Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C034002.286ON49449426340.0
Kpol_1003.382.286ON49649719260.0
NDAI0G006602.286ON49649718650.0
NCAS0G037902.286ON49249617730.0
KAFR0H033102.286ON48849617650.0
Suva_14.3252.286ON49049317630.0
Skud_14.3072.286ON49049317610.0
TDEL0G021702.286ON48449217560.0
YNL022C2.286ON49049417340.0
KLLA0E08361g2.286ON49149617170.0
KNAG0H020002.286ON49849817100.0
SAKL0E07678g2.286ON47749316940.0
TBLA0B069602.286ON50850916970.0
Smik_14.3092.286ON49049316820.0
CAGL0M06941g2.286ON49250016770.0
ZYRO0A01892g2.286ON46549416560.0
KLTH0G10362g2.286ON52949316470.0
Kwal_27.115322.286ON47949516350.0
ADL215W2.286ON48449515910.0
Ecym_33252.286ON49649715700.0
AFR179C8.171ON7002991536e-10
ZYRO0A01562g2.247ON6172021536e-10
SAKL0E08624g2.247ON6112071501e-09
TBLA0E038502.247ON6322841473e-09
ADL254W2.247ON6032111464e-09
Kpol_1003.152.247ON6332111464e-09
CAGL0J10032g2.247ON6192841464e-09
KNAG0I018702.247ON6292841455e-09
KLLA0F03399g2.247ON6192071448e-09
TPHA0C031502.247ON6082111438e-09
KLTH0G09460g2.247ON6372071439e-09
NCAS0G030302.247ON4902821421e-08
Ecym_32842.247ON6062111421e-08
NDAI0D010502.247ON6252821421e-08
KAFR0J009702.247ON6102461421e-08
Kwal_23.48412.247ON6272161402e-08
Skud_14.2712.247ON6192091393e-08
TDEL0C041502.247ON6142071393e-08
Smik_14.2662.247ON6182141393e-08
Suva_14.2802.247ON6202091383e-08
YNL061W (NOP2)2.247ON6182091383e-08
TPHA0C028708.171ON6743021359e-08
NCAS0B043908.171ON6713041322e-07
ZYRO0G08998g8.171ON6833011322e-07
TPHA0H001508.171ON6493001312e-07
TDEL0B043908.171ON6733051294e-07
Ecym_23538.171ON6902941295e-07
KNAG0G015108.171ON6662951287e-07
KNAG0D020508.171ON6823041279e-07
Kpol_1002.1098.171ON6703021261e-06
NDAI0B018308.171ON6863051252e-06
NCAS0B056408.171ON6593021232e-06
YBL024W (NCL1)8.171ON6842991223e-06
Suva_2.978.171ON6702991223e-06
SAKL0H19448g8.171ON6912981215e-06
Skud_2.818.171ON6813021199e-06
NDAI0B029808.171ON6793011171e-05
Smik_2.928.171ON6743021171e-05
KAFR0B022208.171ON6862961162e-05
KLTH0H08096g8.171ON6882971162e-05
KLLA0F12562g8.171ON7043021116e-05
CAGL0K01991g8.171ON6722951116e-05
TBLA0A087408.171ON6863041081e-04
Smik_6.4746.1ON318111800.31
YPL266W (DIM1)6.1ON318111790.32
Skud_16.116.1ON318111790.35
Suva_16.396.1ON318111790.35
Kwal_14.20818.171ON272120780.39
KAFR0B066506.174ON57293790.41
Ecym_30036.1ON319111780.46
KAFR0B064506.1ON318111780.52
Kpol_449.126.1ON319111760.75
ZYRO0F00308g6.1ON319111760.94
CAGL0L07678g6.1ON317111751.2
SAKL0E00660g6.1ON322111741.4
Smik_13.3896.263ON198118722.0
NDAI0K009508.753ON1730111742.2
ACR026W6.1ON319111722.4
NDAI0I027106.1ON319111722.6
NCAS0D022506.1ON319111722.6
KLLA0D00594g6.1ON320111713.7
TDEL0G04970singletonON38187697.0
Kwal_27.118928.507ON73959697.4
Smik_25.2singletonON78539697.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C03400
         (494 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...  1019   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   746   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   723   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   687   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   684   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   683   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   682   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   681   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   672   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   665   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   663   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   657   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   658   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   652   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   650   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   642   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   639   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   634   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   617   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   609   0.0  
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    64   6e-10
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    64   6e-10
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    62   1e-09
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    61   3e-09
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    61   4e-09
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    61   4e-09
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    61   4e-09
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    60   5e-09
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    60   8e-09
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    60   8e-09
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    60   9e-09
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    59   1e-08
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    59   1e-08
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    59   1e-08
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    59   1e-08
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    59   2e-08
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    58   3e-08
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    58   3e-08
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    58   3e-08
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    58   3e-08
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    58   3e-08
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    57   9e-08
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    55   2e-07
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    55   2e-07
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    55   2e-07
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    54   4e-07
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    54   5e-07
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    54   7e-07
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    54   9e-07
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    53   1e-06
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    53   2e-06
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    52   2e-06
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    52   3e-06
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    52   3e-06
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    51   5e-06
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    50   9e-06
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    50   1e-05
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    50   1e-05
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    49   2e-05
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    49   2e-05
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    47   6e-05
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    47   6e-05
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    46   1e-04
Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}...    35   0.31 
YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essentia...    35   0.32 
Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W (R...    35   0.35 
Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W (R...    35   0.35 
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    35   0.39 
KAFR0B06650 Chr2 complement(1386066..1387784) [1719 bp, 572 aa] ...    35   0.41 
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    35   0.46 
KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {...    35   0.52 
Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON} ...    34   0.75 
ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}...    34   0.94 
CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {...    33   1.2  
SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}...    33   1.4  
Smik_13.389 Chr13 (612617..613213) [597 bp, 198 aa] {ON} YMR184W...    32   2.0  
NDAI0K00950 Chr11 (215066..220258) [5193 bp, 1730 aa] {ON} Anc_8...    33   2.2  
ACR026W Chr3 (404011..404970) [960 bp, 319 aa] {ON} Syntenic hom...    32   2.4  
NDAI0I02710 Chr9 (636403..637362) [960 bp, 319 aa] {ON} Anc_6.1 ...    32   2.6  
NCAS0D02250 Chr4 (419581..420540) [960 bp, 319 aa] {ON} Anc_6.1 ...    32   2.6  
KLLA0D00594g Chr4 complement(57894..58856) [963 bp, 320 aa] {ON}...    32   3.7  
TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {O...    31   7.0  
Kwal_27.11892 s27 complement(991891..994110) [2220 bp, 739 aa] {...    31   7.4  
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     31   7.6  

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/494 (100%), Positives = 494/494 (100%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
           PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP
Sbjct: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300
           GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR
Sbjct: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300

Query: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360
           TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE
Sbjct: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360

Query: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420
           SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI
Sbjct: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420

Query: 421 DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPKED 480
           DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPKED
Sbjct: 421 DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPKED 480

