           L+ N  G L G   +P  +  G+ S  VALRK+L +YAN+   KS+     +   +D+++
Sbjct: 81  LKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 142 VRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQL 201
           +RENTE  +  LE   +       V ++ K ++   T RIA+ A D A    K      +
Sbjct: 139 IRENTEGEFSGLEHESV-----PGVVESLKIMTRPKTERIARFAFDFA----KKYNRKAV 189

Query: 202 TVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVA 261
           T  HK+N++   DGLFR +  E+ +     Y DI  +  I+D+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEIGQKE---YPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEP-CHGSAPDIAGKGISNPIATIRST 320
           P++YG IL +  AAL+G  G+V  AN G    + EP       DI G+ ++NP A I S+
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSS 306

Query: 321 ALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371
            LML  LG ++ A  I  AV   + E K  T D+GG +ST+D  N++I +L
Sbjct: 307 VLMLNHLGLNEYATRISKAVHETIAEGKHTTKDIGGSSSTTDFTNEIINKL 357

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  173 bits (439), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 129/384 (33%), Positives = 196/384 (51%), Gaps = 41/384 (10%)

Query: 1   MLRRSVYNRQF----QRTIGNISKK--SNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHG 54
           M + SV  R      + TI  I KK     T+ L+PGDG+GKE+  S   +         
Sbjct: 1   MFKHSVTKRSLVTLAKETI--IPKKYGGRFTVTLLPGDGVGKEITDSVVSI--------- 49

Query: 55  LTFNFIDLQAGWQTF----LDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPI 110
             F   ++   W+T     LD  + +    V +L+ N  G L G   +P  +V G+ S  
Sbjct: 50  --FKSENVPIDWETVDISGLDHTEGVKA-AVDSLKRNKIG-LKGIWHTPADQV-GHGSLN 104

Query: 111 VALRKELGLYANIRPVKSVDTPGNK--KVDMVIVRENTEDLYIKLEKTYIDEKTGTRVAD 168
           VA RK+L +YAN+   KS++    K   VD+V++RENTE  Y  LE   +       V +
Sbjct: 105 VAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVVIRENTEGEYSGLEHESV-----PGVVE 159

Query: 169 ATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN 228
           + K I++  + RIA+ A D A    K N    +T  HK+N++  SDGLFR    ++ E  
Sbjct: 160 SLKIITKSKSERIARFAFDFA----KRNNRKSVTAVHKANIMKLSDGLFRNTVSKIGEEE 215

Query: 229 KTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANV 288
              Y +IQ +  I+D+   +   +P  FDV+V P++YG I+ +  AAL+G  G+VP  N 
Sbjct: 216 ---YPEIQTSSIIVDNASMQAVAKPHQFDVMVTPSMYGTIVGNIGAALIGGPGLVPGVNY 272

Query: 289 GPGIVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLRED 347
           G    + EP       DI G+ ++NP A + S  L+L+ LG  ++A  I++AV   + E 
Sbjct: 273 GRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSATLLLDHLGLEKSANRIKSAVYDVIAEG 332

Query: 348 KIKTPDLGGKNSTSDVVNDVIRRL 371
           K  T D+GG  ST++    VI +L
Sbjct: 333 KATTQDIGGSASTTEFTQAVINKL 356

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  173 bits (439), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 136/391 (34%), Positives = 202/391 (51%), Gaps = 43/391 (10%)

Query: 1   MLRRSVYNRQF-------QRTIGNISKKSNLTIG-----LIPGDGIGKEVIPSGRQVLET 48
           +LR S   R+F       Q +IG  + K N   G      I GDGIG E+  S + + + 
Sbjct: 6   LLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFK- 64

Query: 49  IGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSS 108
              +  + + F D+      F++    +P   V ++ +N   AL G + +P  K  G+ S
Sbjct: 65  -AAEVPINWEFCDVT---PIFVNGLTTIPDPAVASINKNLI-ALKGPLATPIGK--GHRS 117

Query: 109 PIVALRKELGLYANIRPVKSVDTPGNKK----VDMVIVRENTEDLYIKLEKTYIDEKTGT 164
             + LRK   L+AN+RP KS++  G K     VD+V++RENTE  Y     + I+     
Sbjct: 118 LNLTLRKTFNLFANVRPAKSIE--GFKTTYSDVDLVLIRENTEGEY-----SGIEHVVAP 170

Query: 165 RVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEV 224
            V  + K I+  A+ R+ + A + A    K  G  ++ V HKS +   +DGLF  V KE+
Sbjct: 171 GVVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVVVHKSTIQRLADGLFVNVAKEL 226

Query: 225 FESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLG 281
            +     Y +I+   ++ID+ V  +   P  +   V V PNLYGDILSD  + L  GSLG
Sbjct: 227 SKE----YPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLG 282

Query: 282 VVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVD 341
           + PSAN+G  I I E  HGSAPDIAG+  +NP A + S+ +ML  +G    A  I+ AV 
Sbjct: 283 LTPSANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVL 342

Query: 342 SNL-REDKIKTPDLGGKNSTSDVVNDVIRRL 371
           + +    K +T DLGG  +TS   + VI+ L
Sbjct: 343 TTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  172 bits (437), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 125/352 (35%), Positives = 184/352 (52%), Gaps = 29/352 (8%)

Query: 25  TIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKTL 84
           T+ LIPGDG+GKEV  S  ++ E       + +  ID+ +G +   +  +A     V++L
Sbjct: 31  TVTLIPGDGVGKEVTDSVVKIFEN--ENIPIDWETIDI-SGLENTENVQRA-----VESL 82

Query: 85  RENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPGNK----KVDMV 140
           + N  G L G   +P  +  G+ S  VALRK+L ++AN+   KS+  PG K     +DMV
Sbjct: 83  KRNKVG-LKGIWHTPADQT-GHGSLNVALRKQLDIFANVALFKSI--PGVKTRLNNIDMV 138

Query: 141 IVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQ 200
           I+RENTE  Y  LE   +       V ++ K ++   + RIA+ A D AL+    N    
Sbjct: 139 IIRENTEGEYSGLEHESV-----PGVVESLKIMTRAKSERIARFAFDFALK----NNRKS 189

Query: 201 LTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIV 260
           +   HK+N++   DGLFR    E+  +    Y ++     I+D+   +   +P  FDV+V
Sbjct: 190 VCAVHKANIMKLGDGLFRNTVNEIGANE---YPELDVKNIIVDNASMQAVAKPHQFDVLV 246

Query: 261 APNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEP-CHGSAPDIAGKGISNPIATIRS 319
            PNLYG IL +  +AL+G  G+VP AN G    + EP       DI G+ ++NP A I S
Sbjct: 247 TPNLYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILS 306

Query: 320 TALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371
           + LML  LG +  A  I  A    + E K  T D+GG  STS+  N VI +L
Sbjct: 307 STLMLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEFTNAVIEKL 358

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  172 bits (436), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 128/355 (36%), Positives = 181/355 (50%), Gaps = 35/355 (9%)

Query: 25  TIGLIPGDGIGKEVIPSGRQVLETIG-PKHGLTFNF--IDLQAGWQTFLDTGKALPVETV 81
           T+ LIPGDG+GKEV  S   + E    P    T N   +D + G Q           + V
Sbjct: 31  TVTLIPGDGVGKEVTDSVVSIFEAENVPIDWETINITGVDSEEGVQ-----------KAV 79

Query: 82  KTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPGNK----KV 137
           ++L+ N  G L G   +P  +  G+ S  VA RK+L ++AN+   K+V  PG K     +
Sbjct: 80  ESLKRNKIG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKNV--PGVKTKLSNI 135

Query: 138 DMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNG 197
           D+V++RENTE  Y  LE   +       V ++ K I++  + RIA+ A D AL+    N 
Sbjct: 136 DLVVIRENTEGEYSGLEHESV-----PGVVESLKIITKAKSERIARFAFDFALK----NN 186

Query: 198 NVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFD 257
              +   HK+N++   DGLFR    EV  S    Y +I     I+D+   +   +P  FD
Sbjct: 187 RKSVCAVHKANIMKLGDGLFRNTVNEVGASE---YPEIDVKNIIVDNASMQAVAKPHQFD 243

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEP-CHGSAPDIAGKGISNPIAT 316
           V+V PNLYG IL +  AAL+G  G+VP AN G    + EP       DI GK ++NP A 
Sbjct: 244 VLVTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGKDLANPTAM 303

Query: 317 IRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371
           I S+ LML  LG +  A  I  A    + E K  T D+GG +ST++    VI +L
Sbjct: 304 ILSSTLMLRHLGLNGYADRISKATYDVIAEGKHTTKDIGGSSSTTEFTKSVIDKL 358

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  172 bits (435), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 131/397 (32%), Positives = 199/397 (50%), Gaps = 55/397 (13%)

Query: 1   MLRRSVYNRQFQR-------TIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLET 48
           MLR ++Y   F R        IG  + K N      T+  I GDG+G E+  S + +   
Sbjct: 1   MLRNTIYRGSFARMMTTGQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDI--- 57

Query: 49  IGPKHGLTFNFIDLQAGWQ------TFLDTGKALPVETVKTLRENCDGALFGAVQSPTTK 102
                   F    +   W+       F++    +P   V+++ ++   AL G + +P  K
Sbjct: 58  --------FAAAKVPIEWEPCDVGPIFVNGLTTIPDAAVQSINKHLV-ALKGPLATPIGK 108

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDTPGNK----KVDMVIVRENTEDLYIKLEKTYI 158
             G+ S  + LRK   L+AN+RP +SV  P  K     VD+V++RENTE  Y  +E    
Sbjct: 109 --GHRSLNLTLRKTFNLFANVRPARSV--PNYKTTYQNVDLVLIRENTEGEYSGIEHV-- 162

Query: 159 DEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFR 218
                  V  + K I++ A+ R+ + A +      +  G  +L V HKS +   +DGLF 
Sbjct: 163 ---ISPGVIQSIKLITKDASERVIRYAFEYT----RAIGRPRLVVVHKSTIQRMADGLFV 215

Query: 219 EVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL 276
            V KE+     + Y DI+   ++ID+ +  +   PE +   V V PNLYGDILSD  + L
Sbjct: 216 NVAKEL----ASEYPDIELQTELIDNTILNVVTHPESYTDAVSVCPNLYGDILSDLNSGL 271

Query: 277 -VGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQD 335
             GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G ++ A  
Sbjct: 272 SAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNEHATK 331

Query: 336 IQTAVDSNLRE-DKIKTPDLGGKNSTSDVVNDVIRRL 371
           I+ A+ S +    + +T DL G  +TS     VI +L
Sbjct: 332 IENAILSTIASGSENRTGDLAGTATTSSFTEAVINKL 368

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  171 bits (434), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 127/373 (34%), Positives = 195/373 (52%), Gaps = 36/373 (9%)

Query: 12  QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGW 66
           Q +IG  + K +      T+  I GDG+G E+  + + +      K  + +   D+    
Sbjct: 19  QPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWESCDVSP-- 74

Query: 67  QTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPV 126
             F++    +P     ++ +N   AL G + +P  K  G+ S  + LRK  GL+AN+RP 
Sbjct: 75  -LFINGLTTIPQPAQDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPA 130

Query: 127 KSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKI 184
           KSV         VD+V++RENTE  Y  +E           V  + K I++ A+ R+ + 
Sbjct: 131 KSVQGYKTAYDNVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITQDASERVIRY 185

Query: 185 ALDIA--LQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQII 242
           A + A  ++R K      + V HKS +   +DGLF  V +++ +     Y DI+   ++I
Sbjct: 186 AFEYARAVERPK------VVVVHKSTIQRLADGLFVSVAEQLSKE----YPDIELQTELI 235

Query: 243 DSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPGIVIGEPCH 299
           D+ V    R+P  +   V+V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  H
Sbjct: 236 DNTVLHTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVH 295

Query: 300 GSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLRE-DKIKTPDLGGKN 358
           GSAPDIAG+  +NP A + S+ +ML  +G ++ A  I+ AV + +    + +T DLGG  
Sbjct: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSA 355

Query: 359 STSDVVNDVIRRL 371
           STS     VI RL
Sbjct: 356 STSSFAEAVISRL 368

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  171 bits (434), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 126/373 (33%), Positives = 195/373 (52%), Gaps = 36/373 (9%)

Query: 12  QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGW 66
           Q +IG  + K +      T+  I GDG+G E+  S +++         +   ++    G 
Sbjct: 19  QPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKIFSAAK----VPIEWVPCDVG- 73

Query: 67  QTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPV 126
             F++    +P   V+ + ++   AL G + +P  K  G+ S  + LRK   L+AN+RP 
Sbjct: 74  PIFVNGQTTIPEPAVELINKHLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPA 130

Query: 127 KSVDTPGNKK----VDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIA 182
           +S+  P  K     VD+V++RENTE  Y  +E           V  + K I+  AT R+ 
Sbjct: 131 RSI--PNYKSTYENVDLVLIRENTEGEYSGIEHVITP-----GVIQSIKLITREATERVV 183

Query: 183 KIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQII 242
           + A +      +  G  +L V HKS +   +DGLF +V +E+     + Y DI+   +II
Sbjct: 184 RYAFEYT----QAIGRPRLLVIHKSTIQRMADGLFVKVAEEL----ASEYPDIKLETEII 235

Query: 243 DSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPGIVIGEPCH 299
           D  +  +  +PE +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  H
Sbjct: 236 DKSILNVVSKPELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVH 295

Query: 300 GSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLRE-DKIKTPDLGGKN 358
           GSAPDIAG+  +NP A + S+ +ML+ +G  + A  I+ AV + +    + +T DL G  
Sbjct: 296 GSAPDIAGQNKANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTA 355

Query: 359 STSDVVNDVIRRL 371
           STS    +VI+RL
Sbjct: 356 STSSFTEEVIQRL 368

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  171 bits (433), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 123/356 (34%), Positives = 183/356 (51%), Gaps = 37/356 (10%)

Query: 25  TIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTF----LDTGKALPVET 80
           T+ LIPGDG+GKEV  S   + E+            ++   W+T     LD  + +  + 
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSIFESE-----------NVPIDWETVEISGLDNEEGVQ-KA 77

Query: 81  VKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPG----NKK 136
           V +L+ N  G L G   +P+ +  G+ S  VALRK+L ++AN+   K+V  PG    +  
Sbjct: 78  VDSLKRNKVG-LKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKTV--PGVPSRHSN 133

Query: 137 VDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNN 196
           VD+V++RENTE  Y  LE   +       V ++ K +++  + RI + A D AL+    N
Sbjct: 134 VDLVVIRENTEGEYSGLEHESV-----PGVVESLKIMTKAKSDRIGRFAFDFALK----N 184

Query: 197 GNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECF 256
               +   HK+N++   DGLFR    E+       Y +I+    I+D+   +   +P  F
Sbjct: 185 NRKSVCAVHKANIMKLGDGLFRNCINEIGAKE---YPEIEVKNIIVDNASMQAVAKPHQF 241