Query: 481 GGIGFFAVCFERDI 494
           GGIGFFAVCFERDI
Sbjct: 481 GGIGFFAVCFERDI 494

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/497 (73%), Positives = 442/497 (88%), Gaps = 5/497 (1%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           M+FYRD+TWVLE+LEKE+AK KISGS+Q +VLKSCK YKV+SNP+H+YA ++SCWK KPY
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           LE +MK+SGIL++IP K GKP+FERLT+LLLCHDLL SKSKRIQMGKHP+K Y+LKYKT 
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           L SE+VKL++K+K++   +LI  ++  +DITPVRW RINPIR    KG+E I+ EL KKF
Sbjct: 121 LHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKKF 180

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
           PTRV+HWS I  GTIYHD++IPNLFGVHTKDKITSHELYK GK+IIQDRASCFPAH+LNP
Sbjct: 181 PTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILNP 240

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300
           GK+DIVID+CAAPGNKTTHTA+YILGGP KDQ  QI+AFEKDPERAK+LQ M++ AGC+ 
Sbjct: 241 GKNDIVIDACAAPGNKTTHTASYILGGPKKDQTTQIYAFEKDPERAKILQHMIKVAGCSN 300

Query: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKE---GEDVDEDD 357
           TI+VNVGDFTKIATPEKF+NVTGFIVDPSCSGSGIFGRK++D++NKKK+   G++ ++DD
Sbjct: 301 TIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQDD 360

Query: 358 ESESIPVEQDEEFS-KKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENE 416
           E +++P EQ+EEF  K+DDLKTRLSKLASFQFQVVKHAM+FPKA+K+VYSTCSIHAEENE
Sbjct: 361 E-DAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEENE 419

Query: 417 RVVIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRAL 476
            VVIDLLLD+ +++ GW+VA R +VIPTWPRRG+  EF +VFRD++EKC+E+A GCIR L
Sbjct: 420 GVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRVL 479

Query: 477 PKEDGGIGFFAVCFERD 493
           PKEDGGIGFFAVCFER+
Sbjct: 480 PKEDGGIGFFAVCFERN 496

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/497 (66%), Positives = 430/497 (86%), Gaps = 6/497 (1%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           MNFYRDATWVLE++E+++AKG+ISGS+Q++VL+SC  YK++ NPKH+YAV+ SCWKYKPY
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           LE +MKKSGIL++IPKK GKP + RLT++LLCHDLLFSKSKRIQMGKHP+KEYVLK+K+ 
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           L SE+V+L++K+K+K+  +++ + D   D+TPVRW RINP+R    + V  +LEEL KKF
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKKF 180

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
           P RV++W+ I  G+IY+DE+IP+L+G+H +DKITSHELYKQGKIIIQDRASCFPAH+LNP
Sbjct: 181 PKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYILG-GPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCA 299
            KDDI+ID+CAAPGNKTTH A+Y+ G    +D  +QI+AFEKDPERAK+L+KM++ AGC+
Sbjct: 241 SKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGCS 300

Query: 300 RTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDED--- 356
           + I+V VGDFTK ATP+KFK+VTGFIVDPSCSGSGIFGRK++D+LN+++  +  D+D   
Sbjct: 301 KNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKKS 360

Query: 357 -DESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEEN 415
            +E + +P EQ E+++KK+DLKTRL+KL+SFQFQV+KHAM+FP A+K+VYSTCSIHAEEN
Sbjct: 361 TEEDDEVPDEQ-EDYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAEEN 419

Query: 416 ERVVIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRA 475
           ERVV+DLLLD  +K+ GW+VA +E VIPTWPRRG ++EF+EVFRDD  KC+ +A GCIRA
Sbjct: 420 ERVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCIRA 479

Query: 476 LPKEDGGIGFFAVCFER 492
           LP++DGGIGFFAVCFER
Sbjct: 480 LPRDDGGIGFFAVCFER 496

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/496 (68%), Positives = 427/496 (86%), Gaps = 8/496 (1%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           M FYRDATWVLEF+E+EDAKG+ISGS+Q++V +SCK YK++ NPKH+YAV+ SCWKYKPY
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           LE +MKKSGIL+ IPK+ GKP + RLT++L+CHDLLFSK+KRIQMGK P+K YVLK+K+ 
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           L SE+VKL++K+K+K+  +L+S+ D  ND+TPVRW RINP+R      VE    E++KKF
Sbjct: 121 LHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRC----DVEATKLEIQKKF 176

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
           PTRV++WS I  G+IY+DE+IPNLFG+H +DKITSH LYKQGKIIIQDRASCFPAH+L+P
Sbjct: 177 PTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHP 236

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300
            ++D+VID CAAPGNKTTHTA+Y++  PSKD KIQI+AFEK+PERAK+L KM++ AGC++
Sbjct: 237 DENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSK 296

Query: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGED--VDEDDE 358
            I++NVGDFTKIA PEK+K+VTGFIVDPSCSGSGIFGRKFID+LN+KK  +D    ++ +
Sbjct: 297 NIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNKDEADKKEGD 356

Query: 359 SESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERV 418
            E    ++ EE++K++DLKTRLSKL+SFQFQVVKHAM+FP A+K+VYSTCSIHAEENERV
Sbjct: 357 EEEEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERV 416

Query: 419 VIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDD--EEKCKEIAGGCIRAL 476
           VIDL+LD  +K+ GW+VA R KVIPTWPRRG V+EF+EVFR+D    KC+E+AGGCIRAL
Sbjct: 417 VIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRAL 476

Query: 477 PKEDGGIGFFAVCFER 492
           P+ DGGIGFFAVCFER
Sbjct: 477 PRSDGGIGFFAVCFER 492

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/496 (66%), Positives = 416/496 (83%), Gaps = 10/496 (2%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           M FYRDATWVLE++E++D+KG+ISGS+QS+VLKSC+ YK+++NPKHIYAV+ SCWKYKP+
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           LE +M KSGIL +IPKK GKP + RLT+LLL HDLL SK KRIQMGKHP+K +VL+YK+ 
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           L SE+VKL++K K++   +L+ + D +NDITPVRWFRINP+R P       +++ELEKKF
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCP---DASAVMKELEKKF 177

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
           P RV+ W  I  G+IYHDEFIP LFG+H +DKITSHELYKQG+IIIQDRASCFPAH+LNP
Sbjct: 178 PQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNP 237

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300
             +D +ID+C+APGNKTTH A+Y+ G    D  ++I AFEKDPERAKVLQKM++ AGC++
Sbjct: 238 TLEDKIIDACSAPGNKTTHVASYMFGNGLVDD-VRIFAFEKDPERAKVLQKMIKVAGCSK 296

Query: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360
            I VNVGDFTK+ATP KF +VTGFIVDPSCSGSGIFGRK+ID+LN++K+ +D+ ++    
Sbjct: 297 QISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDN---- 352

Query: 361 SIPVEQDEEFSKKD-DLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVV 419
            +P EQ+E   K++ +L+ RLSKL+SFQFQVVKHAM+FPKA+++VYSTCSIHAEENERV 
Sbjct: 353 GVPDEQEEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVA 412

Query: 420 IDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRD-DEEKCKEIAGGCIRALPK 478
           +DLLLDE +K+ GW++A RE VIP WPRRG+V EF+E+FRD    +C+E+A GCIRALP+
Sbjct: 413 LDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPR 472