Query: 257 DVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEP-CHGSAPDIAGKGISNPIA 315
           DV+V PNLYG IL +  AAL+G  G+VP AN G    + EP       DI G+ ++NP A
Sbjct: 242 DVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTA 301

Query: 316 TIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371
            I S+ALML  LG +  A  I  A    + E K  T D+GG  ST+D    +I +L
Sbjct: 302 MILSSALMLRHLGLNSYADRISKATYDVIAEAKNTTKDIGGSASTTDFTQAIIEKL 357

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  171 bits (433), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 123/356 (34%), Positives = 186/356 (52%), Gaps = 37/356 (10%)

Query: 25  TIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQ----TFLDTGKALPVET 80
           T+ LIPGDG+GKEV  S   +           FN  +L   W+    + LD  + +    
Sbjct: 35  TVTLIPGDGVGKEVTDSVVSI-----------FNAENLPIDWERVDISGLDHEEGVEA-A 82

Query: 81  VKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPGNKK---- 136
           V +L+ N  G     +   +     + S  VALRK+L +YAN+   K++  PG K     
Sbjct: 83  VNSLKRNKIG--LKGIWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTL--PGVKTRIPD 138

Query: 137 VDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNN 196
           VD+VI+RENTE  Y  LE   +       V ++ K I++  + RIA+ A D A    K  
Sbjct: 139 VDLVIIRENTEGEYSGLEHESV-----PGVVESLKIITKEKSERIARFAFDFA----KRF 189

Query: 197 GNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECF 256
               +T  HK+N++   DGLFR     + E   T Y DI+ +  I+D+   +   +P  F
Sbjct: 190 DRKLVTAVHKANIMKLGDGLFRNSVTSIGE---TEYPDIKVSSIIVDNASMQSVAKPHQF 246

Query: 257 DVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEP-CHGSAPDIAGKGISNPIA 315
           DV+V P++YG IL +  AAL+G  G+VP AN G    + EP       DI G+ ++NP A
Sbjct: 247 DVLVTPSMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTA 306

Query: 316 TIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371
            I S+ L+L+ LG +  A+ I+ AV   + E K+ T D+GG  ST++  N++I++L
Sbjct: 307 MILSSTLLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  171 bits (432), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 123/356 (34%), Positives = 183/356 (51%), Gaps = 37/356 (10%)

Query: 25  TIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTF----LDTGKALPVET 80
           T+ LIPGDG+GKEV  S   + E+            ++   W+T     LD  + +  + 
Sbjct: 31  TVTLIPGDGVGKEVTDSVVSIFESE-----------NIPIDWETVEISGLDNQEGVQ-KA 78

Query: 81  VKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPG----NKK 136
           V++L+ N  G L G   +P+ +  G+ S  VALRK+L ++AN+   KSV  PG    +  
Sbjct: 79  VESLKRNKVG-LKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKSV--PGVPSRHSN 134

Query: 137 VDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNN 196
           VDMV++RENTE  Y  LE   +       V ++ K +++  + RI + A D A++    N
Sbjct: 135 VDMVVIRENTEGEYSGLEHESV-----PGVVESLKIMTKAKSERIGRFAFDFAVK----N 185

Query: 197 GNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECF 256
               +   HK+N++   DGLFR    EV       Y +I     I+D+   +   +P  F
Sbjct: 186 NRKSVCAVHKANIMKLGDGLFRNCINEVGAKE---YPEIDVKNIIVDNASMQAVAKPHQF 242

Query: 257 DVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEP-CHGSAPDIAGKGISNPIA 315
           DV+V PNLYG IL +  AAL+G  G+VP AN G    + EP       DI G+ ++NP A
Sbjct: 243 DVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTA 302

Query: 316 TIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371
            I S++LML  LG +  A  I  A    + E K  T D+GG  ST++    +I +L
Sbjct: 303 MILSSSLMLRHLGLNAYADRISKATYDVIAEAKTTTQDIGGSASTTEFTEAIISKL 358

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  171 bits (432), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 132/379 (34%), Positives = 192/379 (50%), Gaps = 46/379 (12%)

Query: 12  QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGW 66
           Q +IG  + K +      T+  I GDGIG E+  S + +           F    +   W
Sbjct: 27  QPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDI-----------FQAASVPITW 75

Query: 67  QT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           +T       +D    +P E VK++ +N  G L G + +P  K  G+ S  + LRK   L+
Sbjct: 76  ETCDVSPILVDGLTTIPDEAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLF 132

Query: 121 ANIRPVKSVDTPGNK----KVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEV 176
           AN+RP KSV   G K     VD+V++RENTE  Y  +E           V  + K I+  
Sbjct: 133 ANVRPAKSVR--GFKTTYDNVDLVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITRD 185

Query: 177 ATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQ 236
           A+ R+ + A + A    K  G  ++ V HKS +   SDGLF  V KE+ +     + +I+
Sbjct: 186 ASERVIRYAFEYA----KAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKN--FQNIE 239

Query: 237 YNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPGIV 293
            + ++ID+ V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PSAN+G  I 
Sbjct: 240 LDTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKIS 299

Query: 294 IGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNL-REDKIKTP 352
           I E  HGSAPDIAG+  +NP A + S+ +ML  +G ++    I+ AV   +    K +T 
Sbjct: 300 IFEAVHGSAPDIAGQNKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTG 359

Query: 353 DLGGKNSTSDVVNDVIRRL 371
           DLGG  +T+     VI  L
Sbjct: 360 DLGGTATTTSFTEAVIDNL 378

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  169 bits (429), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 134/385 (34%), Positives = 201/385 (52%), Gaps = 40/385 (10%)

Query: 3   RRSVYNRQF---QRTIGNIS-----KKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHG 54
           RR+V  R F   Q +IG  +     K  N  +  I GDGIG E+  S + +      K  
Sbjct: 8   RRAVA-RMFSSKQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIFA--AAKVP 64

Query: 55  LTFNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALR 114
           + F  + ++      ++   ++P E  K++  N   AL G + +P  K  G+ S  + LR
Sbjct: 65  VDFESVVVKP---ILVNGVTSIPEEAQKSINTNLV-ALKGPLATPVGK--GHRSMNLTLR 118

Query: 115 KELGLYANIRPVKSVDTPGNK----KVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADAT 170
           K  GL+AN+RP KSV+  G K     V++V++RENTE  Y  +E   +       V  + 
Sbjct: 119 KTFGLFANLRPAKSVE--GFKTIYDNVNLVLIRENTEGEYAGIEHAIVP-----GVVQSI 171

Query: 171 KRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKT 230
           K I+  A+ R+ + A + A    +     +L V HKS +   SDGLF +V KE+    ++
Sbjct: 172 KLITREASERVIRFAYEYA----RAAERPRLIVVHKSTIQRLSDGLFVDVAKEL----QS 223

Query: 231 LYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSAN 287
            + DI+   ++ID+ V     +P  +   V V PNLYGDILSD  + L  GSLG+ PS N
Sbjct: 224 EFPDIKLETELIDNAVLNTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTPSGN 283

Query: 288 VGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLRE- 346
           +G  + I E  HGSAPDIAGK  +NP A + S+ +ML  +G  + A  I+ AV + +   
Sbjct: 284 IGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTIAAG 343

Query: 347 DKIKTPDLGGKNSTSDVVNDVIRRL 371
            + +T DL G  STS     VI++L
Sbjct: 344 PESRTGDLKGSASTSSFTEAVIKKL 368

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  169 bits (429), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 128/398 (32%), Positives = 193/398 (48%), Gaps = 54/398 (13%)

Query: 1   MLRRSVYNRQFQRTIGNISKKS---------------NLTIGLIPGDGIGKEVIPSGRQV 45
           MLR  +  R   R + + + K                  T+  I GDG+G E+  S + +
Sbjct: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60

Query: 46  LETIGPKHGLTFNFIDLQAGWQT------FLDTGKALPVETVKTLRENCDGALFGAVQSP 99
                      F    +   W++       ++    +P +  +++  N   AL G + +P
Sbjct: 61  -----------FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLV-ALKGPLATP 108

Query: 100 TTKVEGYSSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTY 157
             K  G+ S  + LRK  GL+AN+RP KSV+      + VD+V++RENTE  Y  +E   
Sbjct: 109 IGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVI 166

Query: 158 IDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLF 217
           +       V  + K I+  A+ R+ + A + A    +  G  +L V HKS +   +DGLF
Sbjct: 167 VPG-----VVQSIKLITREASERVIRYAYEYA----RAVGRPKLVVVHKSTIQRLADGLF 217

Query: 218 REVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAA 275
             V KE+       + DIQ   ++ID+ V  +   P  +   V V PNLYGDILSD  + 
Sbjct: 218 VTVAKELAHE----FPDIQLQTELIDNTVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSG 273

Query: 276 L-VGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQ 334
           L  GSLG+ PS N+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A 
Sbjct: 274 LSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHAS 333

Query: 335 DIQTAVDSNLRE-DKIKTPDLGGKNSTSDVVNDVIRRL 371
            I+ AV + +    + +T DL G  STS     VI RL
Sbjct: 334 KIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  168 bits (425), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 127/385 (32%), Positives = 194/385 (50%), Gaps = 43/385 (11%)

Query: 1   MLRRSVYNRQF-----QRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGL 55
           M R+++  R       + TI        +T+ L+PGDG+GKE+  S   +          
Sbjct: 1   MFRQTIAKRTLATFIPKETILPKKYGGRMTVTLLPGDGVGKEITDSVVSI---------- 50

Query: 56  TFNFIDLQAGWQTF----LDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIV 111
            F   ++   W+T     LD    +    V++L+ N  G L G   +   +V G+ S  V
Sbjct: 51  -FQAENVPIDWETVDISQLDHEDGVNA-AVESLKRNKIG-LKGIWHTSADQV-GHGSLNV 106

Query: 112 ALRKELGLYANIRPVKSVDTPGNK----KVDMVIVRENTEDLYIKLEKTYIDEKTGTRVA 167
           A RK+L +YAN+   KS+  PG K     VD+VI+RENTE  Y  LE   +       V 
Sbjct: 107 AFRKQLDIYANVAFCKSI--PGVKTKIPNVDLVIIRENTEGEYSGLEHESV-----PGVV 159

Query: 168 DATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFES 227
           ++ K +++V + RIAK A D A++  +      +T  HK+N++  SDGLFR     V E+
Sbjct: 160 ESLKIVTKVNSERIAKFAFDFAMRHDRK----MVTAVHKANIMKLSDGLFRNTVARVGEA 215

Query: 228 NKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSAN 287
               Y  I+ +  I+D+   +   +P  FDV+V P++YG IL +  AAL+G  G+VP  N
Sbjct: 216 ----YPQIKNDSIIVDNASMQAVAKPHQFDVMVTPSMYGTILGNIGAALIGGPGLVPGVN 271

Query: 288 VGPGIVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLRE 346
            G    + EP       DI G+ ++NP A I S+ L+L+ LG +  A  I  AV   ++E
Sbjct: 272 YGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLLLQHLGLNDTASRISKAVYDVIKE 331

Query: 347 DKIKTPDLGGKNSTSDVVNDVIRRL 371
               T D+GG  ST++    VI +L
Sbjct: 332 GNATTKDIGGNASTTEFTKAVIDKL 356

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  168 bits (425), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 127/379 (33%), Positives = 193/379 (50%), Gaps = 48/379 (12%)

Query: 12  QRTIGNISKKSN-----LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGW 66
           Q +IG  + K +      T+  I GDG+G E+  + + +           F        W
Sbjct: 19  QPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDI-----------FAAAKAPIQW 67

Query: 67  QT------FLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120
           +T      F++    +P     ++ +N   AL G + +P  K  G+ S  + LRK  GL+
Sbjct: 68  ETCDVTPLFINGLTTIPQPAQDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLF 124

Query: 121 ANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVAT 178
           AN+RP KS+         VD+V++RENTE  Y  +E           V  + K I++ A+
Sbjct: 125 ANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHV-----VAPGVVQSIKLITQDAS 179

Query: 179 RRIAKIALDIA--LQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQ 236
            R+ + A + A  ++R K      + V HKS +   +DGLF  V +++ +     Y DI+
Sbjct: 180 ERVIRYAFEYARAVERPK------VLVVHKSTIQRLADGLFVSVAEKLAKE----YPDIE 229

Query: 237 YNEQIIDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPGIV 293
              ++ID+ V    R+P  +   V+V PNLYGDILSD  + L  GSLG+ PSAN+G  + 
Sbjct: 230 LQTELIDNTVLHTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVS 289

Query: 294 IGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLRE-DKIKTP 352
           I E  HGSAPDIAG+  +NP A + S+ +ML  +G ++ A  I+ AV S +    + +T 
Sbjct: 290 IFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTG 349

Query: 353 DLGGKNSTSDVVNDVIRRL 371
           DL G  STS     VI RL
Sbjct: 350 DLAGSASTSSFAEAVISRL 368

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  167 bits (424), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 128/386 (33%), Positives = 190/386 (49%), Gaps = 42/386 (10%)

Query: 1   MLRRS---VYNRQFQRTIGNISKKS---NLTIGLIPGDGIGKEVIPSGRQVLETIGPKHG 54
           MLR +   +  R+F    G +  K      T+ LIPGDG+GKEV  S   + E       
Sbjct: 1   MLRNTFVQISKRRFALASGQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVNIFEAE----- 55

Query: 55  LTFNFIDLQAGWQTFLDTGKALPVE----TVKTLRENCDGALFGAVQSPTTKVEGYSSPI 110
                 ++   W++   +G    +E     V++L+ N  G L G   +P  +  G+ S  
Sbjct: 56  ------NVPIDWESVELSGLEENMEGVQKAVESLKRNKVG-LKGIWSTPADQT-GHGSLN 107

Query: 111 VALRKELGLYANIRPVKSVDTPGNKK----VDMVIVRENTEDLYIKLEKTYIDEKTGTRV 166
           VA RK+L ++AN+   KS   PG K     VD+VI+RENTE  Y  LE   +       V
Sbjct: 108 VAFRKQLDIFANVALFKSF--PGVKTKLKDVDLVIIRENTEGEYSGLEHESV-----PGV 160

Query: 167 ADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFE 226
            ++ K +++  + RIA+ A D AL+    N    +   HK+N++   DGLFR    E+  
Sbjct: 161 VESLKIMTKAKSERIARFAFDFALK----NNRRSVCAVHKANIMKLGDGLFRNTVNEIGA 216

Query: 227 SNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSA 286
                Y +++    I+D+   +   +P  FDV+V PNLYG IL +  AAL+GS G+VP A
Sbjct: 217 KE---YPELEVKSIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNVGAALIGSPGLVPGA 273

Query: 287 NVGPGIVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLR 345
           N G    + EP       DI G+ ++NP A I S+ LML  LG +  A  I  A    + 
Sbjct: 274 NFGREYAVFEPGSRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIA 333

Query: 346 EDKIKTPDLGGKNSTSDVVNDVIRRL 371
           E K  T D+GG  ST+     ++ +L
Sbjct: 334 EGKHTTKDIGGHASTTQFTKAIVDKL 359

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  166 bits (419), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 127/388 (32%), Positives = 190/388 (48%), Gaps = 49/388 (12%)

Query: 1   MLRRSVYNRQFQRTIGNISKKSNL---------TIGLIPGDGIGKEVIPSGRQVLETIGP 51
           M R  +  R F     +I+ + N+         T+ L+PGDG+G+E+  S   + E    
Sbjct: 1   MFRNLISKRAFT----SIASRENIIPKKYGGRYTVTLLPGDGVGREITDSVVSIFEAE-- 54

Query: 52  KHGLTFNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFG--AVQSPTTKVEGYSSP 109
                    +L   W+    +G  L  E V T  E+      G   +   +   +G++S 
Sbjct: 55  ---------NLPIDWERVELSG--LEQEDVHTAVESLKRNKIGLKGIWHTSADHDGHTSW 103

Query: 110 IVALRKELGLYANI---RPVKSVDT--PGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGT 164
            VALRKEL +YAN+   +  K VDT  P    VD+VI+RENTE  Y  LE   +      
Sbjct: 104 NVALRKELDIYANVAIFKSFKGVDTRIP---DVDLVIIRENTEGEYSGLEHESV-----P 155

Query: 165 RVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEV 224
            V ++ K ++   T RIA+ A D A++  + +    +T  HK+N++   DGLFR +  E+
Sbjct: 156 GVVESLKIMTAQKTERIARFAFDYAMKYNRKS----VTAVHKANIMKLGDGLFRNLVTEI 211

Query: 225 FESNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVP 284
                  Y ++  +  I+D+   +   +P  FDV+VAP++YG IL +  AAL+G  G+VP
Sbjct: 212 GAKE---YPEVGVSSIIVDNASMQAVAKPHQFDVMVAPSMYGTILGNIGAALIGGPGLVP 268

Query: 285 SANVGPGIVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSN 343
            AN G    + EP       DI  + I+NP A I S  LML  LG    A  I  AV   
Sbjct: 269 GANYGRDYAVFEPGSRHVGLDIENQNIANPTAMILSATLMLNHLGFRNDAARISKAVHEV 328

Query: 344 LREDKIKTPDLGGKNSTSDVVNDVIRRL 371
           + E K  T D+GG  +T++  N VI +L
Sbjct: 329 IAEGKTTTRDIGGSATTTEFTNAVIAKL 356

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  166 bits (419), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 123/369 (33%), Positives = 189/369 (51%), Gaps = 33/369 (8%)

Query: 14  TIGNISKK-----SNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQT 68
           +IGN   K      N T+  I GDG+G E+  S R + +       +  ++++   G   
Sbjct: 30  SIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSVRTIFKA----AKVPIDWVNCDIG--P 83

Query: 69  FLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKS 128
            L  G+    +T      N   AL G + +P    +G+ S  + LRK  GL+AN+RP KS
Sbjct: 84  LLINGETTIPQTAVDQINNSLIALKGPLATPVG--QGHRSINLTLRKTFGLFANVRPAKS 141

Query: 129 VDTPGN--KKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIAL 186
           +    +  + VD++++RENTE  Y  +E   +       V  + K I+  A+ ++ K A 
Sbjct: 142 IPNLASTYENVDLIVIRENTEGEYSGIEHEIVP-----GVVQSIKLITRKASEKVIKYAF 196

Query: 187 DIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMV 246
           +      ++ G   L V HK+ +  + DGLF +  +E+ +     Y D+    ++ID+ V
Sbjct: 197 EYT----RSIGRSNLIVVHKATIQRRGDGLFVQTAQEMADK----YPDVNLKLELIDNTV 248

Query: 247 YRLFREPECF--DVIVAPNLYGDILSDGAAAL-VGSLGVVPSANVGPGIVIGEPCHGSAP 303
                 PE +   V V PNLYGDILSD  + L  GSLG+ PSAN+G   V+ E  HGSAP
Sbjct: 249 LNCIMNPEKYADSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIGE-TVLYEAVHGSAP 307

Query: 304 DIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDK-IKTPDLGGKNSTSD 362
           DIAG+  +NP A + S+ +ML  +G  + A  I+TAV + +   K  +T DLGG  +T+ 
Sbjct: 308 DIAGQDKANPTALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTS 367

Query: 363 VVNDVIRRL 371
               VI  L
Sbjct: 368 FTKAVIENL 376

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  165 bits (418), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 118/354 (33%), Positives = 186/354 (52%), Gaps = 27/354 (7%)

Query: 24  LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKT 83
            T+  I GDG+G E+  S + + +    +  + + + D+       L T   +P   V+ 
Sbjct: 41  FTVPFIEGDGVGPEISKSVKDIFK--AAQVPVDWEYCDVSPLLINGLTT---IPEPAVQQ 95

Query: 84  LRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVI 141
           + ++   AL G + +P  K  G+ S  + LRK  GL+AN+RP +S+       K VD+V+
Sbjct: 96  INKH-KIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152

Query: 142 VRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQL 201
           +RENTE  Y  +E           V  + K I+  A+ R+ + A + A    +  G  +L
Sbjct: 153 IRENTEGEYSGIEHV-----VAPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRL 203

Query: 202 TVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VI 259
            V HKS +   +DGLF  + KE+       + DI+   ++ID+ V  + R+P  +   V 
Sbjct: 204 VVVHKSTIQKLADGLFVNIAKELAPE----FPDIKLETELIDNTVLNVVRDPPSYTDAVT 259

Query: 260 VAPNLYGDILSDGAAAL-VGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIR 318
           V PNLYGDILSD  + L  GSLG+ PSAN+G  + I E  HGSAPDIAG+  +NP A + 
Sbjct: 260 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLL 319

Query: 319 STALMLEFLGHSQAAQDIQTAVDSNLRE-DKIKTPDLGGKNSTSDVVNDVIRRL 371
           S+ +ML ++G    +  I+ A+ + +    + +T DL G  +TS     VI+ L
Sbjct: 320 SSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  164 bits (416), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 122/355 (34%), Positives = 184/355 (51%), Gaps = 34/355 (9%)

Query: 25  TIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDTG--KALPVET-V 81
           T+ LIPGDG+GKEV  S   +           F   ++   W     +G  +A  V++ V
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSI-----------FKAENVPVDWDRVDISGVDRAEDVKSAV 78

Query: 82  KTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPGNK----KV 137
           ++L+ N  G L G   +      G+ S  VALRKEL +YAN+   KS+  PG +     V
Sbjct: 79  ESLKRNRIG-LKGIWHTSPADQAGHGSLNVALRKELDIYANVARFKSI--PGVQVKIPDV 135

Query: 138 DMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNG 197
           D+V++RENTE  +  LE   +       V ++ K +++    RIA+ A D A    K N 
Sbjct: 136 DLVVIRENTEGEFSGLEHESV-----PGVVESLKIMTQDNIERIARFAFDYA----KKND 186

Query: 198 NVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFD 257
             Q+   HK+N++   DGLF+ + +EV E     Y ++Q    I+D+   +    P  FD
Sbjct: 187 RKQVVAVHKANIMKMGDGLFKNLVQEVGEKE---YPELQVGNIIVDNASMQTVANPHQFD 243

Query: 258 VIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEP-CHGSAPDIAGKGISNPIAT 316
           V+V P++YG IL +  AAL+G  G+V  AN G  + + EP       DI G+ ++NP A 
Sbjct: 244 VLVTPSMYGTILGNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLDIKGQNVANPTAM 303

Query: 317 IRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371
           I S+ L+L  LG + +A  I  AV + + E K  T D+GG  ST++    VI +L
Sbjct: 304 ILSSVLLLNHLGLNTSADRISKAVHAVIAEGKSVTRDIGGTASTTEFTEAVINKL 358

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  163 bits (413), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 124/382 (32%), Positives = 187/382 (48%), Gaps = 37/382 (9%)

Query: 1   MLRRSVYNRQFQ---RTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTF 57
           MLRR V  R       T+         T+ L+PGDG+GKE   S   V           F
Sbjct: 1   MLRRLVSKRSLATLPETLFPNKYGGRYTVTLLPGDGVGKECTDSVVSV-----------F 49

Query: 58  NFIDLQAGWQTFLDTG---KALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALR 114
           N  ++   W+    +G   K      V++LR N  G L G   +      G+ S  VA R
Sbjct: 50  NAENIPIDWEIVNISGLDHKEGVAAAVQSLRRNKIG-LKGLWHTSNADQSGHGSLNVAFR 108

Query: 115 KELGLYANIRPVKSVDTPGNKK----VDMVIVRENTEDLYIKLEKTYIDEKTGTRVADAT 170
           K+L +YAN+   KS+   G K     VD+V++RENTE  +  LE   ++      V ++ 
Sbjct: 109 KQLDIYANVAVFKSLK--GVKTMIPDVDLVVIRENTEGEFSGLEHESVEG-----VVESL 161

Query: 171 KRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKT 230
           K  +   T RIA+ A + A    + NG   +   HK+N++   DGLFR     + E    
Sbjct: 162 KVTTLPKTERIARFAFNYA----QKNGRKAVCAVHKANIMKLGDGLFRNTVTSIGEKE-- 215

Query: 231 LYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
            Y DI+ +  I+D+   +   +P  FDV+V P++YG I+ +  AAL+G  G+V  AN G 
Sbjct: 216 -YPDIETSSIIVDNASMQAVAKPHQFDVLVTPSMYGTIIGNIGAALIGGPGLVAGANFGR 274

Query: 291 GIVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKI 349
              + EP       DI G+ I+NP A + S+ALML  LG +++ + I  AV   + E  +
Sbjct: 275 EYAVFEPGSRHVGLDIKGQNIANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEGDV 334

Query: 350 KTPDLGGKNSTSDVVNDVIRRL 371
           +T D+GG  +T++    VI +L
Sbjct: 335 RTKDIGGDATTTEFTQAVIEKL 356

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  163 bits (412), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 122/384 (31%), Positives = 191/384 (49%), Gaps = 51/384 (13%)

Query: 1   MLRRSVYNRQFQRTIGNISKKS---NLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTF 57
           MLR    N   +R+I  IS K       I LIPG+GIGKEV  S R +           F
Sbjct: 1   MLR----NTLLRRSISTISPKKYGGRFQITLIPGNGIGKEVTDSVRSI-----------F 45

Query: 58  NFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGY--SSPI----- 110
              +L   W+          +  +++ R+    A+  +++     ++G   S PI     
Sbjct: 46  QAENLPIDWE----------IVNIESHRDGIKTAV-DSIKRNKIALKGIWSSDPIDGSLN 94

Query: 111 VALRKELGLYANIRPVKSVDTPGNK--KVDMVIVRENTEDLYIKLEKTYIDEKTGTRVAD 168
           VALRK+L ++AN+   KS D    +   VD+V++RENTE  +  LE   +D      V +
Sbjct: 95  VALRKQLDIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDG-----VVE 149

Query: 169 ATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN 228
           + K +++  T RIA+ A D A +  +N     +T  HK+N++   DGLF+ +   +  + 
Sbjct: 150 SLKIVTKPKTERIARFAFDFAKKHNRN----HVTAVHKANIMKLGDGLFKNIVAHIGNNE 205

Query: 229 KTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANV 288
              Y +I+ +  I+D+   +   +P  FDV+V+P++YG IL +  AAL+G  G+VP AN 
Sbjct: 206 ---YPEIKNSSIIVDNASMQAVAKPHQFDVLVSPSMYGTILGNIGAALIGGPGLVPGANF 262

Query: 289 GPGIVIGEP-CHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLRED 347
           G    + EP       DI G+ ++NP A I S   ML  LG +  A+ I  AV   + + 
Sbjct: 263 GRDYAVFEPGSRHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQG 322

Query: 348 KIKTPDLGGKNSTSDVVNDVIRRL 371
              T D+GG  ST++  + VI  L
Sbjct: 323 TTVTKDIGGTASTTEFTDAVINEL 346

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  162 bits (411), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 126/368 (34%), Positives = 200/368 (54%), Gaps = 38/368 (10%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIGPK-HGLTFNFIDLQAGWQTFLDTGKALPVETVKTL 84
           I ++PGD +G+E++    +VL+ +  K HG+ FNF     G      TG  LP ET++  
Sbjct: 7   IVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEAA 66

Query: 85  RENCDGALFGAVQSP---TTKVEGYSSPIVALRKELGLYANIRPVKSVD------TPGNK 135
           +++ D  L GAV  P   T KV      ++ +RKELGLY N+RP K +       +P  +
Sbjct: 67  KQS-DAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFISDKLIGLSPLKE 124

Query: 136 KV----DMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQ 191
           +V    D V+VRE    +Y    +    E  G+ VA  +++ S    +RI K+A   A  
Sbjct: 125 EVCKGTDFVVVRELVGGIYFGERQ----EDDGSGVAWDSEKYSIEEVKRITKMA---AFL 177

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFR 251
            L+N+  + +    K+NVL+ S  L+R    E        + +++   Q+IDS    L +
Sbjct: 178 SLQNDPPLPIWSLDKANVLASSR-LWRAAVDETIAE----FPNLKVQHQLIDSAAMMLVK 232

Query: 252 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSAPD 304
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSAPD
Sbjct: 233 NPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAPD 292

Query: 305 IAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDV 363
           +A +G  NP+ATI S A+ML+  L   Q  + I+ AV S + +  I+T DLGG ++TS++
Sbjct: 293 LA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAV-SVVLDRGIRTADLGGNSTTSEL 350

Query: 364 VNDVIRRL 371
            + V + L
Sbjct: 351 GDAVAQEL 358

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  161 bits (407), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 114/352 (32%), Positives = 181/352 (51%), Gaps = 29/352 (8%)

Query: 25  TIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKTL 84
           T+ LIPGDG+GKE+  S   + E       + +  +D+        D  +A     V++L
Sbjct: 28  TVTLIPGDGVGKEITDSVVSIFE--AENIPVDWERVDISTS-DNIQDVSQA-----VESL 79

Query: 85  RENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPGNK----KVDMV 140
           + N  G     +   +  +  + S  VALRK+L ++A++   KSV  PG K     VD+V
Sbjct: 80  KRNKIG--LKGIWHTSADIADHGSFNVALRKQLDMFAHVAFFKSV--PGVKTKIPNVDLV 135

Query: 141 IVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQ 200
           ++RENTE  Y  LE   +       V ++ K I++  + RIA+ A D A    K      
Sbjct: 136 VIRENTEGEYSGLEHESV-----PGVVESLKIITKAKSERIARFAFDFA----KKYNRKS 186

Query: 201 LTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIV 260
           +   HK+N++   DGLFR    E+  +    Y DIQ +  I+D+   +   +P  FDV+V
Sbjct: 187 VCAVHKANIMKMGDGLFRNTVTEIGANE---YPDIQTSSIIVDNASMQAVAKPHQFDVMV 243