Query: 479 EDGGIGFFAVCFERDI 494
           EDGGIGFFA+CFERDI
Sbjct: 473 EDGGIGFFAICFERDI 488

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/493 (68%), Positives = 419/493 (84%), Gaps = 5/493 (1%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           MNFYRDATWVLE +EKE AK +ISGSMQ++VLKSCK YK++SNPKHIYAV+ SCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           LE +MKK+ IL  IPKK GKP F RLT+LLLCHDLL SK KRIQMGKHP+KEYVLK+K+ 
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           L SEMVKL++K+K++   +L+ S+D  ND+ PVRW RINP++       E +L EL+KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKKF 180

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
             +VD+WS++  G+IYHDE+IPNLFG+H  DKIT+HELYK GKIIIQDRASCFPAH+L+P
Sbjct: 181 TQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300
           G +DIVID+C+APGNKTTHTA+YI   P KD+KIQI+AFEKDPERAK+LQKM++ AGC+ 
Sbjct: 241 GSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCSA 300

Query: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360
            I+VNVGDFTK+ATPEK K VTGFIVDPSCSGSGIFGRKF D+LN++K     ++DDE +
Sbjct: 301 NIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKI---DEKDDEDD 357

Query: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420
           ++P EQ EEF  K++L+TRL+KL+SFQFQ+VKHAM+FP A+K+VYSTCSIHAEENERVVI
Sbjct: 358 AVPDEQ-EEFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVI 416

Query: 421 DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRD-DEEKCKEIAGGCIRALPKE 479
           DLLLD+ +++ GW+VA+R +V+P+WPRRG V+EF+EVFRD      +++A GCIRALPKE
Sbjct: 417 DLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKE 476

Query: 480 DGGIGFFAVCFER 492
           DGGIGFFAVCF R
Sbjct: 477 DGGIGFFAVCFVR 489

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/493 (68%), Positives = 414/493 (83%), Gaps = 5/493 (1%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           MNFYRDATWVLE +EKE AK +ISGSMQ++VL+SCK YK++SNPKHIYAV+ SCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           LE +MKK+ IL +IPKK GKP F RLT+LLLCHDLL SK KRIQMGKHP+K+YVLK+K+ 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           L SEMVKL++K+K++   +++ S+D  ND+ PVRW RINP++   +   E +L EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKKF 180

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
             +V+ WS +  G+IY+DE+IPNLFG+H  DKIT+HELYK GKIIIQDRASCFPAH+L+P
Sbjct: 181 TLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILHP 240

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300
           G DDIVID+C+APGNKTTHTA+YI  GP KD  I+I+AFEKDPERAK+LQKMV+ AGC+ 
Sbjct: 241 GADDIVIDACSAPGNKTTHTASYICSGPPKDNIIRIYAFEKDPERAKILQKMVKVAGCSS 300

Query: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360
            I+V VGDFTK+ATP+K K  TGFIVDPSCSGSGIFGRKF D+LNK+K  E   +DD+++
Sbjct: 301 NIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDE---KDDDND 357

Query: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420
            IP EQ EEF  K++L+TRL+KL+SFQFQ+VKHAM+FP A+K+VYSTCSIHAEENERVVI
Sbjct: 358 VIPDEQ-EEFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVI 416

Query: 421 DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRD-DEEKCKEIAGGCIRALPKE 479
           DLLLD+ +++ GW+VA R +VIP+WPRRG V+EF EVFRD      +++A GCIRALPKE
Sbjct: 417 DLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKE 476

Query: 480 DGGIGFFAVCFER 492
           DGGIGFFAVCFER
Sbjct: 477 DGGIGFFAVCFER 489

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/492 (66%), Positives = 406/492 (82%), Gaps = 8/492 (1%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           MNFYRDATWVLE++E+ED KG++SGSMQ++VLKSC+ YK++S+PKH+YAV+ SCW+YK  
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           LE IMK+S I ++IPKK GKP + RLT+LL+CHDLL SK KRIQMGK P+KEYVLK+KT 
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           L SE+VKL++K+K+KS  +++  +D +ND+TPVRW RINP+R P    VE +L+EL KKF
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRCP-KNDVEPVLKELIKKF 179

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
           P RV HWS I  GT+Y+DEF+PNLFGVH +DKITSHELY+QGKIIIQDR+SCFPAH+LNP
Sbjct: 180 PQRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNP 239

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300
           GK+D+VID+CAAPGNKTTH AA+IL   +++Q  +I+AFEKDP RA +L+KM   AGC +
Sbjct: 240 GKNDVVIDACAAPGNKTTHVAAHILPEYTREQTPKIYAFEKDPARANILKKMTSVAGCGQ 299

Query: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360
           T+E++VGDFTK+A P  FK+VTG IVDPSCSGSGIFGRK +D+ N  K+  + D +    
Sbjct: 300 TVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTETDSE---- 355

Query: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420
              +  +EE    DD+  RLSKLASFQFQVVKHAM+ P A+K+VYSTCSIHAEENERVVI
Sbjct: 356 ---IPDEEEKMVGDDVANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERVVI 412

Query: 421 DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPKED 480
           DLLLD  IK+ GW+VA+RE+VIP WPRRG V EF++VFRDD  KC E+A GCIRALP+ED
Sbjct: 413 DLLLDRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDDPVKCNELADGCIRALPQED 472

Query: 481 GGIGFFAVCFER 492
           GGIGFFAVCF+R
Sbjct: 473 GGIGFFAVCFKR 484

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/494 (68%), Positives = 414/494 (83%), Gaps = 5/494 (1%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           MNFYRDATWVLE +EKE AK +ISGSMQ++VLKSCK YK++SNPKHIYAV+ SCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           LE +MKK+ IL +IPKK GKP F RLT+LLLCHDLL SK KRIQMGKHP+K+YVLK+K+ 
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           L SEMVKL++K+K++   +L+ S+D +ND+ PVRW RINP++   +   E +L EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKKF 180

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
             +VD WS++  G+IY+DEFIPNLFG+H  DKIT+HELYK GKIIIQDRASCFPAH+LNP
Sbjct: 181 TLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILNP 240

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300
           G  DIVIDSC+APGNKTTHTA+YI   P KD   +I+AFEKDPERAKVLQKM++ AGC+ 
Sbjct: 241 GPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCSP 300

Query: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360
            I VNVGDFTK+ATPEK+K+VT FIVDPSCSGSGIFGRKF D+ N++K  +   +DD+  
Sbjct: 301 NISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDD---KDDDGG 357

Query: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420
            +P EQ EEF  K++L+TRL+KL+SFQFQ+VKHAM+FP A+K+VYSTCSIHAEENERVVI
Sbjct: 358 IVPDEQ-EEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVI 416

Query: 421 DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDD-EEKCKEIAGGCIRALPKE 479
           DLLLD+++++ GW+VA + +VIP+WPRRG V+EF+EVFRD      +++A GCIRALPK 
Sbjct: 417 DLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKS 476

Query: 480 DGGIGFFAVCFERD 493
           DGGIGFFAVCFERD
Sbjct: 477 DGGIGFFAVCFERD 490

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/496 (64%), Positives = 400/496 (80%), Gaps = 8/496 (1%)

Query: 1   MNFYRDATWVLEFLEKEDAKGK-ISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKP 59
           M FYRDATWVLEF+E+E +K K ++GS+Q++VL SCK YK+++NP+HIYA+++S W+Y+ 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 60  YLETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKT 119
           YL+ I+KKSGIL ++PKK GKP F + TI LL HDLL SKSKRIQMGKHP+K ++LK++T
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 120 SLRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKK 179
            L++E+ KL+VK+K+ S   LI + DD  D+TPVRW RINPI   + +  + +L EL KK
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKT-DDGEDVTPVRWIRINPIL--VKERYDDVLAELNKK 177