Query: 261 APNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEP-CHGSAPDIAGKGISNPIATIRS 319
            P++YG I+ +  AAL+G  G+V  A+ G    + EP       DI GK ++NP A I S
Sbjct: 244 TPSMYGTIIGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILS 303

Query: 320 TALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371
           + LML+ LG +++A+ I  A    +   ++ T D+GG  ST++    +I+RL
Sbjct: 304 STLMLQHLGLTESAKRIAKATHDVISLGQVTTKDIGGSASTTEFTEAIIKRL 355

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  153 bits (387), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 127/366 (34%), Positives = 191/366 (52%), Gaps = 37/366 (10%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIGP-KHGLTFNFIDLQAGWQTFLDTGKALPVETVKTL 84
           I ++PGD +G+E+     +VL+ I   +   TFNF     G      TG  LP E ++  
Sbjct: 5   IVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEALEAS 64

Query: 85  RENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRP----------VKSVDT 131
           ++  D  L GAV  P     G   P   ++ +RKEL LYAN+RP          +  +  
Sbjct: 65  KK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLELSPLKA 122

Query: 132 PGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQ 191
              +  D V+VRE    +Y    K    E  G  VA  +++ S    +RI ++A  +ALQ
Sbjct: 123 QYAQGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLALQ 178

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFR 251
              +N  + +    K+NVL+ S  L+R   K V ++ K  +  +  N Q+IDS    L +
Sbjct: 179 ---HNPPLPIWSLDKANVLASSR-LWR---KTVEKTIKEEFPTLSVNHQLIDSAAMILVK 231

Query: 252 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSAPD 304
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSAPD
Sbjct: 232 NPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 291

Query: 305 IAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDV 363
           +A KG  NP+ATI S A+ML+  L   +    I+ AV   L +D I+T DLGG NSTS+V
Sbjct: 292 LA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKKVL-DDGIRTGDLGGSNSTSEV 349

Query: 364 VNDVIR 369
            + V +
Sbjct: 350 GDAVAK 355

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  151 bits (382), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 187/360 (51%), Gaps = 37/360 (10%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIGP-KHGLTFNFIDLQAGWQTFLDTGKALPVETVKTL 84
           I ++PGD +GKEV     +VL  I   +  + FNF     G      TG  LP E ++  
Sbjct: 5   IVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEALEAS 64

Query: 85  RENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRP----------VKSVDT 131
           ++  D  L GAV  P     G   P   ++ +RKELGLYAN+RP          +  +  
Sbjct: 65  KK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDLSPLKP 122

Query: 132 PGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQ 191
              K  D V+VRE    +Y    K    E  G  VA  +++ S    +RI ++A  +ALQ
Sbjct: 123 EYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 178

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFR 251
           +   N  + +    K+NVL+ S  L+R   K V E+ KT +  +    Q+IDS    L +
Sbjct: 179 Q---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDSAAMILVK 231

Query: 252 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSAPD 304
            P   + V++  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSAPD
Sbjct: 232 SPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPD 291

Query: 305 IAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDV 363
           +    + NPIATI S A+ML+  L   +  + ++ AV  N+ +  ++T DLGG NST++V
Sbjct: 292 LPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAV-RNVLDAGVRTGDLGGSNSTTEV 349

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  149 bits (375), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 129/377 (34%), Positives = 201/377 (53%), Gaps = 50/377 (13%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQ---AGWQTFLDTGKALPVETVK 82
           I ++PGD IG+EV+    +VL  +  +  L+    D Q    G      TG ALP E + 
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAV--EQSLSDVHFDFQYHLVGGAAIDATGSALPDEALG 64

Query: 83  TLRENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRPVK-SVDT-----PG 133
             +E  D  L GAV  P  +  G   P   ++ LR+ELG+YAN+RP   + D+     P 
Sbjct: 65  AAKE-ADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSPL 122

Query: 134 NKKV----DMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIA 189
             ++    D+++VRE     Y    + + DE  G  VA  T + +    +RIA++A  +A
Sbjct: 123 RPEIARDTDIMVVRELLGGSYFG--ERHEDEGDG--VAWDTDKYTVKEVQRIARMAGFLA 178

Query: 190 LQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRL 249
           LQ   ++  + +    K+NVL+ S  L+R+  +E F+S    + ++Q   Q+IDS    L
Sbjct: 179 LQ---HDPPLPVWSLDKANVLASSR-LWRKTVEETFQSE---FPNVQLQHQLIDSAAMIL 231

Query: 250 FREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVG------PGIVIGEPCHGSA 302
            + P  F+ V+V  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSA
Sbjct: 232 VKNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSA 291

Query: 303 PDI-AGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360
           PD+ AGK  +NPI  I S A+ML+  L    A + ++ AV   L +  ++T DL G +ST
Sbjct: 292 PDLPAGK--ANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVL-DSGVRTGDLLGSSST 348

Query: 361 SDV-------VNDVIRR 370
           S+V       V + +RR
Sbjct: 349 SEVGDAIALAVKEALRR 365

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  147 bits (371), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 124/360 (34%), Positives = 186/360 (51%), Gaps = 37/360 (10%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIGP-KHGLTFNFIDLQAGWQTFLDTGKALPVETVKTL 84
           I ++PGD +G+E+     +VL+ I    + + F+F     G      TG  LP E ++  
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEALEA- 64

Query: 85  RENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRP----------VKSVDT 131
            +N D  L GAV  P     G   P   ++ +RKELGLYAN+RP          +  +  
Sbjct: 65  SKNSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 132 PGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQ 191
              K  D ++VRE    +Y    K    E  G  VA  +++ S    +RI ++A  +ALQ
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLALQ 179

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFR 251
              +N  + +    K+NVL+ S  L+R   K V E+ K  +  +    Q+IDS    L +
Sbjct: 180 ---HNPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAAMILVK 232

Query: 252 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSAPD 304
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSAPD
Sbjct: 233 NPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 292

Query: 305 IAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDV 363
           +  KG  NPIATI S A+ML+  L   +    I+ AV   L +  I+T DLGG NST++V
Sbjct: 293 LP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVL-DAGIRTGDLGGSNSTTEV 350

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  146 bits (368), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 122/366 (33%), Positives = 188/366 (51%), Gaps = 37/366 (10%)

Query: 28  LIPGDGIGKEVIPSGRQVLETIG-PKHGLTFNFIDLQAGWQTFLDTGKALPVETVKTLRE 86
           ++PGD IG+EVI    +VL  I   +  + F F     G      TG  L  +T++  + 
Sbjct: 9   VLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLSDKTIEAAKA 68

Query: 87  NCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRPVKSVD------TPGNKKV 137
             D  L GAV  P     G   P   ++A+RKELGLYAN+RP   +       +P   ++
Sbjct: 69  -ADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGLSPLKPEI 126

Query: 138 ----DMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRL 193
               D VI+RE    +Y    K    E  G  VA  +++ +     RI ++   +ALQ  
Sbjct: 127 AQGTDFVILRELVGGIYFGERK----EDDGDGVAWDSEKYTVSEVERITRMGAFLALQ-- 180

Query: 194 KNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREP 253
            ++  + L    K+NVL+ S  L+R   + V E+ K  +  +    Q+IDS    + + P
Sbjct: 181 -HDPPLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDSAAMIMIKNP 235

Query: 254 ECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSAPDIA 306
             F+ +++  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSAPD+ 
Sbjct: 236 RKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCHGSAPDLE 295

Query: 307 GKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVN 365
            KG +NPIA I S A+ML+  L      + I+ AV   + E  I+T DLGG N+T++V +
Sbjct: 296 -KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVKQVI-ESGIRTGDLGGNNTTTEVGD 353

Query: 366 DVIRRL 371
            V   L
Sbjct: 354 AVTHAL 359

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  144 bits (362), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 124/376 (32%), Positives = 196/376 (52%), Gaps = 43/376 (11%)

Query: 18  ISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIG---PKHGLTFNFIDLQAGWQTFLDTGK 74
           +S   N+T+   PGD IG E++    +VL+ I    P     +N+  +  G      TG+
Sbjct: 1   MSSVKNITV--FPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLI--GGAAIDATGE 56

Query: 75  ALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRPVKSVD- 130
            L  E ++  + N D  L GAV  P     G   P   ++ +RKELG+YAN+RP + V  
Sbjct: 57  PLTDEALQVAK-NSDAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSE 114

Query: 131 -----TPGNKKV----DMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRI 181
                +P  +++    D VIVRE    +Y    +   D+  G      +  + E+  +RI
Sbjct: 115 TLLDLSPLKREIVQGTDFVIVRELVGGIYFGERQEAGDD--GVAWDKESYSVPEI--QRI 170

Query: 182 AKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQI 241
            ++A  +ALQ   +N  + +    K+NVL+ S  L+R   K V E+ K  +  +  N  +
Sbjct: 171 TRMAAFLALQ---HNPPLPVWSLDKANVLATSR-LWR---KTVEETIKNEFPTLTINHHL 223

Query: 242 IDSMVYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVI 294
           IDS    L + P   + V++  N++GDI+SD A+ + GSLG++PSA++         + +
Sbjct: 224 IDSAAMTLVQNPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGL 283

Query: 295 GEPCHGSAPDIAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPD 353
            EPCHGSAPD+     +NPIATI S A+M +  L  ++    I+ AV   + +  IKT D
Sbjct: 284 YEPCHGSAPDLPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTI-DAGIKTGD 341

Query: 354 LGGKNSTSDVVNDVIR 369
           LGGKN+T++V N V +
Sbjct: 342 LGGKNTTTEVGNAVAK 357

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  143 bits (360), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 126/371 (33%), Positives = 190/371 (51%), Gaps = 38/371 (10%)

Query: 22  SNLTIGLIPGDGIGKEVIPSGRQVLETIGPK--HGLTFNFIDLQAGWQTFLDTGKALPVE 79
           S   I ++PGD +G+E++    +VLE +      G+ F F     G  +   TG  LP E
Sbjct: 2   STKKIVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDE 61

Query: 80  TVKTLRENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRPVKSVD------ 130
            +   + N D  L GAV  P     G   P   ++ +RKEL LYAN+RP   V       
Sbjct: 62  ALDAAK-NSDAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLGL 119

Query: 131 TPGNKKV----DMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIAL 186
           +P  +++    D  +VRE    +Y    K   D+  G+        I EV  +RI ++A 
Sbjct: 120 SPLKEEIAKGTDFTVVRELVGGIYFGDRKE--DDGDGSAWDCEKYTIPEV--QRITRMAA 175

Query: 187 DIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMV 246
            +ALQ   ++  + +    K+NVL+ S  L+R   K V E+ K  + +++   Q+IDS  
Sbjct: 176 FLALQ---HDPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSAA 228

Query: 247 YRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCH 299
             L + P   + +I+  N++GDI+SD A+ + GSLG++PSA++           + EPCH
Sbjct: 229 MILVKSPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCH 288

Query: 300 GSAPDIAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKN 358
           GSAPD+  KG  NPIATI S A+ML+  L        I+ AV   L +  I+T DL G N
Sbjct: 289 GSAPDLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVL-DAGIRTADLKGSN 346

Query: 359 STSDVVNDVIR 369
           STS+V + V +
Sbjct: 347 STSEVGDAVAK 357

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  142 bits (359), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 121/368 (32%), Positives = 190/368 (51%), Gaps = 37/368 (10%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIGP-KHGLTFNFIDLQAGWQTFLDTGKALPVETVKTL 84
           I ++PGD +G+E+     +VL+ I   +  + F+F +   G      TG  LP E ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  RENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRP----------VKSVDT 131
           ++  D  L GAV  P     G   P   ++ +RKEL LYAN+RP          +  +  
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 132 PGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQ 191
              K  D V+VRE    +Y    K    E  G  VA  +++ +    +RI ++A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFR 251
              +   + +    K+NVL+ S  L+R   K V E+ K  +  ++   Q+IDS    L +
Sbjct: 181 ---HEPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 252 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSAPD 304
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDV 363
           +  K   NPIATI S A+ML+  L   +  + I+ AV   L +  I+T DLGG NST++V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVL-DAGIRTGDLGGSNSTTEV 351

Query: 364 VNDVIRRL 371
            + V + +
Sbjct: 352 GDAVAKEV 359

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  142 bits (358), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 122/368 (33%), Positives = 189/368 (51%), Gaps = 41/368 (11%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIG---PKHGLTFNFIDLQAGWQTFLDTGKALPVETVK 82
           I ++PGD  G+E+     +VLE I    P+    FNF     G      TG  LP + + 
Sbjct: 5   IVVLPGDHAGQEIAQEAIKVLEAISEVSPEA--KFNFQHHLIGGAAIDATGSPLPDDALA 62

Query: 83  TLRENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRP----------VKSV 129
             ++     L GAV  P     G   P   ++ +RKEL LYAN+RP          +  +
Sbjct: 63  AAKKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPL 120

Query: 130 DTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIA 189
                K  D V+VRE    +Y    K    E  G  VA  +++ ++   +R+ ++A  +A
Sbjct: 121 KPQHAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYTKPEVQRLTRMAAFLA 176

Query: 190 LQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRL 249
           LQ   +N  + +    K+NVL+ S  L+R   K V E+ K  +  ++ N Q+IDS    L
Sbjct: 177 LQ---HNPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDSAAMIL 229

Query: 250 FREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSA 302
            + P   + +++  NL+GDI+SD A+ + GSLG++PSA++           + EPCHGSA
Sbjct: 230 VKSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPCHGSA 289

Query: 303 PDIAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTS 361
           PD+  KG  NPIA I S A+ML+  L  S+  + ++ AV   L +  ++T DLGG NSTS
Sbjct: 290 PDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQVL-DSGVRTGDLGGSNSTS 347

Query: 362 DVVNDVIR 369
           +V + + +
Sbjct: 348 EVGDAIAK 355

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  142 bits (357), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 186/360 (51%), Gaps = 37/360 (10%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIGP-KHGLTFNFIDLQAGWQTFLDTGKALPVETVKTL 84
           I ++PGD +G+E+     +VL+ I   +  + F+F +   G      TG  LP E ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  RENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRP----------VKSVDT 131
           ++  D  L GAV  P     G   P   ++ +RKEL LYAN+RP          +  +  
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 132 PGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQ 191
              K  D V+VRE    +Y    K    E  G  VA  +++ +    +RI ++A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFR 251
              +   + +    K+NVL+ S  L+R   K V E+ K  +  ++   Q+IDS    L +
Sbjct: 181 ---HEPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 252 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSAPD 304
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDV 363
           +  K   NPIATI S A+ML+  L   +  + I+ AV   L +  I+T DLGG NST++V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVL-DAGIRTGDLGGSNSTTEV 351

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  141 bits (356), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 122/368 (33%), Positives = 187/368 (50%), Gaps = 41/368 (11%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIGP-KHGLTFNFIDLQAGWQTFLDTGKALPVETVKTL 84
           I ++PGD +G+E+     +VL+ I   +  + F F     G      TG+ LP  +++  
Sbjct: 7   IVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAA 66