Query: 180 FPTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLN 239
           FP RV+ W +I  G+IY+DE+IPNLFG+H  DKITSHE YK+GKIIIQDRASCFPAH+LN
Sbjct: 178 FPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILN 237

Query: 240 PGKDDIVIDSCAAPGNKTTHTAAYILGG-PSKDQKIQIHAFEKDPERAKVLQKMVRTAGC 298
           P   D+VID+CAAPGNKTTH AA+I G   +K   ++IHAFEKDPERAK LQ MV TAGC
Sbjct: 238 PNSTDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGC 297

Query: 299 ARTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDE 358
           A+ ++++VGDFTK+  PE F+NVTGFIVDPSCSGSGIFGRK ID +N  K G    ++D+
Sbjct: 298 AKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQ 357

Query: 359 SESIPVEQDEE-FSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENER 417
           +   PVEQ++E F K+ DLK RL+KL+SFQ+Q+VKHAM+FP A+K+ YSTCSIHAEENER
Sbjct: 358 TSVEPVEQEKELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENER 417

Query: 418 VVIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALP 477
           VVIDLLLD  +K+ GW+V  R  VIPTWPRRGW  EF+EVF   +E+ KE+A GCIRALP
Sbjct: 418 VVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVF--PKEEAKELAEGCIRALP 475

Query: 478 KEDGGIGFFAVCFERD 493
           KEDGGIGFFAVCFERD
Sbjct: 476 KEDGGIGFFAVCFERD 491

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/498 (66%), Positives = 410/498 (82%), Gaps = 4/498 (0%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           M+FYRDATWVLE +E +DAKGK+SGS+Q++VL SCK +KV++NPKHIYAV++SCW+YKP+
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           LE +MKKS IL+ +P+K G P F+RLT+LLLCHDLL SKSKRIQMGKHP+K +VLKYKT 
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           L +E+ K++VK+K+K    L  S D  NDITPVRWFR+NP+R    K V+ ++ EL KKF
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKKF 180

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
             +VD W  +  G+IY+DE+IPNLF VH +DKITSHELYKQGKIIIQDRASCFPAH+LNP
Sbjct: 181 TEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQ--KIQIHAFEKDPERAKVLQKMVRTAGC 298
             DDIVID+CAAPGNKTTH AA++    + D+  K+QI+AFEKDPERA+VL KM++ AGC
Sbjct: 241 KSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAGC 300

Query: 299 ARTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDE 358
           ++ IEV VGDFTK+ATP+   NV G IVDPSCSGSGIFGRK+ID++N KK  E+ +E++ 
Sbjct: 301 SKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKEEEER 360

Query: 359 SESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERV 418
                 E+ EE    D+LKTRLSKL+SFQFQ+VK+A++FP+A K+VYSTCSIHAEENERV
Sbjct: 361 ELDAVPEEQEEQELDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEENERV 420

Query: 419 VIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEE--KCKEIAGGCIRAL 476
           VIDLLLD+ +K++GWRVA R KVIPTW RRG VDEF++VFR+D E   C+E+A GCIRAL
Sbjct: 421 VIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCIRAL 480

Query: 477 PKEDGGIGFFAVCFERDI 494
           P+EDGGIGFFAVCFER +
Sbjct: 481 PREDGGIGFFAVCFERTL 498

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/493 (64%), Positives = 407/493 (82%), Gaps = 16/493 (3%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           MN YRDATWV E++E+E++KGKI+GS+Q++VL SCK YK+++NPKH+YA++ SCWKYKP+
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           LE I+KKSGIL +IPKK G+P F   TILLL HDLL SK+KRIQMGKHP+KE+VLK+K  
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           L++E+ KL+VK+++ +   L+  +DD+ND+TPVRW RINP+R   +  V+ +  EL+KKF
Sbjct: 121 LQAELAKLKVKLRVTNLSQLV--KDDSNDMTPVRWIRINPVRC--NGKVDDVKGELQKKF 176

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
           PT+V +WS+I  GTIYHDEFIPNLFGVH  DKITSHELYK+GKIIIQDRASCFPAH+LNP
Sbjct: 177 PTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNP 236

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300
             +D++IDSC+APGNKTTH AA++       ++ QIHAFEKDPERAK LQKM++ AGC +
Sbjct: 237 TPEDVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDK 296

Query: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360
           +IEV+VGDFTK+A P+KF  VTGFIVDPSCSGSGIFGRK ID           D ++++E
Sbjct: 297 SIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIID-----------DTNNKNE 345

Query: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420
            +P E+ E+     DLKTRL+KL+SFQFQ++KHAM+FP A+KLVYSTCSIHAEENERVVI
Sbjct: 346 VLPEEEQEKEEMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVI 405

Query: 421 DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPKED 480
           DLLLD+ +++ GWRV  R  VIPTW RRG+V+EF++V++ D+++ +E+A GCIRALPKED
Sbjct: 406 DLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQ-DKQQAQELADGCIRALPKED 464

Query: 481 GGIGFFAVCFERD 493
           GGIGFFAVCFERD
Sbjct: 465 GGIGFFAVCFERD 477

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/509 (65%), Positives = 408/509 (80%), Gaps = 16/509 (3%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           MNFYRDATWVLE LE +D KG++SGS+ S+V+KSCK +K+QSNPKH+YAV+ S WK+KP+
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           +E IM KSGIL++IPKK GKP ++RLT+LLL HDL+FSKS+RIQMGKHP+K +VL YKT 
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 121 LRSEMVKLQVKMKLKSWGDLI----SSQDDANDITPVRWFRINPIRTPLSKGVEGILEEL 176
           L SE+VKL++K+K+ +  D+I    +S D  +DITPVRW RINPIR P  K  + I+ EL
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILEL 180

Query: 177 EKKFPTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAH 236
            KKF T+VDHWSKI+ G IY+DE+IPNLFG+   DKITSHELYK GKIIIQDRASCFPAH
Sbjct: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240

Query: 237 VLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQ----KIQIHAFEKDPERAKVLQKM 292
           +LN   DD +ID+CAAPGNKTTH A+YI+   +       K ++ AFEKDPER+K+L KM
Sbjct: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300

Query: 293 VRTAGCARTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKK---- 348
           V+ AGC + +E+N GDFTKIATPEK+ NVTGFIVDPSCSGSGIFGRKFID +N  K    
Sbjct: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360

Query: 349 EGEDVDEDDESESIPVEQD--EEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYS 406
           + +D  EDDE + IP+EQ+   E   KDDL+TRLSKL+SFQFQVVKHAM+FP A+K+VYS
Sbjct: 361 KVKDEGEDDE-QDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYS 419

Query: 407 TCSIHAEENERVVIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEE-KC 465
           TCSIHAEENERVVIDLLLD+ +K+ GW+V  R   IPTW RRG V EF++VF++D     
Sbjct: 420 TCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDP 479

Query: 466 KEIAGGCIRALPKEDGGIGFFAVCFERDI 494
           K++A GCIR LPKEDGGIGFFAVCFER+I
Sbjct: 480 KQLAEGCIRTLPKEDGGIGFFAVCFERNI 508