Query: 85  RENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRP----------VKSVDT 131
           ++  D  L GAV  P     G   P   ++ +RKEL LYAN+RP          +  +  
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKA 124

Query: 132 PGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQ 191
              +  D V+VRE    +Y    K    E  G  VA  +++ S    +RI ++A  +ALQ
Sbjct: 125 EHARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFR 251
              +N  + +    K+NVL+ S  L+R   K V E+ K  +  +    Q+IDS    + +
Sbjct: 181 ---HNPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMIMVK 233

Query: 252 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSAPD 304
            P   + VI+  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLR---EDKIKTPDLGGKNSTS 361
           +  KG  NPIATI S A+MLE    S    +  TAV+  +R   +  I+T DL G NST 
Sbjct: 294 LE-KGKVNPIATILSAAMMLEL---SLDMFEEGTAVEEAVRRVLDSGIRTGDLRGSNSTQ 349

Query: 362 DVVNDVIR 369
           +V + V +
Sbjct: 350 EVGDAVAK 357

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  143 bits (360), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 122/360 (33%), Positives = 185/360 (51%), Gaps = 37/360 (10%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIGP-KHGLTFNFIDLQAGWQTFLDTGKALPVETVKTL 84
           I ++PGD +G+E+     +VL  I   +  + F+F     G      TG  LP E ++  
Sbjct: 90  IVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPDEALEAS 149

Query: 85  RENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRPVKSVD------TPGN- 134
           ++  D  L GAV  P     G   P   ++ +RKEL LYAN+RP           +P   
Sbjct: 150 KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 207

Query: 135 ---KKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQ 191
              K  D+ IVRE    +Y    K    E  G  VA  +++ S    +RI ++A  +ALQ
Sbjct: 208 EIVKGTDICIVRELVGGIYFGERK----EDEGDGVAWDSEKYSVSEVQRITRMAGFLALQ 263

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFR 251
              +N  + +    K+NVL+ S  L+R   K V E+ K  +  +    Q+IDS    L +
Sbjct: 264 ---HNPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 316

Query: 252 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSAPD 304
            P   + V++A N++GDI+SD A+ + GSLG++PSA++           + EPCHGSAPD
Sbjct: 317 NPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 376

Query: 305 IAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDV 363
           +  KG  NP+ATI S A+ML+  L  ++    ++ AV   L +  ++T DL G NSTS+V
Sbjct: 377 LP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVL-DSGVRTADLRGSNSTSEV 434

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  140 bits (354), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 189/368 (51%), Gaps = 37/368 (10%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIGP-KHGLTFNFIDLQAGWQTFLDTGKALPVETVKTL 84
           I ++PGD +G+E+     +VL+ I   +  + F+F +   G      TG  LP E ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 85  RENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRP----------VKSVDT 131
           ++  D  L GAV  P     G   P   ++ +RKEL LYAN+RP          +  +  
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 132 PGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQ 191
              K  D V+VRE    +Y    K    E  G  VA   ++ +    +RI ++A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGERK----EDDGDGVAWDCEQYTVPEVQRITRMAAFMALQ 180

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFR 251
              +   + +    K+NVL+ S  L+R   K V E+ K  +  ++   Q+IDS    L +
Sbjct: 181 ---HEPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 252 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSAPD 304
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDV 363
           +  K   NP+ATI S A+ML+  L   +  + I+ AV   L +  I+T DLGG NST++V
Sbjct: 294 LP-KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVKRVL-DAGIRTGDLGGSNSTTEV 351

Query: 364 VNDVIRRL 371
            + V + +
Sbjct: 352 GDAVAKEV 359

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  140 bits (353), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 123/368 (33%), Positives = 187/368 (50%), Gaps = 38/368 (10%)

Query: 25  TIGLIPGDGIGKEVIPSGRQVLETIGP--KHGLTFNFIDLQAGWQTFLDTGKALPVETVK 82
           TI ++PGD +G+E+     +VL  I       + F F     G      TG  LP E ++
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 83  TLRENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRPVKSVD------TPG 133
             ++  D  L GAV  P     G   P   ++ +RKEL LYAN+RP           +P 
Sbjct: 66  ASKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 134 NKKV----DMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIA 189
             ++    D V+VRE    +Y    K    E  G  VA  +++ S    +RI ++A  +A
Sbjct: 124 KPEIARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFMA 179

Query: 190 LQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRL 249
           LQ   +N  + +    K+NVL+ S  L+R   K V E+ K  +  +    Q+IDS    L
Sbjct: 180 LQ---HNPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAMIL 232

Query: 250 FREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSA 302
            + P   + +I+  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSA
Sbjct: 233 VKNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSA 292

Query: 303 PDIAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTS 361
           PD+  KG  NP+ATI S A+ML+  L   +  + I+ AV   L +  I+T DL G NST+
Sbjct: 293 PDLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVL-DSGIRTADLKGTNSTT 350

Query: 362 DVVNDVIR 369
           +V + V +
Sbjct: 351 EVGDAVAK 358

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  139 bits (350), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 120/370 (32%), Positives = 191/370 (51%), Gaps = 41/370 (11%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIG---PKHGLTFNFIDLQAGWQTFLDTGKALPVETVK 82
           I ++PGD +G+E+     +VL+ I    P+    F +  +  G      TG+ LP  +++
Sbjct: 7   IVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLI--GGAAIDATGEPLPDASLE 64

Query: 83  TLRENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRP----------VKSV 129
             +++ D  L GAV  P     G   P   ++ +RKEL LYAN+RP          +  +
Sbjct: 65  AAKKS-DAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPL 122

Query: 130 DTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIA 189
                +  D V+VRE    +Y    K    E TG  VA  +++ S    +RI ++A  +A
Sbjct: 123 KPECARGTDFVVVRELVGGIYFGERK----EDTGDGVAWDSEQYSVPEVQRITRMAAFLA 178

Query: 190 LQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRL 249
           LQ   ++  + +    K+NVL+ S  L+R   K V E+ K  +  +    Q+IDS    L
Sbjct: 179 LQ---HSPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMIL 231

Query: 250 FREPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSA 302
            + P   + VI+  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSA
Sbjct: 232 VKNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSA 291

Query: 303 PDIAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTS 361
           PD+  KG  NPIATI S A+ML+  L   +    ++ AV   L +  ++T DL G ++TS
Sbjct: 292 PDLP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVL-DSGVRTADLKGTSTTS 349

Query: 362 DVVNDVIRRL 371
           +V   V++ L
Sbjct: 350 EVGEAVVKAL 359

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  137 bits (344), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 187/368 (50%), Gaps = 37/368 (10%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIGP-KHGLTFNFIDLQAGWQTFLDTGKALPVETVKTL 84
           I ++PGD +G+E+     +VL+ I   +  + F+F     G      TG  L  E ++  
Sbjct: 7   IVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDATGVPLTDEALEAS 66

Query: 85  RENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRP----------VKSVDT 131
           ++  D  L GAV  P     G   P   ++ +RKEL LYAN+RP          +  +  
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLELSPIKP 124

Query: 132 PGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQ 191
              +  D V+VRE    +Y    K    E  G  VA  +++ +    +RI ++A  +ALQ
Sbjct: 125 QFARGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFR 251
              +   + +    K+NVL+ S  L+R   K V E+ K  +  ++   Q+IDS    L +
Sbjct: 181 ---HQPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 252 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSAPD 304
            P   + +I+  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSAPD
Sbjct: 234 NPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDV 363
           +  K   NPIATI S A+ML+  L  +   Q I+ AV   L +  I+T DLGG NST +V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVKKVL-DAGIRTGDLGGSNSTIEV 351

Query: 364 VNDVIRRL 371
            + V + +
Sbjct: 352 GDAVAKEV 359

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  134 bits (338), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 103/325 (31%), Positives = 161/325 (49%), Gaps = 38/325 (11%)

Query: 1   MLRRSVYNRQFQRT--IGNISKKS---NLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGL 55
           ML R++  R       + +I  K      T+ LIPGDG+GKEV  S + + E        
Sbjct: 1   MLNRTIAKRSLATAAQVEHILPKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEAE------ 54

Query: 56  TFNFIDLQAGWQTF----LDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIV 111
                ++   W+T      D  + +  E V++LR N  G L G   +P  +  G+ S  V
Sbjct: 55  -----NIPIDWETINIKQTDHKEGVN-EAVESLRRNKIG-LKGLWHTPADQT-GHGSLNV 106

Query: 112 ALRKELGLYANIRPVKSVDTPGNK--KVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADA 169
           ALRK+L +YAN+   KS+     +   +D++++RENTE  +  LE   +       V ++
Sbjct: 107 ALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIRENTEGEFSGLEHESV-----PGVVES 161

Query: 170 TKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNK 229
            K +++  T RIA+ A D A    K      +T  HK+N++   DGLFR +  E+ +   
Sbjct: 162 LKIMTKPKTERIARFAFDFA----KKYNRKAVTAVHKANIMKLGDGLFRNIITEIGQKE- 216

Query: 230 TLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVG 289
             Y DI  +  I+D+   +   +P  FDV+V P++YG IL +  AAL+G  G+V  AN G
Sbjct: 217 --YPDIDVSSIIVDNASMQAVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANFG 274

Query: 290 PGIVIGEP-CHGSAPDIAGKGISNP 313
               + EP       DI G+ ++NP
Sbjct: 275 RDYAVFEPGSRHVGLDIKGQNVANP 299

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  132 bits (333), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 119/366 (32%), Positives = 186/366 (50%), Gaps = 37/366 (10%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIGP-KHGLTFNFIDLQAGWQTFLDTGKALPVETVKTL 84
           I ++PGD +G+E+     +VL+ I   +  + F++     G      TG  LP E +   
Sbjct: 7   IVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLPDEALDAA 66

Query: 85  RENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRP----------VKSVDT 131
           ++     L GAV  P     G   P   ++ +RKEL LYAN+RP          +  +  
Sbjct: 67  KKADA-VLLGAVGGPKWGT-GQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 124

Query: 132 PGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQ 191
              K  D V+VRE    +Y    K    E  G  VA  +++ S    +RI ++A  +ALQ
Sbjct: 125 EYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFR 251
           +   N  + +    K+NVL+ S  L+R   K V E+ K  +  +    Q+IDS    L +
Sbjct: 181 Q---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 233

Query: 252 EPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSAPD 304
            P   + +++  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSAPD
Sbjct: 234 SPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 305 IAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDV 363
           +  K   NPIATI S A+ML+  L   +    ++ AV   L +  I+T DL G+NSTS+V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRRVL-DAGIRTADLRGENSTSEV 351

Query: 364 VNDVIR 369
            + V++
Sbjct: 352 GDAVVK 357

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  132 bits (331), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 117/361 (32%), Positives = 178/361 (49%), Gaps = 38/361 (10%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIG--PKHGLTFNFIDLQAGWQTFLDTGKALPVETVKT 83
           I ++PGD +G E+     +VL+ I       + F+F     G       G  L  E ++ 
Sbjct: 7   IVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLTDEALEA 66

Query: 84  LRENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRPVKSVDTPG------- 133
            ++  D  L GAV  P     G   P   ++ +RKELGLYAN+RP      P        
Sbjct: 67  SKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASEPLLGLSPLR 124

Query: 134 ---NKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIAL 190
               K  D ++VRE    +Y    K    E  G  VA  +++ S     RI ++A  +AL
Sbjct: 125 PEIAKGTDFMVVRELVGGIYFGERK----EDDGDGVAWDSEKYSVPEVERITRMAAFLAL 180

Query: 191 QRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLF 250
           Q   +N  + +    K+NVL+ S  L+R   K V  + K  +  +    Q+IDS    L 
Sbjct: 181 Q---HNPPLPIWSLDKANVLASSR-LWR---KTVEATIKNEFPTLTVQNQLIDSAAMILV 233

Query: 251 REPECFD-VIVAPNLYGDILSDGAAALVGSLGVVPSANVGP------GIVIGEPCHGSAP 303
           + P   + +I+  N++GDI+SD A+ + GSLG++PSA++           + EPCHGSAP
Sbjct: 234 KNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAP 293

Query: 304 DIAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSD 362
           D+  K   NP+ATI S A+ML+  L   +  + ++ AV   L +  ++T DLGG NST +
Sbjct: 294 DLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVRRVL-DAGVRTGDLGGSNSTQE 351

Query: 363 V 363
           V
Sbjct: 352 V 352

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  131 bits (329), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 185/369 (50%), Gaps = 42/369 (11%)

Query: 26  IGLIPGDGIGKEVIPSGRQVLETIGP--KHGLTFNFIDLQAGWQTFLDTGKALPVETVKT 83
           I ++PGD +G EV     ++L+ I     + + FNF     G      TG  LP E+++ 
Sbjct: 7   IVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLEA 66

Query: 84  LRENCDGALFGAVQSPTTKVEGYSSP---IVALRKELGLYANIRPVKSVD------TPGN 134
            +   D  L GAV  P     G   P   ++ +RKEL LYAN+RP           +P  
Sbjct: 67  SKR-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLK 124

Query: 135 KK----VDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIAL 190
           +K     D  +VRE    +Y    K    E  G  VA  +++ S    +RI ++A  +A+
Sbjct: 125 EKYAKGTDFTVVRELVGGIYFGKRK----EDDGDGVAWDSEQYSVPEVQRITRMAAFLAM 180

Query: 191 QRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLF 250
           Q   +N  + +    K+NVL+ S  L+R+  +E  ++    +  ++ + Q+IDS    L 
Sbjct: 181 Q---HNPPLPIWSLDKANVLASSR-LWRKTVEETIQNE---FPSLKVSHQLIDSAAMILV 233

Query: 251 REPECFD-VIVAPNLYGDILSDGAAALVG--------SLGVVPSANVGPGIVIGEPCHGS 301
           + P   + +I+  N++GDI+SD A+ + G        SL  +P  N   G+   EPCHGS
Sbjct: 234 KNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLY--EPCHGS 291

Query: 302 APDIAGKGISNPIATIRSTALMLEF-LGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360
           APD+  KG  NPI TI S A+ML+  L   +    ++ AV   L ++ I+T DLGG NST
Sbjct: 292 APDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAVRRVL-DNNIRTADLGGSNST 349

Query: 361 SDVVNDVIR 369
           SD+ + V +
Sbjct: 350 SDIGDAVAK 358

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 132/286 (46%), Gaps = 39/286 (13%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDT--PGNKKVDMVIVRENTEDLYIKLEKTYIDE 160
           V G+  PI+     +G +A+    K+ D   PG  K+++V   E+  +   KLE   + +
Sbjct: 134 VPGWEKPII-----IGRHAHADQYKATDAIIPGPGKLELVYKPEDGSEP-TKLE---VYD 184

Query: 161 KTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREV 220
             G  VA A     E + R  A  +  +AL     N  + L ++ K+ +L + DG F+++
Sbjct: 185 YKGAGVALAMYNTDE-SIRGFAHASFKLAL-----NKKLNLFLSTKNTILKKYDGRFKDI 238

Query: 221 CKEVFESN-KTLY--SDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALV 277
            +E+F++  KT +  ++I Y  ++ID MV ++ +    F ++   N  GD+ SD  A   
Sbjct: 239 FQEIFDAEYKTQFEAANISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGF 297

Query: 278 GSLGVVPSANVGPG--IVIGEPCHGS----------APDIAGKGISNPIATIRSTALMLE 325
           GSLG++ S  V P       E  HG+            + +   I++  A  R  A   E
Sbjct: 298 GSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAKRGE 357

Query: 326 FLGH---SQAAQDIQTAVDSNLREDKIKTPDLG---GKNSTSDVVN 365
             G    ++ A  +++A  + ++ED I T DL    GK      VN
Sbjct: 358 LDGTPEVTKFANLLESATLNTVQEDGIMTKDLAFACGKTDRDSYVN 403

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 139/300 (46%), Gaps = 47/300 (15%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDT--PGNKKVDMVIVRENTEDLYIKLEKTYIDE 160
           V+ +  PI+     +G +A+    K+ DT  PG   +++V   ++ +    ++   Y  +
Sbjct: 142 VKNWEKPII-----IGRHAHADQYKATDTLIPGPGTLELVYKSKDNDPSKTQVLNVYDYK 196

Query: 161 KTGTRVA--DATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFR 218
            +G  +A  +  + I+  A     K+A+D  L          L ++ K+ +L + DG F+
Sbjct: 197 SSGVALAMYNTDESITGFAHSSF-KLAIDKKLD---------LFLSTKNTILKKYDGRFK 246

Query: 219 EVCKEVFES---NKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAA 275
           +V +EVF+S   +K    +I+Y  ++ID MV ++ +    + ++   N  GD+ SD  A 
Sbjct: 247 DVFQEVFDSTYKDKFEALNIKYEHRLIDDMVAQMIKSKGGY-IMALKNYDGDVQSDIVAQ 305

Query: 276 LVGSLGVVPSANVGPG--IVIGEPCHGSA-----PDIAGKGIS-NPIATIRSTALMLEFL 327
             GSLG++ S  V P       E  HG+          GK  S N IA+I + +  L   
Sbjct: 306 GFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRQHQQGKQTSTNSIASIFAWSRGLAKR 365

Query: 328 GH-------SQAAQDIQTAVDSNLREDKIKTPDL----GGKN-----STSDVVNDVIRRL 371
           G         + AQ ++ A    ++ED I T DL    G  N     +T++ +N V +RL
Sbjct: 366 GELDNTPDVMKFAQTLEKATLDTVQEDGIMTKDLALACGNLNPDAYVNTAEFLNAVDKRL 425

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 124/283 (43%), Gaps = 31/283 (10%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKT 162
           V  +  PI+  R   G   +      V  PG  K+ +V   +++    I+L     DE++
Sbjct: 121 VTNWEKPIIIGRHAFG---DQYRATDVVIPGAGKLKLVFESDDSNTENIELSVYDFDEES 177

Query: 163 GTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCK 222
              VA A     E  T   A  +  +AL+R      + L  T K+ +L + DG F++V +
Sbjct: 178 KGGVAMAMYNTLESITG-FAHASFKMALER-----GLPLYSTTKNTILKKYDGKFKDVFE 231

Query: 223 EVFESN-KTLYS--DIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 279
            ++ES  K+ +    I Y  ++ID MV ++ +    + +I   N  GD+ SD  A   GS
Sbjct: 232 SLYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGS 290

Query: 280 LGVVPSANVGPG--IVIGEPCHGSAP-----DIAGKGIS-NPIATIRSTALMLEFLGHSQ 331
           LG++ S  + P       E  HG+          GK  S N IA+I +    L   G   
Sbjct: 291 LGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLIQRGKLD 350

Query: 332 AAQD-------IQTAVDSNLREDKIKTPDLG---GKNSTSDVV 364
           +  D       +++A  + ++ED+I T DL    GK   S  V
Sbjct: 351 STPDVVKFAELVESATVNTVQEDEIMTKDLALILGKTDRSSYV 393

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 96/204 (47%), Gaps = 16/204 (7%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKT 162
           V G+  PI+     +G +A+    ++ D    K   + +V    +    K+ + +  + T
Sbjct: 129 VPGWQKPII-----IGRHAHGDQYRATDAIIEKAGKLELVHRPADGSEPKILQVHEFKGT 183

Query: 163 GTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCK 222
           G R        ++ + R  A  +  +AL +  N     L ++ K+ +L Q DG F+++ +
Sbjct: 184 GARGVALAMYNTDESIRGFAHASFKLALSKRLN-----LFMSTKNTILKQYDGRFKDIFQ 238

Query: 223 EVF-ESNKTLYSD--IQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 279
           EV+ +  +T + D  I Y  ++ID MV ++ +    F V+   N  GD+LSD  A   GS
Sbjct: 239 EVYAQEYQTQFRDEGISYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQGFGS 297

Query: 280 LGVVPSANVGPG--IVIGEPCHGS 301
           LG++ S  V P       E  HG+
Sbjct: 298 LGLMTSMLVTPDGKTFESEAAHGT 321

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 136/298 (45%), Gaps = 44/298 (14%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDT--PGNKKVDMVIVRENTEDLYIKLEKTYIDE 160
           V G+  PI+     +G +A+    K+ D   PG  K+++V  + N +    ++ + Y  +
Sbjct: 133 VPGWEKPII-----IGRHAHGDQYKATDAVIPGQGKLELV-YKPNGDASKAEVMEVY--D 184

Query: 161 KTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREV 220
             G  VA A     E + R  A  +  +ALQ+      + L ++ K+ +L + DG F+++
Sbjct: 185 YKGPGVALAMYNTDE-SIRGFAHSSFKLALQK-----KLNLFLSTKNTILKKYDGRFKDI 238

Query: 221 CKEVFES---NKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALV 277
            +EV++S    K    +I Y  ++ID MV ++ +    F ++   N  GD+ SD  A   
Sbjct: 239 FQEVYDSEYKQKFAELNITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGF 297

Query: 278 GSLGVVPSANVGPG--IVIGEPCHGSAPDIAGKG------ISNPIATIRSTALMLEFLGH 329
           GSLG++ S  + P       E  HG+      K        +N IA+I +    L   G 
Sbjct: 298 GSLGLMTSILITPDGKTFESEAAHGTVTRHYRKHQQGEETSTNSIASIFAWTRGLAKRGE 357

Query: 330 SQAAQDI-------QTAVDSNLREDKIKTPDLG---GKN------STSDVVNDVIRRL 371
                D+       ++A  + +++D I T DL    GK       +T++ ++ V +RL
Sbjct: 358 LDGTPDVVRFANILESATLNTVQQDGIMTKDLALACGKTDRASYVTTTEFLDAVEKRL 415

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSD---IQY 237
            A+ + ++AL+R      + L  T K+ VL + DG F+++ +E++ES+  +  D   I Y
Sbjct: 195 FARASFEMALKR-----KMPLFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQFDEIGILY 249

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIG 295
             ++ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V P       
Sbjct: 250 EHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVAPDGKTFES 308

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 309 EAAHGT 314

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 128/286 (44%), Gaps = 39/286 (13%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDT--PGNKKVDMVIVREN-TEDLYIKLEKTYID 159
           V G+  PI+     +G +A+    K+ D   PG  K+ +    EN T    I L+   + 
Sbjct: 135 VPGWEKPII-----IGRHAHADQYKATDCLIPGPGKLHLKWTPENGTAGDAIDLQ---VY 186

Query: 160 EKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFRE 219
           +  G+ VA A     E + R  A  +  +AL +      + L ++ K+ +L + DG F++
Sbjct: 187 DYQGSGVALAMYNTDE-SIRGFAHSSFKLALTK-----KLNLFLSTKNTILKKYDGRFKD 240

Query: 220 VCKEVFESN-KTLYSD--IQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAAL 276
           + +E+F+   KT +++  I Y  ++ID MV ++ +    F ++   N  GD+ SD  A  
Sbjct: 241 IFQEIFDMEYKTKFANLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQG 299

Query: 277 VGSLGVVPSANVGPG--IVIGEPCHGSAPDIAGK------GISNPIATIRSTALMLEFLG 328
            GSLG++ S  V P       E  HG+      K        +N IA+I + +  L   G
Sbjct: 300 FGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRKFQKGEETSTNSIASIFAWSRGLAKRG 359

Query: 329 HSQAAQDI-------QTAVDSNLREDKIKTPDLG---GKNSTSDVV 364
                 D+       + A  + +++D I T DL    GK   S  V
Sbjct: 360 ELDGTPDVVRFANLLEAATLNTVQQDGIMTKDLALAQGKTDRSSYV 405

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 89/191 (46%), Gaps = 22/191 (11%)

Query: 196 NGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN-KTLYSD--IQYNEQIIDSMVYRLFRE 252
           N  + L +  K+ +L + DG F+++ ++++    K  +    I Y  ++ID MV ++ + 
Sbjct: 214 NKKLNLFLATKNTILKKYDGRFKDIFQQIYNGQYKAKFEQLGITYEHRLIDDMVAQMIKS 273

Query: 253 PECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIGEPCHGSAP------D 304
              F ++   N  GD+ SD  A   GSLG++ S  V P       E  HG+         
Sbjct: 274 KGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSPDGKTFESEAAHGTVTRHFRRHQ 332

Query: 305 IAGKGISNPIATIRSTALMLEFLGHSQAAQDI-------QTAVDSNLREDKIKTPDLG-- 355
           +  +  +N IA+I + +  L   G     +D+       + A   +++ED I T DL   
Sbjct: 333 MGEETSTNSIASIFAWSRGLAKRGELDGTKDVIAFANKLEAATLDSVQEDGIMTKDLALA 392

Query: 356 -GKNSTSDVVN 365
            GKN+ SD VN
Sbjct: 393 SGKNNRSDYVN 403

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 90/182 (49%), Gaps = 19/182 (10%)

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN-KTLYSD--IQYNEQIIDSMVYR 248
           +L  N  + L ++ K+ +L + DG F+++ +E++ES+ K+ + +  I Y  ++ID MV +
Sbjct: 209 KLAINKKLNLFLSTKNTILKKYDGRFKDIFQEIYESDYKSQFENLGISYEHRLIDDMVAQ 268

Query: 249 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIGEPCHGSAPDI- 305
           + +    F ++   N  GD+ SD  A   GSLG++ S  V P       E  HG+     
Sbjct: 269 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHY 327

Query: 306 ----AGKGIS-NPIATIRSTALMLEFLGHSQAAQDI-------QTAVDSNLREDKIKTPD 353
                GK  S N IA+I + +  L   G   +  D+       ++A  + +++D I T D
Sbjct: 328 RQYEQGKETSTNSIASIFAWSRGLAKRGELDSTPDVIKFANLLESATLNTVQQDGIMTKD 387

Query: 354 LG 355
           L 
Sbjct: 388 LA 389

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 97/213 (45%), Gaps = 27/213 (12%)

Query: 174 SEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFES---NKT 230
           ++ + R  A  +  +AL +      + L ++ K+ +L + DG F+++ +E+F++    + 
Sbjct: 202 TDESIRGFAHASFKLALSK-----KLDLFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQF 256

Query: 231 LYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP 290
             S IQY  ++ID MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V P
Sbjct: 257 EESGIQYQHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 315

Query: 291 G--IVIGEPCHGSAPDIAGK------GISNPIATIRSTALMLEFLGHSQAAQDI------ 336
                  E  HG+      K        +NPIA+I +    +   G      D+      
Sbjct: 316 DGKTFESEAAHGTVTRHYRKYQRGEETSTNPIASIFAWTRGIAKRGELDGTPDVVRFANI 375

Query: 337 -QTAVDSNLREDKIKTPDLG---GKNSTSDVVN 365
            ++A  + ++ED   T DL    GK   +  VN
Sbjct: 376 LESATLNTVQEDGKMTKDLAATLGKTDRASYVN 408

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 100/220 (45%), Gaps = 33/220 (15%)

Query: 179 RRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN---KTLYSDI 235
           R  A+ + ++ALQR      + L  T K+ +L + DG F++  + ++E+    +   + I
Sbjct: 192 RGFARASFELALQR-----KMPLYSTTKNTILKRYDGRFKDEFEAMYEAEYRERFERAGI 246

Query: 236 QYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IV 293
            Y  ++ID MV ++ +    F VI   N  GD+ SD  A   GSLG++ S  V P     
Sbjct: 247 WYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGRAF 305

Query: 294 IGEPCHGSAP-----DIAGKGIS-NPIATIRSTALMLEFLGHSQA-------AQDIQTAV 340
             E  HG+          GK  S N IA+I +    L   G           A+ ++TA 
Sbjct: 306 ESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLLQRGRLDGTPEVEGFARALETAT 365

Query: 341 DSNLREDKIKTPDLG---GKN------STSDVVNDVIRRL 371
            + + ED I T DL    G+       +T D ++ V +RL
Sbjct: 366 VATVNEDGIMTKDLALMLGRTDRASYVTTEDFIDAVEQRL 405

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 127/280 (45%), Gaps = 37/280 (13%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDT--PGNKKVDMVIVRENTEDLYIKLEKTYIDE 160
           V G+  PI+     +G +A+    K+ D   PG  K+++V   EN  +   K+ + Y  +
Sbjct: 133 VPGWEKPII-----IGRHAHGDQYKATDAVIPGPGKLELVYKPENGPE---KVMEVY--D 182

Query: 161 KTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREV 220
             G  VA A     E + R  A  +  +AL +  N     L ++ K+ +L + DG F+++
Sbjct: 183 YKGPGVALAMYNTEE-SIRGFAHASFKLALTKKLN-----LYLSTKNTILKKYDGRFKDI 236

Query: 221 CKEVFES---NKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALV 277
            +E++++    +   + I Y  ++ID MV ++ +    F ++   N  GD+ SD  A   
Sbjct: 237 FQELYDAEYKKQFEAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGF 295

Query: 278 GSLGVVPSANVGPG--IVIGEPCHGSA-----PDIAGKGIS-NPIATIRSTALMLEFLGH 329
           GSLG++ S  V P       E  HG+          GK  S N IA+I + +  L   G 
Sbjct: 296 GSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWSRGLAKRGE 355

Query: 330 -------SQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSD 362
                   + A  ++ A  + +++D I T DL      +D
Sbjct: 356 LDNTPQVVRFANILEAATLNTVQQDGIMTKDLALAGGNTD 395

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 123/286 (43%), Gaps = 39/286 (13%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDT--PGNKKVDMVIVRENTEDLYIKLEKTYIDE 160
           V G+  PI+     +G +A+    K+ D   PG   +D+V    +           ++ +
Sbjct: 139 VPGWEKPII-----IGRHAHGDQYKATDAVVPGAGTLDLVFRPADGS----APTSLHVYD 189