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/493 (66%), Positives = 410/493 (83%), Gaps = 5/493 (1%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           MNFYRDATWVLE +EKE AK +ISGSMQ++VLKSCK YK++SNPKH+YAV+ SCWKYKPY
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           LE +MKK+ IL +IPKK GKP F RLT+LLLCHDLL SK KRIQMGKHP+K+YVLK+K+ 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           L SEMVKL++K+K+++  +L+ S+D AND+ PVRW RINP++   +   E +L EL KKF
Sbjct: 121 LHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKKF 180

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
             +V+ WS++   +IY+DE+IPNLFG+H  DKIT+HELYK GKIIIQDRASCFPAH+LNP
Sbjct: 181 TLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILNP 240

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300
           G +DIVID+C+APGNKTTHTA+YI   P KD + +I+AFEKDPERAK+LQKM++ AGC+ 
Sbjct: 241 GPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCSS 300

Query: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360
            I+V+VGDFTK+ATPEKFK+ TGFIVDPSCSGSGIFGRKF D+LN+KK  +   +DD+++
Sbjct: 301 NIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDD---KDDDND 357

Query: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420
            +P EQ EEF  K++L+TRL+KL+SFQFQ+VKHAM+FP A+K+VYSTCSIHAEENERVVI
Sbjct: 358 IVPDEQ-EEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVI 416

Query: 421 DLLLDETIKKAGWRVANREKVIPTWPRRG-WVDEFKEVFRDDEEKCKEIAGGCIRALPKE 479
           DLLLD+ +++ GWRVA R +VIP WPRRG   +  +          +E+A GCIRALPK+
Sbjct: 417 DLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKD 476

Query: 480 DGGIGFFAVCFER 492
           DGGIGFFAVCFER
Sbjct: 477 DGGIGFFAVCFER 489

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/500 (64%), Positives = 407/500 (81%), Gaps = 15/500 (3%)

Query: 1   MNFYRDATWVLEFLEKEDAK-GKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKP 59
           M FYRD+TWVLE+LE +  K G++SGS+Q+IVL+ CK Y++++NPKHIYA+++SCWKYKP
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 60  YLETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKT 119
           YL+ IMKKSG+L+ IP+K GKP F +LT+LLLCHDLL SK+KRIQMGKHP+K YVLKYK 
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 120 SLRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKK 179
           +L +E VKL++K+K+     ++   D A+D+TPVRW RINP+R   +   + +L EL+KK
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRIS-NHDTDQVLNELKKK 179

Query: 180 FPTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLN 239
           FPTRV+ W  I  G+IY+DEFIPNL+G+H  DKITSHELYKQGKIIIQDRASCFPAH+LN
Sbjct: 180 FPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILN 239

Query: 240 PGKDDIVIDSCAAPGNKTTHTAAYILGGPS--KDQKIQIHAFEKDPERAKVLQKMVRTAG 297
           P  DD+VID+C+APGNKTTH AA+I G P   ++  +QI+AFEKDPERA++LQKM++TAG
Sbjct: 240 PSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAG 299

Query: 298 CARTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLN---KKKEGEDVD 354
           C + I+VNVGDFT+IATP K+ +VTGFI+DPSCSGSGIFGRK +D LN   KK   E  D
Sbjct: 300 CHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKSNDEVPD 359

Query: 355 EDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEE 414
           E+D  E+         SK + LK RLSKLASFQFQ+V+HAM+FP A+K+VYSTCSIHAEE
Sbjct: 360 ENDAEETTD-------SKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEE 412

Query: 415 NERVVIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRD-DEEKCKEIAGGCI 473
           NERVVIDLLLD+ ++  GWRVA +E V+PTW RRG+ +EF+EVF D  E++C+E+A GC+
Sbjct: 413 NERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCV 472

Query: 474 RALPKEDGGIGFFAVCFERD 493
           RALPKEDGGIGFFAVCF RD
Sbjct: 473 RALPKEDGGIGFFAVCFVRD 492

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/494 (62%), Positives = 390/494 (78%), Gaps = 31/494 (6%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           M+FYRD+TW+LE+LE E+ KGK+SGS+QS VLK+C  YKV++NPKHIYAV+ASCWKY+ Y
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           LE IM KSGIL  IP+K GKP F RLTI+LLCHDLL SK KRIQMGKHP+K+YVLKYKT 
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           L +E+VKL+VK+K+K   +L+  QDD +D TPVRW RINP++      +  ++E+L KKF
Sbjct: 121 LHAELVKLKVKLKVKELSELV-DQDDGDDATPVRWIRINPLKC----DIPVVVEQLNKKF 175

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
           P RVDHW ++  G+IY+DE++PNLFG+H  +KITSH+LYKQGK+IIQDRASC PAH+LNP
Sbjct: 176 PHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNP 235

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYIL--GGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGC 298
           GK+D+V+D+CAAPGNKTTH AA+I+   G S   + QIHAFEK+P RAKVLQKM   AGC
Sbjct: 236 GKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGC 295

Query: 299 ARTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDE 358
              ++++VGDFT++A P++F++VT  +VDPSCSGSGIFGRK +++ N             
Sbjct: 296 GSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSND------------ 343

Query: 359 SESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERV 418
                       S+   L+ RLSKL+SFQFQVVKHAM+ P ARK+VYSTCS+HAEENERV
Sbjct: 344 ------------SQDQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERV 391

Query: 419 VIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPK 478
           VIDLLLD  +K+ GW+++ R +V+PTWPRRG  +EF+EVFRDD+ KC+ +A  CIRALP+
Sbjct: 392 VIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPR 451

Query: 479 EDGGIGFFAVCFER 492
           EDGGIGFFAVCF+R
Sbjct: 452 EDGGIGFFAVCFQR 465

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/493 (62%), Positives = 381/493 (77%), Gaps = 10/493 (2%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           MNFYRDATWVLE++E  +  G+++GS+Q++VL SCK Y++++NPKHIYA + SCW+Y  +
Sbjct: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           L+ ++K+SGIL +IPKK GK  F   TI LL HDLLFSK+KRIQMGKHPLKE+VLKYK  
Sbjct: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           L SE+V+L++K+K+     L+  +DD ND+TPVRWFR+NPIR       E IL+EL KKF
Sbjct: 167 LSSELVRLKIKLKVTDLQQLL--KDDRNDMTPVRWFRLNPIRC--GAKSEDILQELSKKF 222

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
           PTRV+ W+ I  G IYHDE+IP LFGVH  DKITSHELYK GK+IIQDRASCFPAH+LN 
Sbjct: 223 PTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILNA 282

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300
             +D++ID+CAAPGNKTTH AA+I    +  + ++IHAFEKDPERAK L+ M+ TAGC +
Sbjct: 283 SSEDLIIDACAAPGNKTTHVAAHIFQDQAV-ESVRIHAFEKDPERAKTLRTMINTAGCTK 341

Query: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360
            IEV+VGDFT++A P KF +VTGFI+DPSCSGSGIFGRK ID  NK K     D     E
Sbjct: 342 GIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSK----ADGASPVE 397

Query: 361 SIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVVI 420
               E++ E     DLK RL KLASFQF++VKHAM+FP A+KLVYSTCS+HAEENER+V+
Sbjct: 398 EEEKEEEREDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVV 457