Query: 161 KTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREV 220
             G  VA A     E + R  A  +  +AL +  N     L ++ K+ +L Q DG F++V
Sbjct: 190 FAGPGVALAMYNTEE-SIRGFAHASFRLALAKQLN-----LFLSTKNTILKQYDGRFKDV 243

Query: 221 CKEVFESNKTLYSD---IQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALV 277
            +E++++      +   I Y  ++ID MV ++ +    F ++   N  GD+ SD  A   
Sbjct: 244 FEELYQAQYKAEFERLGIYYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGF 302

Query: 278 GSLGVVPSANVGPG--IVIGEPCHGSAP-----DIAGKGIS-NPIATIRSTALMLEFLGH 329
           GSLG++ S  V P       E  HG+         AGK  S N IA+I +    L   G 
Sbjct: 303 GSLGLMTSVLVTPDGKTFESEAAHGTVTRHFRQHQAGKETSTNSIASIFAWTRGLAKRGE 362

Query: 330 SQAAQDI-------QTAVDSNLREDKIKTPDLG---GKNSTSDVVN 365
                D+       + A  + ++ D I T DL    G++  S  VN
Sbjct: 363 LDNTPDVVNFAHALEAATTNTVQLDGIMTKDLALACGRSDRSAYVN 408

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 99/207 (47%), Gaps = 23/207 (11%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDT--PGNKKVDMVIVRENT-EDLYIKLEKTYID 159
           + G+  PI+     +G +A+    K+ DT  PG  K+ +  +  N  E+  I L+   + 
Sbjct: 137 IPGWEKPII-----IGRHAHADQYKATDTLIPGPGKLQLNFIPSNAQENSPITLD---VY 188

Query: 160 EKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFRE 219
           +  G+ VA A     E +    A  +  +A+ +      + L ++ K+ +L + DG F++
Sbjct: 189 DYKGSGVALAMYNTDE-SIEGFAHSSFKLAIDK-----KLNLFLSTKNTILKKYDGRFKD 242

Query: 220 VCKEVFESN---KTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAAL 276
           + + ++E++   K    +I Y  ++ID MV ++ +    F ++   N  GD+ SD  A  
Sbjct: 243 IFQSIYETHYKAKFQQLNINYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQG 301

Query: 277 VGSLGVVPSANVGPG--IVIGEPCHGS 301
            GSLG++ S  V P       E  HG+
Sbjct: 302 FGSLGLMTSILVTPDGKTFESEAAHGT 328

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFE---SNKTLYSDIQY 237
            AK + + AL+R      + L  T K+ +L Q DG F+++ +E++     +K    +I Y
Sbjct: 198 FAKASFEFALER-----KIPLYSTTKNTILKQYDGKFKDIFEEMYAKEYEDKFKVLNIWY 252

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP--GIVIG 295
             ++ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + P       
Sbjct: 253 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVVAQGFGSLGLMTSVLLTPDGSSFES 311

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 312 EAAHGT 317

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 64/130 (49%), Gaps = 11/130 (8%)

Query: 177 ATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN-KTLYSD- 234
           A    A+ +  +AL+R      + L  T K+ +L + DG F+ V ++++E   K  + D 
Sbjct: 190 AIEGFARSSFQLALER-----QLPLYSTTKNTILKKYDGKFKSVFEDMYEREYKQQFEDL 244

Query: 235 -IQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG-- 291
            I Y  ++ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V P   
Sbjct: 245 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAPDGK 303

Query: 292 IVIGEPCHGS 301
               E  HG+
Sbjct: 304 TFESEAAHGT 313

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 103/219 (47%), Gaps = 35/219 (15%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVF-ESNKTLYSD--IQY 237
            A+ + ++A++R      + L  T K+ +L + DG F+++ ++++ E  K  + +  I Y
Sbjct: 193 FARASFELAIKR-----KLPLFFTTKNTILKKYDGRFKDIFQKMYDEDYKGKFKELGISY 247

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIG 295
             ++ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + P   I   
Sbjct: 248 EHRLIDDMVAQMIKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLLTPDGKIFES 306

Query: 296 EPCHGSAPDI-----AGKGIS-NPIATIRSTALMLEFLGHSQAAQDI--------QTAVD 341
           E  HG+          GK  S N IATI + +  +   G      D+        ++ +D
Sbjct: 307 EAAHGTVTRHYRQYQKGKETSTNSIATIFAWSQGIIHRGKVDQTPDVRLFGEILERSTID 366

Query: 342 SNLREDKIKTPDLG---GKN------STSDVVNDVIRRL 371
           + ++ D I T DL    GK       ST + ++ V RRL
Sbjct: 367 T-VQIDGIMTKDLALILGKTERKDYASTEEFIDAVARRL 404

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 116/272 (42%), Gaps = 31/272 (11%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDTPGNKKVDMVI-VRENTEDLYIKLEKTYIDEK 161
           V G+  PI+  R   G   +      V  PG   + +V   ++  E   I L+     + 
Sbjct: 121 VSGWKEPIIIGRHAFG---DQYKATDVVIPGEGTLKLVFKSKDGDESKDIDLDVFEFPKD 177

Query: 162 TGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVC 221
            G  VA +    +E  T   AK + ++AL+R      + L  T K+ +L + DG F+++ 
Sbjct: 178 GG--VAMSMYNTAESITG-FAKSSFELALER-----KMPLYSTTKNTILKKYDGQFKDIF 229

Query: 222 KEVFE---SNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVG 278
           + ++E     K     I Y  ++ID MV ++ +    F +I   N  GD+ SD  A   G
Sbjct: 230 EGMYEREYKQKFEAVGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFG 288

Query: 279 SLGVVPSANVGPG--IVIGEPCHGSAP-----DIAGKGIS-NPIATIRSTALMLEFLGHS 330
           SLG++ S  V P       E  HG+          GK  S N IA+I + +  +   G  
Sbjct: 289 SLGLMTSVLVSPDGKTFESEAAHGTVTRHYRLHQQGKETSTNSIASIFAWSRGIIQRGKL 348

Query: 331 QAAQDI-------QTAVDSNLREDKIKTPDLG 355
               D+       ++A    ++ED I T DL 
Sbjct: 349 DGTPDVVKFGQLLESATLDTVQEDGIMTKDLA 380

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 128/286 (44%), Gaps = 39/286 (13%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVIVRENTEDLYIKLEKTYIDE 160
           V G+  PIV     +G +A+    K+ D   PG  K+++V   + T+    K  + Y  +
Sbjct: 140 VPGWEKPIV-----IGRHAHGDQYKATDLVVPGPGKLELVY--KPTDGSETKTLEVY--D 190

Query: 161 KTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREV 220
             G  +A A     E + R  A  +  +A+ +      + L ++ K+ +L + DG F+++
Sbjct: 191 YKGPGIALAMYNTDE-SIRGFAHASFKLAITK-----KLNLYLSTKNTILKKYDGRFKDI 244

Query: 221 CKEVFESN-KTLYSD--IQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALV 277
            +E+++S  K+ +    I Y  ++ID MV ++ +    F ++   N  GD+ SD  A   
Sbjct: 245 FQEIYDSEYKSEFEKLGIWYEHRLIDDMVAQMIKSKGGF-ILAFKNYDGDVQSDIVAQGF 303

Query: 278 GSLGVVPSANVGPG--IVIGEPCHGSAPDI-----AGKGIS-NPIATIRSTALMLEFLGH 329
           GSLG++ S  V P       E  HG+          GK  S N IA+I +    L   G 
Sbjct: 304 GSLGLMTSVLVTPDGKAFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAKRGE 363

Query: 330 -------SQAAQDIQTAVDSNLREDKIKTPDLG---GKNSTSDVVN 365
                   + A  ++ +  + ++ED I T DL    G    S  VN
Sbjct: 364 LDNTPEVVEFANLLEKSTLNTVQEDGIMTKDLALACGNTDRSSYVN 409

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 100/221 (45%), Gaps = 39/221 (17%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSD------ 234
            AK + ++AL+R      + L  T K+ +L + DG F+++ + ++ S+   Y D      
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKRYDGKFKDIFESMYASD---YQDKFEVIG 243

Query: 235 IQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--I 292
           I Y  ++ID MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  V P    
Sbjct: 244 IWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMSSVLVTPDGKT 302

Query: 293 VIGEPCHGSAP-----DIAGKGIS-NPIATIRSTALMLEFLGH-------SQAAQDIQTA 339
              E  HG+          GK  S N IA+I + +  +   G         +  Q ++ A
Sbjct: 303 FESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWSRGIIQRGKIDETPEVVKFGQLLEDA 362

Query: 340 VDSNLREDKIKTPDL---------GGKNSTSDVVNDVIRRL 371
             + ++ED I T DL         G   +T + ++ V +RL
Sbjct: 363 TTNTVQEDGIMTKDLALILGKTDRGSYVTTEEFIDAVEKRL 403

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 68/126 (53%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN-KTLYSD--IQY 237
            AK + ++AL+R      + L    K+ +L + DGLF+++ +++++ + KT + +  I +
Sbjct: 195 FAKSSFELALKR-----KLPLFFATKNTILKEYDGLFKDIFEKLYKDHYKTKFEELGITF 249

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGP--GIVIG 295
             ++ID MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  V P   +   
Sbjct: 250 EHRLIDDMVAQMLKSNGGF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDSVFES 308

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 309 EAAHGT 314

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 86/193 (44%), Gaps = 24/193 (12%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN---KTLYSDIQY 237
            AK + ++ALQR      + L  T K+ +L + DG F+++ + ++ +    K   + I Y
Sbjct: 194 FAKSSFELALQR-----KMPLYSTTKNTILKKYDGKFKDIFEGMYAAEYKEKFEAAGIWY 248

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIG 295
             ++ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V P       
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 296 EPCHGSAP-----DIAGKGIS-NPIATIRSTALMLEFLGHSQAAQDI-------QTAVDS 342
           E  HG+          GK  S N IA+I +    +   G      D+       + +   
Sbjct: 308 EAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGIIHRGKVDGTPDVVKFGELLEKSTLD 367

Query: 343 NLREDKIKTPDLG 355
            ++ED I T DL 
Sbjct: 368 TVQEDNIMTKDLA 380

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 68/288 (23%), Positives = 124/288 (43%), Gaps = 38/288 (13%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDT--PGNKKVDMVIVRENTEDLYIKLEKTYIDE 160
           V G+  PI+     +G +A+    ++ DT  PG  K+++V                ++ +
Sbjct: 129 VPGWQQPII-----IGRHAHGDQYRATDTLVPGPGKLELVF--RPAGRGAAAARTLHVHD 181

Query: 161 KTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREV 220
             G  VA A     E + R  A  +  +AL +  N     L +  K+ +L Q DG F+++
Sbjct: 182 FEGAGVALAMYNTDE-SIRGFAHASFRLALSKQLN-----LFLATKNTILKQYDGRFKDL 235

Query: 221 CKEVFESN-KTLY--SDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALV 277
            ++++++  +  +  + I Y  ++ID MV ++ +    F V+   N  GD+ SD  A   
Sbjct: 236 FQQLYDAEYREAFERAGISYEHRLIDDMVAQMIKSRGGF-VLALKNYDGDVQSDIVAQGF 294

Query: 278 GSLGVVPSANVGP--GIVIGEPCHGS----------APDIAGKGISNPIATIRSTALMLE 325
           GSLG++ S  + P       E  HG+            + +   I++  A  R  A   +
Sbjct: 295 GSLGLMSSVLITPDGNAFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLARRAD 354

Query: 326 FLGH---SQAAQDIQTAVDSNLREDKIKTPDL----GGKNSTSDVVND 366
             G    +  A  ++ A    +++D I T DL    G  + T+ V  D
Sbjct: 355 LDGTPAVADFAHALEGATLRTVQDDAIMTKDLALACGKTDRTAYVTTD 402

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 66/126 (52%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVF-ESNKTLYSD--IQY 237
            AK + ++AL+R      + L  T K+ +L + DG F++V ++++ +  ++ + +  I Y
Sbjct: 191 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEQMYADQYQSRFEELGIWY 245

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIG 295
             ++ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V P       
Sbjct: 246 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLVTPDGKTFES 304

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 305 EAAHGT 310

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN-KTLYSD--IQY 237
            A+ +  +A++R      + L  T K+ +L Q DG F+++ K V+E+  K  + +  I Y
Sbjct: 190 FARASFTMAIER-----KLPLYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEELGIWY 244

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIG 295
             ++ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +         
Sbjct: 245 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGKTFES 303

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 304 EAAHGT 309

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 61/115 (53%), Gaps = 6/115 (5%)

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN-KTLYSD--IQYNEQIIDSMVYR 248
           +L  +  + L ++ K+ +L + DG F+++ +EV+E+  K+ +    I Y  ++ID MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQ 274

Query: 249 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIGEPCHGS 301
           + +    F ++   N  GD+ SD  A   GSLG++ S  V P       E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN-KTLYSD--IQY 237
            A+ + ++ALQR      + L  T K+ +L + DG F++V + ++ +  ++ + +  I Y
Sbjct: 192 FARASFELALQR-----RMPLYSTTKNTILKKYDGKFKDVFEAMYAAEYQSRFEELGIWY 246

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIG 295
             ++ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V P       
Sbjct: 247 EHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 61/115 (53%), Gaps = 6/115 (5%)

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN-KTLYSD--IQYNEQIIDSMVYR 248
           +L  +  + L ++ K+ +L + DG F+++ +EV+E+  K+ +    I Y  ++ID MV +
Sbjct: 216 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAEYKSKFEKLGIHYEHRLIDDMVAQ 275

Query: 249 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIGEPCHGS 301
           + +    F ++   N  GD+ SD  A   GSLG++ S  V P       E  HG+
Sbjct: 276 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 329

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 97/218 (44%), Gaps = 33/218 (15%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN---KTLYSDIQY 237
            AK + ++A++R      + L  T K+ +L + DG F++V + ++  N   K     I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESLGIWY 246

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIG 295
             ++ID MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  + P       
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGKTFES 305

Query: 296 EPCHGSAP-----DIAGKGIS-NPIATIRSTALMLEFLGHSQAAQDI-------QTAVDS 342
           E  HG+          GK  S N IA+I +    +   G      D+       ++A  +
Sbjct: 306 EAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGEILESATVN 365

Query: 343 NLREDKIKTPDLG---GKN------STSDVVNDVIRRL 371
            ++ED I T DL    GK       +T D ++ V  RL
Sbjct: 366 TVQEDGIMTKDLALILGKTERSAYVTTEDFIDAVESRL 403

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 98/209 (46%), Gaps = 28/209 (13%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVIVREN---TEDLYIKLEKTY 157
           V  +  PI+     +G +A+    K  D   PG  K++M+   ++    +D+Y    K Y
Sbjct: 136 VSTWEKPII-----IGRHAHADQYKCSDFIVPGEGKLEMIFTPKDPSKAKDVY----KVY 186