Query: 421 DLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPKED 480
           DLLLD  +K+ GWRV  R  VIPTW RRG+  EF+EVFR DE+  KE+A  CIR  PKED
Sbjct: 458 DLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFR-DEDTAKELAEACIRVAPKED 516

Query: 481 GGIGFFAVCFERD 493
           GGIGFFAVCFERD
Sbjct: 517 GGIGFFAVCFERD 529

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/495 (61%), Positives = 385/495 (77%), Gaps = 18/495 (3%)

Query: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60
           MNFYRDATWVLE++EK ++ G+++GS+Q++VL SCK Y +++NPKH+YA + SCW+Y  +
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120
           LE ++KKS IL ++PKK GK  F   TI LL HDLLF+K+KRIQMGKHPLKE+VLK+KT 
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 121 LRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKKF 180
           L SE+V+L++K+K+     L+  +DD ND+TPVRWFRINP+R       E ++ EL KKF
Sbjct: 121 LNSELVRLKIKLKVTDLHQLL--KDDRNDMTPVRWFRINPVRC--HGKHEEVMAELAKKF 176

Query: 181 PTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNP 240
           PTRVD W  +  G+IYHDE+IPNLFGVH  DKITSHELYK GKIIIQDRASCFPAH+LNP
Sbjct: 177 PTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNP 236

Query: 241 GKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCAR 300
              D++ID+CAAPGNKTTH AA++     + Q+  IHAFEKDPERAK L+ MV+TAGC++
Sbjct: 237 SPSDVIIDACAAPGNKTTHVAAHMFLN-DQPQEPLIHAFEKDPERAKTLRTMVKTAGCSK 295

Query: 301 TIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESE 360
            I ++VGDFTK+A P  F NV+GFIVDPSCSGSGIFGR+ ID  NK +         E  
Sbjct: 296 GINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSR---------EEG 346

Query: 361 SIPVEQDE--EFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERV 418
           ++P +++E  E   K D+K RL+KLASFQF++VK+A++FP A+KLVYSTCSIHAEENER+
Sbjct: 347 ALPTQEEERQEIEGK-DIKNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERI 405

Query: 419 VIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPK 478
           VIDLLLD  +K+ GWRV  R   IPTWPRRG+  EF++VFR+  +  KE+A  CIR  PK
Sbjct: 406 VIDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREG-DTAKELAEACIRVAPK 464

Query: 479 EDGGIGFFAVCFERD 493
           EDGGIGFFAVCFERD
Sbjct: 465 EDGGIGFFAVCFERD 479

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/495 (60%), Positives = 379/495 (76%), Gaps = 13/495 (2%)

Query: 1   MNFYRDATWVLEFLEKEDA-KGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKP 59
           M FYRDA+WVLE++E+E A K K++GS+ S+VL+S K YK++S+ +H+YA++AS WKYK 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 60  YLETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKT 119
           YL+ I++KSG+L ++P+K G+P F+R T+ L+ HDLL SK KRI MGKHPLK +VLK++T
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 120 SLRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKK 179
            LR E  K  VK+ +     L+  QD+  D TPVRW R+NP R    +  E +L+EL+KK
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLV--QDEREDATPVRWIRLNPFRIRGQR--EEVLQELQKK 176

Query: 180 FPTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLN 239
           FP RV  W ++  G+IY DE++  L+GVH  DKITSHELYK+GKIIIQDRASCFPA +L 
Sbjct: 177 FPRRVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILA 236

Query: 240 PGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCA 299
           PG+ D++ID+CAAPGNKTTH AA+I      D   QIHAFE+DP+RAK L+KM+ TAGC 
Sbjct: 237 PGRSDVIIDACAAPGNKTTHVAAHIFPEGGADHA-QIHAFERDPQRAKTLRKMIATAGCD 295

Query: 300 RTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDES 359
             IEV+VGDFT+ A PE FKNVTGFIVDPSCSGSGIFGR+ +D   + ++G    E D S
Sbjct: 296 NAIEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKG---TETDPS 352

Query: 360 ESIPVEQDEEFSKKD-DLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERV 418
             +P E+  E +K   +LK RL+KL+SFQFQ+VKHAM+FP A+KL+YSTCS+HAEENERV
Sbjct: 353 ADVPEEETFEATKSAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERV 412

Query: 419 VIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPK 478
           VIDLLLD  ++K GW+VA+R KVIP WPRRG   EF+EVF D  E   E+AGGCIR LPK
Sbjct: 413 VIDLLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPDQAE---ELAGGCIRVLPK 469

Query: 479 EDGGIGFFAVCFERD 493
           EDGGIGFFAVCFER+
Sbjct: 470 EDGGIGFFAVCFERE 484

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/497 (60%), Positives = 392/497 (78%), Gaps = 18/497 (3%)

Query: 1   MNFYRDATWVLEFLEKEDAKG-KISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKP 59
           M FYRD++WVLE++E+E +K  +ISGS+Q++VL+SCK YK+++NPKHIYA+++SCWKYK 
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 60  YLETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKT 119
           YLE I+K SG+L ++P K G+P F + TI+LL HDLL SK+KRI MGKHP+K +VLK + 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 120 SLRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKK 179
            L  E  K+ VK+K+KS  +L+  +D+  D++PVRW RINP R      V+ +L+EL KK
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELV--EDNDADMSPVRWIRINPFRC--QGKVDDVLKELRKK 189

Query: 180 FPTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLN 239
           FP +VD W++I  G+IY DE+IPNL+GVH  DKITSHELYK+GKIIIQDRASCFPA++LN
Sbjct: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249

Query: 240 PGKDDIVIDSCAAPGNKTTHTAAYIL-GGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGC 298
           P   D+VID+C+APGNKTTH AA+I   G + D  ++I+AFE+D +RA++L+KMV +AGC
Sbjct: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDGNASD--VKIYAFERDAKRAEILEKMVTSAGC 307

Query: 299 ARTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDE 358
              I+++VGDFT++A P+ FK+VTGFI+DPSCSGSGIFGR+ +D  NK K  E V  +  
Sbjct: 308 ESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVF 367

Query: 359 SESIP--VEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENE 416
            E  P  +EQ+E +      KTRL+KL+SFQFQ+VKHAM+FP A+KLVYSTCSIHAEENE
Sbjct: 368 EEQDPKEMEQNELY------KTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENE 421

Query: 417 RVVIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRAL 476
           RVVIDLLLD+ IK+ GW+VA R+ VIP W RRG + EF+EVF    E+ +E+A GCIRAL
Sbjct: 422 RVVIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVF--PHEQAQELADGCIRAL 479

Query: 477 PKEDGGIGFFAVCFERD 493
           PKEDGGIGFFAVCFER+
Sbjct: 480 PKEDGGIGFFAVCFERE 496

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 110/299 (36%), Gaps = 64/299 (21%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTH-TAAYILGGPSKDQKIQIHAFE 280
           G I  Q+  S  P +VL       V+D CAAPG+KT     A    GP     +   A +
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPEPSGFVV--AND 203

Query: 281 KDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGSGI 335
            D  R+ +L   ++    A  I VN     F +I T E  K+   F   + D  CSG G 
Sbjct: 204 ADYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDGT 263

Query: 336 FGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAM 395
             RK I+       G  +                             L + Q  ++   +
Sbjct: 264 M-RKNINVWKDWGTGSGLG----------------------------LHTVQLNILNRGL 294

Query: 396 TFPK-ARKLVYSTCSIHAEENERVVIDLLLDETIKKAGWRVA-----------NREKVIP 443
           T  K   +LVYSTCS++  ENE VV   L     +K G ++             R   I 
Sbjct: 295 TLLKNGGRLVYSTCSLNPIENEAVVAAAL-----RKWGAKIKLVNCDDQLLGLVRSTGIS 349

Query: 444 TWP---------RRGWVDEFKEVFRDDEEKCKEIA-GGCIRALPKEDGGIGFFAVCFER 492
           +WP          +G        F   EE+ KE     CIR  P +    GFF   FE+
Sbjct: 350 SWPVLDKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISVFEK 408

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 89/202 (44%), Gaps = 35/202 (17%)

Query: 219 YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHA 278
           Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A +           + A
Sbjct: 323 YLAGNYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGC------VFA 376

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGR 338
            + +  R K L   +   GC  TI   V ++     P         ++D  CSG+G+ G+
Sbjct: 377 NDANKSRTKSLVANIHRLGCTNTI---VCNYDAREFPRVIGGFDRILLDAPCSGTGVIGK 433

Query: 339 KFIDTLNKKKEGEDVDEDDESESIPVEQDE-EFSKKDDLKTRLSKLASFQFQVVKHAMTF 397
                                +S+ V + E +F +   L+ +L  L S    V  H+ T 
Sbjct: 434 --------------------DQSVKVSRTEKDFMQIPHLQKQL--LLSAIDSVDSHSKT- 470

Query: 398 PKARKLVYSTCSIHAEENERVV 419
                +VYSTCS+  EE+E+VV
Sbjct: 471 --GGIIVYSTCSVAVEEDEQVV 490

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 92/207 (44%), Gaps = 45/207 (21%)

Query: 219 YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHA 278
           Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A +           + A
Sbjct: 316 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGC------VFA 369

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGS 333
            + +  R K L   +   GC  TI  N    +F K+        + GF   ++D  CSG+
Sbjct: 370 NDANKARTKSLIANIHRLGCHNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 421

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDE-EFSKKDDLKTRLSKLASFQFQVVK 392
           G+ G+                     +S+ V + E +F +   L+ +L  + S    V  
Sbjct: 422 GVIGK--------------------DQSVKVSRTEKDFMQIPHLQKQL--ILSAIDSVDA 459

Query: 393 HAMTFPKARKLVYSTCSIHAEENERVV 419
           H+ T      +VYSTCS+  EENE VV
Sbjct: 460 HSKT---GGVIVYSTCSVAVEENEAVV 483

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 116/284 (40%), Gaps = 67/284 (23%)

Query: 146 DANDITPVRWFRINPIRTPLSKGVEGILEELEKKFPTRVDHWSKIEQGTIYHDEFIPNLF 205
           +AN+++     R N ++T      + ++       P  +  W+K+  G    D  +P   
Sbjct: 277 EANEVSRPITIRTNTLKTRRRDLAQALVNRGVNLQP--IGAWTKV--GLQIFDSQVP--- 329

Query: 206 GVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYIL 265
                  I +   Y  G  I+Q  +S  P   L+P +++ V+D  +APG KTT+ +A + 
Sbjct: 330 -------IGATPEYLAGNYILQAASSFLPVIALDPQENERVLDMASAPGGKTTYISALMK 382

Query: 266 GGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTG 323
                     I A + +  R K L   +   GC  TI  N    +F K+        + G
Sbjct: 383 NTGC------IFANDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGG 428

Query: 324 F---IVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRL 380
           F   ++D  CSG+G+ G+                     +S+ V + E    KD      
Sbjct: 429 FDRILLDAPCSGTGVIGK--------------------DQSVKVSRTE----KD-----F 459

Query: 381 SKLASFQFQVVKHAMTFPKARK-----LVYSTCSIHAEENERVV 419
            ++   Q Q++  A+    +       LVYSTCS+  EE+E VV
Sbjct: 460 IQIPHLQKQLILSAIDSLDSNSKNGGVLVYSTCSVAVEEDEAVV 503

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 90/211 (42%), Gaps = 53/211 (25%)

Query: 219 YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHA 278
           Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A +           + A
Sbjct: 309 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC------VFA 362

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGS 333
            + +  R K L   +   GC  TI  N    +F K+        + GF   ++D  CSG+
Sbjct: 363 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 414

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKH 393
           G+ G+                     +S+ V + E    KD       ++   Q Q++  
Sbjct: 415 GVIGK--------------------DQSVKVNRTE----KD-----FMQIPHLQKQLILS 445

Query: 394 AMTFPKARK-----LVYSTCSIHAEENERVV 419
           A+    +       +VYSTCS+  EENE VV
Sbjct: 446 AIDSVDSNSKHGGVIVYSTCSVAVEENEAVV 476

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 89/211 (42%), Gaps = 53/211 (25%)

Query: 219 YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHA 278
           Y  G+ I+Q  +S  P   L+P +++ V+D  AAPG KTT+ +A +           + A
Sbjct: 337 YLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALMKNTGC------VFA 390

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGS 333
            + +  R K L   +   GC  TI  N    +F K+        + GF   ++D  CSG+
Sbjct: 391 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 442

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKH 393
           G+ G+                 D   +S   E+D              ++   Q Q++  
Sbjct: 443 GVIGK-----------------DQSVKSSRTEKD------------FIQIPHLQKQLLLS 473

Query: 394 AMTFPKARK-----LVYSTCSIHAEENERVV 419
           A+    A       +VYSTCS+  EE+E VV
Sbjct: 474 AIDSVDANSKTGGVIVYSTCSVAVEEDEAVV 504

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 116/284 (40%), Gaps = 67/284 (23%)

Query: 146 DANDITPVRWFRINPIRTPLSKGVEGILEELEKKFPTRVDHWSKIEQGTIYHDEFIPNLF 205
           +AN+I      R N ++T      + ++       P  +  W+K+  G    D  +P   
Sbjct: 266 EANEIARPITIRTNTLKTSRRDLAQALVNRGVNLQP--IGSWTKV--GLQIFDSQVP--- 318

Query: 206 GVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYIL 265
                  I +   Y  G  I+Q  +S  P   L+P +++ V+D  +APG KTT+ +A + 
Sbjct: 319 -------IGATPEYLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKTTYISALMK 371

Query: 266 GGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTG 323
                     + A + + +R K L   +   GC  TI  N    +F K+        + G
Sbjct: 372 NTGC------VFANDANKKRTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGG 417

Query: 324 F---IVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRL 380
           F   ++D  CSG+G+ G+                     +S+ V + E    KD      
Sbjct: 418 FDRVLLDAPCSGTGVIGK--------------------DQSVKVSRTE----KD-----F 448

Query: 381 SKLASFQFQVVKHAMTFPKARK-----LVYSTCSIHAEENERVV 419
            ++   Q Q++  A+    A       +VYSTCS+  EE+E VV
Sbjct: 449 IQIPHLQKQLLLSAIDSVDANSKKGGVIVYSTCSVAVEEDEAVV 492

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 116/284 (40%), Gaps = 67/284 (23%)