Query: 158 IDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLF 217
             +  G  +       ++ + R  A  + ++A+     N N+ L +  K+ +L + DG F
Sbjct: 187 DFKGPGVGMGMYN---TDDSIRGFAYSSFNLAV-----NKNMNLFLATKNTILKKYDGRF 238

Query: 218 REVCKEVFESN-KTLYS--DIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAA 274
           +++ +E++E+  K  +   +I Y  ++ID MV ++ +    + ++   N  GD+ SD  A
Sbjct: 239 KDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQMIKSKGGY-IMALKNYDGDVQSDIVA 297

Query: 275 ALVGSLGVVPSANVGPG--IVIGEPCHGS 301
              GSLG++ S    P       E  HG+
Sbjct: 298 QGFGSLGLMTSILASPDGKTFESEAAHGT 326

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN-KTLYSD--IQY 237
            AK +  +A++R      + L  T K+ +L + DG+F+++ + ++E   K  + +  I Y
Sbjct: 195 FAKASFQLAVER-----KMPLYSTTKNTILKKYDGMFKDIFEGMYEREYKEKFEELGIWY 249

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIG 295
             ++ID MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  + P       
Sbjct: 250 EHRLIDDMVAQMLKSSGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFES 308

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 309 EAAHGT 314

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 93/206 (45%), Gaps = 27/206 (13%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVF-ESNKTLYSD--IQY 237
            AK + ++A++R      + L  T K+ +L + DG F++V + ++ ES K  +    I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESLGIWY 246

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIG 295
             ++ID MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  + P       
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 296 EPCHGSAP-----DIAGKGIS-NPIATIRSTALMLEFLGHSQAAQDI-------QTAVDS 342
           E  HG+          GK  S N IA+I +    +   G      D+       ++A  +
Sbjct: 306 EAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILESATVN 365

Query: 343 NLREDKIKTPDLG---GKNSTSDVVN 365
            ++ED I T DL    GK   S  V 
Sbjct: 366 TVQEDGIMTKDLALILGKTERSAYVT 391

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 131/287 (45%), Gaps = 43/287 (14%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDT----PGNKKVDMVIVRENTEDLYIKLEKTYI 158
           V G+  PI+     +G +A+    K+ DT    PG  K+++V   E+  +    LE   +
Sbjct: 133 VPGWEKPII-----IGRHAHADQYKATDTLVAKPG--KLELVHRPEDGSEP-TTLE---V 181

Query: 159 DEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFR 218
            +  G  VA A     E + R     +  +AL +      + L ++ K+ +L + DG F+
Sbjct: 182 YDYKGPGVALAMYNTDE-SIRGFGHASFKLALDK-----KLNLYLSTKNTILKKYDGRFK 235

Query: 219 EVCKEVFESN-KTLY--SDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAA 275
           ++ +E++++  K  +  + I Y  ++ID MV ++ +    F ++   N  GD+ SD  A 
Sbjct: 236 DIFQELYDTQYKAEFEKAGIFYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQ 294

Query: 276 LVGSLGVVPSANVGPG--IVIGEPCHGSAP-----DIAGKGIS-NPIATIRSTALMLEFL 327
             GSLG++ S  + P       E  HG+          G+  S N IA+I + +  L   
Sbjct: 295 GFGSLGLMTSVLITPDGKTFESEAAHGTVTRHYRQHQQGRETSTNSIASIFAWSRGLAKR 354

Query: 328 GH-------SQAAQDIQTAVDSNLREDKIKTPDLG---GKNSTSDVV 364
           G        ++ A  +++A    +++D I T DL    GKN  S  V
Sbjct: 355 GELDSTPEVTKFANLLESATLDTVQKDGIMTKDLAFACGKNDRSAWV 401

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN---KTLYSDIQY 237
            AK + ++AL+R      + L  T K+ +L   D  F+E+  ++F++    K     I Y
Sbjct: 192 FAKASFELALKR-----RLPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIG 295
             ++ID MV ++ +    F ++   N  GD+ SD  A   GSLG++ S  + P       
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN-KTLYSD--IQY 237
            AK + ++AL+R +      L  T K+ +L + DG F+++ + ++E   ++ +    I Y
Sbjct: 193 FAKASFELALERKQ-----PLYSTTKNTILKKYDGKFKDIFEAMYEKEYRSQFEKLGIWY 247

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIG 295
             ++ID MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  V P       
Sbjct: 248 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFES 306

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 307 EAAHGT 312

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 62/131 (47%), Gaps = 21/131 (16%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFR--------EVCKEVFESNKTLY 232
            AK + ++AL+R      + L  T K+ +L + DG F+        EV KE FE+     
Sbjct: 192 FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEA----- 241

Query: 233 SDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG- 291
             I Y  ++ID MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  + P  
Sbjct: 242 LGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDG 300

Query: 292 -IVIGEPCHGS 301
                E  HG+
Sbjct: 301 KTFESEAAHGT 311

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 63/130 (48%), Gaps = 11/130 (8%)

Query: 177 ATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSD-- 234
           + R  A+ + ++AL+       + L  T K+ +L + DG F++  + ++E+      +  
Sbjct: 188 SIRGFARASFNMALEH-----EMPLYSTTKNTILKKYDGKFKDTFESMYEAEYKEQFEAK 242

Query: 235 -IQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG-- 291
            I Y  ++ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + P   
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISPDGK 301

Query: 292 IVIGEPCHGS 301
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 59/126 (46%), Gaps = 11/126 (8%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN---KTLYSDIQY 237
            AK + ++AL+R      + L  T K+ +L   D  F+++   +F+     K     I Y
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQALKITY 246

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIG 295
             ++ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + P       
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 296 EPCHGS 301
           E  HG+
Sbjct: 306 EAAHGT 311

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 62/129 (48%), Gaps = 17/129 (13%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSD------ 234
            AK + ++AL+R      + L  T K+ +L   D  F+++  ++F++    Y +      
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDKLFDAE---YKEQFQALG 243

Query: 235 IQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--I 292
           I Y  ++ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + P    
Sbjct: 244 ITYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKT 302

Query: 293 VIGEPCHGS 301
              E  HG+
Sbjct: 303 FESEAAHGT 311

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 61/115 (53%), Gaps = 6/115 (5%)

Query: 192 RLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESN-KTLYS--DIQYNEQIIDSMVYR 248
           +L  +  + L ++ K+ +L + DG F+++ ++V+E+  K+ +    I Y  ++ID MV +
Sbjct: 215 KLAIDKKLNLFLSTKNTILKKYDGRFKDIFQKVYEAQYKSKFEALGIHYEHRLIDDMVAQ 274

Query: 249 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIGEPCHGS 301
           + +    F ++   N  GD+ SD  A   GSLG++ S  V P       E  HG+
Sbjct: 275 MIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 88/187 (47%), Gaps = 22/187 (11%)

Query: 199 VQLTVTHKSNVLSQSDGLFREVCKEVFESN-KTLYSD--IQYNEQIIDSMVYRLFREPEC 255
           + L ++ K+ +L + DG F+++ + ++E+  K  + +  I Y  ++ID MV ++ +    
Sbjct: 223 LNLFLSTKNTILKKYDGRFKDIFQNIYEAQYKPKFEELGIHYEHRLIDDMVAQMVKSKGG 282

Query: 256 FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIGEPCHGSAPDIAGK----- 308
           F ++   N  GD+ SD  A   GSLG++ S  V P       E  HG+      K     
Sbjct: 283 F-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRKYQQGE 341

Query: 309 -GISNPIATIRSTALMLEFLGH-------SQAAQDIQTAVDSNLREDKIKTPDLG---GK 357
              +N IA+I + +  L   G         + A  +++A  + +++D I T DL    GK
Sbjct: 342 ETSTNSIASIFAWSRGLLKRGELDNTPSLCKFANILESATLNTVQQDGIMTKDLALACGK 401

Query: 358 NSTSDVV 364
           N  S  V
Sbjct: 402 NDRSAYV 408

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 93/206 (45%), Gaps = 27/206 (13%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVF-ESNKTLYSD--IQY 237
            AK + ++A++R      + L  T K+ +L + DG F++V + ++  S K  +    I Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESLGIWY 246

Query: 238 NEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IVIG 295
             ++ID MV ++ +    + +I   N  GD+ SD  A   GSLG++ S  + P       
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 296 EPCHGSAP-----DIAGKGIS-NPIATIRSTALMLEFLGHSQAAQDI-------QTAVDS 342
           E  HG+          GK  S N IA+I +    +   G      D+       ++A  +
Sbjct: 306 EAAHGTVTRHFRQHQQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILESATVN 365

Query: 343 NLREDKIKTPDLG---GKNSTSDVVN 365
            ++ED I T DL    GK+  S  V 
Sbjct: 366 TVQEDGIMTKDLALILGKSERSAYVT 391

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 97/211 (45%), Gaps = 33/211 (15%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVIVREN-----TEDLYIKLEK 155
           + G+  PI+     +G +A+    K+ D   PG  K++++    +     T D+Y     
Sbjct: 135 IPGWEKPII-----IGRHAHGDQYKATDLLVPGAGKLELLYRPADGSTPTTLDVY----- 184

Query: 156 TYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDG 215
               E   + +A A     E + R  A  +  +AL +      + L ++ K+ +L   DG
Sbjct: 185 ----EYKDSGIAMAMYNTDE-SIRGFAHASFKLALTK-----KLNLFLSTKNTILKTYDG 234

Query: 216 LFREVCKEVFESN-KTLYSD--IQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDG 272
            F+++ +E++++  KT + +  I Y  ++ID MV ++ +    F ++   N  GD+ SD 
Sbjct: 235 RFKDIFQELYDTQYKTEFENHGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDI 293

Query: 273 AAALVGSLGVVPSANVGPG--IVIGEPCHGS 301
            A   GSLG++ S    P       E  HG+
Sbjct: 294 VAQGFGSLGLMTSILATPDGKTFESEAAHGT 324

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 61/131 (46%), Gaps = 21/131 (16%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSD--------GLFREVCKEVFESNKTLY 232
            AK + ++AL+R      + L  T K+ +L   D        GLF E  +E F++     
Sbjct: 192 FAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDGLFNEKYREKFQA----- 241

Query: 233 SDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG- 291
             I+Y  ++ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  V P  
Sbjct: 242 LGIKYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTPDG 300

Query: 292 -IVIGEPCHGS 301
                E  HG+
Sbjct: 301 KTFESEAAHGT 311

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 85/201 (42%), Gaps = 41/201 (20%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKT 162
           V G+  PI+  R   G                K  DMVI  +N + + +KL  T  D KT
Sbjct: 121 VPGWEKPIIIGRHAYG-------------DQYKAADMVIPEDNNKGI-VKLVYTSDDGKT 166

Query: 163 GTRVA--------DATKRISEVATRR----IAKIALDIALQRLKNNGNVQLTVTHKSNVL 210
              +         D    +    T R     A  + + AL++      + L  T K+ +L
Sbjct: 167 NIELPVHQFDGNDDGGIALGMFNTTRSIKGFAHSSFEFALEK-----GLPLYSTTKNTIL 221

Query: 211 SQSDGLFREVCKEVFESNKTLYSD------IQYNEQIIDSMVYRLFREPECFDVIVAPNL 264
            + DG ++++  +++E +   Y D      I Y  ++ID MV ++ +    F VI   N 
Sbjct: 222 KKYDGQYKDIFNDMYEKD---YKDKFEAKGIWYEHRLIDDMVAQMLKSKGGF-VIAMKNY 277

Query: 265 YGDILSDGAAALVGSLGVVPS 285
            GD+ SD  A   GSLG++ S
Sbjct: 278 DGDVQSDVVAQGFGSLGLMSS 298

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 92/205 (44%), Gaps = 17/205 (8%)

Query: 103 VEGYSSPIVALRKELGLYANIRPVKSVDTPGNKKVDMVIV-RENTEDLYIKLEKTYIDEK 161
           V  +  PI+  R     Y +      ++ P NK + ++I  + + ED  I    ++ ++ 
Sbjct: 121 VSNWEKPIIIGRHA---YGDQYKATDLEIPPNKDIKLLIQDKADKEDSKIINVFSFPNDG 177

Query: 162 TGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVC 221
           TG         +  +  +  AK +  +AL+R      + L +  K+ +L + DG F+ + 
Sbjct: 178 TGGIAMVMYNTVDSI--KGFAKASFIMALKR-----KLPLFLATKNTILKKYDGRFKSIF 230

Query: 222 KEVFESN---KTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVG 278
            +++++    K     + Y  ++ID MV ++ +    F +I   N  GD+ SD  A   G
Sbjct: 231 DDMYQNEFKEKFEKLGLTYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFG 289

Query: 279 SLGVVPSANVGPG--IVIGEPCHGS 301
           SLG++ S  + P       E  HG+
Sbjct: 290 SLGLMTSQLITPDGKTFQSEAAHGT 314

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 71/151 (47%), Gaps = 23/151 (15%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSD------ 234
            A+ +  +A+++      + L  T K+ +L + DG F+++  E++ +    Y D      
Sbjct: 196 FARASFQMAIKK-----KIPLYFTTKNTILKKYDGTFKDIFMEMYLNE---YKDEFDKLG 247

Query: 235 IQYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--I 292
           I Y  ++ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  + P    
Sbjct: 248 IFYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKT 306

Query: 293 VIGEPCHGSAP-----DIAGKGIS-NPIATI 317
              E  HG+         AGK  S N IA+I
Sbjct: 307 FQSEAAHGTVTRHYRLHQAGKPTSTNSIASI 337

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 15/128 (11%)

Query: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVF-----ESNKTLYSDI 235
            A+ + + AL+R      + L  T K+ +L + DG F+++ + ++     E  K L  +I
Sbjct: 203 FARSSFEFALER-----KLPLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKAL--NI 255

Query: 236 QYNEQIIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPG--IV 293
            Y  ++ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S  +       
Sbjct: 256 WYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTF 314

Query: 294 IGEPCHGS 301
             E  HG+
Sbjct: 315 ESEAAHGT 322

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 31/50 (62%)

Query: 322 LMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371
           LML  LG +++A  I  AV   + E K  T D+GG +ST+D  N++I +L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 53/104 (50%), Gaps = 9/104 (8%)

Query: 185 ALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSD---IQYNEQI 241
           +  +AL+R      + L  T K+ +L + DG F+++ + ++E       +   I Y  ++
Sbjct: 204 SFKLALER-----KMPLYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELGIWYEHRL 258

Query: 242 IDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPS 285
           ID MV ++ +    F +I   N  GD+ SD  A   GSLG++ S
Sbjct: 259 IDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTS 301

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,494,762
Number of extensions: 1604143
Number of successful extensions: 4927
Number of sequences better than 10.0: 149
Number of HSP's gapped: 4739
Number of HSP's successfully gapped: 149
Length of query: 371
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 260
Effective length of database: 40,753,473
Effective search space: 10595902980
Effective search space used: 10595902980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)