Query: 146 DANDITPVRWFRINPIRTPLSKGVEGILEELEKKFPTRVDHWSKIEQGTIYHDEFIPNLF 205
           +AN+I      R N ++T      + ++       P  + +W+K+  G    D  +P   
Sbjct: 275 EANEIARPITIRTNTLKTRRRDLAQSLVNRGVNLQP--IGNWTKV--GLQIFDSQVP--- 327

Query: 206 GVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYIL 265
                  I +   Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A + 
Sbjct: 328 -------IGATPEYLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMMK 380

Query: 266 GGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTG 323
                     + A + +  R K L   +   GC  TI  N    +F K+        + G
Sbjct: 381 NTGC------VFANDANKNRTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGG 426

Query: 324 F---IVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRL 380
           F   ++D  CSG+G+ G+                     +S+ V + E    KD      
Sbjct: 427 FDRILLDAPCSGTGVIGK--------------------DQSVKVSRTE----KD-----F 457

Query: 381 SKLASFQFQVVKHAMTFPKARK-----LVYSTCSIHAEENERVV 419
            ++   Q Q++  A+    A       +VYSTCS+  EE+E VV
Sbjct: 458 IQIPHLQKQLLLSAIDSVDANSKKGGIIVYSTCSVAVEEDEAVV 501

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 92/207 (44%), Gaps = 45/207 (21%)

Query: 219 YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHA 278
           Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A +           + A
Sbjct: 319 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMMKNTGC------VFA 372

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGS 333
            + +  R K L   +   GC  TI  N    +F K+        + GF   ++D  CSG+
Sbjct: 373 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 424

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDE-EFSKKDDLKTRLSKLASFQFQVVK 392
           G+ G+                     +S+ V + E +F +   L+ +L  L S    V  
Sbjct: 425 GVIGK--------------------DQSVKVSRTEKDFMQIPHLQKQL--LLSAIDSVDS 462

Query: 393 HAMTFPKARKLVYSTCSIHAEENERVV 419
           ++ T      +VYSTCS+  +ENE VV
Sbjct: 463 NSKT---GGVIVYSTCSVAVDENEAVV 486

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 90/211 (42%), Gaps = 53/211 (25%)

Query: 219 YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHA 278
           Y  G+ I+Q  +S  P   L+P  ++ V+D  AAPG KTT+ +A +           + A
Sbjct: 317 YLAGQYILQAASSFLPVVALDPQLNERVLDMAAAPGGKTTYISALMKNTGC------VFA 370

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGS 333
            + +  R K L   +   GC  TI  N    +F K+        + GF   ++D  CSG+
Sbjct: 371 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 422

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKH 393
           G+ G+                     +S+ V + E    KD       ++   Q Q++  
Sbjct: 423 GVIGK--------------------DQSVKVSRTE----KD-----FIQIPHLQKQLLLS 453

Query: 394 AMTFPKARK-----LVYSTCSIHAEENERVV 419
           A+    A       +VYSTCS+  EE+E VV
Sbjct: 454 AIDSVDANSKTGGFIVYSTCSVAVEEDEAVV 484

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 92/207 (44%), Gaps = 45/207 (21%)

Query: 219 YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHA 278
           Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A +           + A
Sbjct: 333 YLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMMKNTGC------VFA 386

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGS 333
            + +  R K L   +   GC  TI  N    +F K+        + GF   ++D  CSG+
Sbjct: 387 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 438

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQ-DEEFSKKDDLKTRLSKLASFQFQVVK 392
           G+  +                     +S+ V + D++F +   L+ +L  L S    V  
Sbjct: 439 GVIAK--------------------DQSVKVSRTDKDFMQIPHLQKQL--LLSAIDSVDA 476

Query: 393 HAMTFPKARKLVYSTCSIHAEENERVV 419
           ++ T      +VYSTCS+  EENE VV
Sbjct: 477 NSKT---GGVIVYSTCSVAVEENEAVV 500

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 116/282 (41%), Gaps = 63/282 (22%)

Query: 146 DANDITPVRWFRINPIRTPLSKGVEGILEELEKKFPTRVDHWSKIEQGTIYHDEFIPNLF 205
           +AN+I      R N ++T      + ++       P  +  W+K+  G    D  +P   
Sbjct: 135 EANEIARPITIRTNTLKTRRRDLAQALVNRGVNLQP--IGSWTKV--GLQIFDSQVP--- 187

Query: 206 GVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYIL 265
                  I +   Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A + 
Sbjct: 188 -------IGATPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMK 240

Query: 266 GGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTG 323
                     + A + +  R K L   +   GC  TI  N    +F K+        + G
Sbjct: 241 NTGC------VFANDANKNRTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGG 286

Query: 324 F---IVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDE-EFSKKDDLKTR 379
           F   ++D  CSG+G+ G+                     +S+ V + E +F +   L+ +
Sbjct: 287 FDRILLDAPCSGTGVIGK--------------------DQSVKVSRTEKDFIQIPHLQKQ 326

Query: 380 --LSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVV 419
             LS + S      KH         +VYSTCS+  EE+E VV
Sbjct: 327 LLLSAIDSVDCN-SKHGGV------IVYSTCSVAVEEDEAVV 361

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 89/211 (42%), Gaps = 53/211 (25%)

Query: 219 YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHA 278
           Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A +           + A
Sbjct: 311 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGC------VFA 364

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGS 333
            + +  R K L   +   GC  TI  N    +F K+        + GF   ++D  CSG+
Sbjct: 365 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 416

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKH 393
           G+  +                     +S+ V + E    KD       ++   Q Q++  
Sbjct: 417 GVIAK--------------------DQSVKVSRTE----KD-----FMQIPHLQKQLILS 447

Query: 394 AMTFPKARK-----LVYSTCSIHAEENERVV 419
           A+    +       +VYSTCS+  EENE VV
Sbjct: 448 AIDSVDSNSKTGGIIVYSTCSVAVEENEAVV 478

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 117/282 (41%), Gaps = 63/282 (22%)

Query: 146 DANDITPVRWFRINPIRTPLSKGVEGILEELEKKFPTRVDHWSKIEQGTIYHDEFIPNLF 205
           +AN+I      R N ++T      + ++       P  +  W+K+  G    D  +P   
Sbjct: 270 EANEIARPITIRTNTLKTRRRDLAQALVNRGVNLQP--IGSWTKV--GLQIFDSQVP--- 322

Query: 206 GVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYIL 265
                  I +   Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A + 
Sbjct: 323 -------IGATPEYLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALMK 375

Query: 266 GGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTG 323
              +      + A + +  R K L   +   GC  TI  N    +F K+        + G
Sbjct: 376 NTGT------VFANDANKNRTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGG 421

Query: 324 F---IVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDE-EFSKKDDLKTR 379
           F   ++D  CSG+G+ G+                     +S+ V + E +F +   L+ +
Sbjct: 422 FDRILLDAPCSGTGVIGK--------------------DQSVKVSRTEKDFIQIPHLQKQ 461

Query: 380 --LSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENERVV 419
             LS + S      KH         +VYSTCS+  EE+E VV
Sbjct: 462 LLLSAIDSVDCN-SKHGGI------IVYSTCSVAVEEDEAVV 496

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 103/246 (41%), Gaps = 65/246 (26%)

Query: 184 VDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKD 243
           + +W+K+  G    D  +P          I +   Y  G+ I+Q  +S  P   L+P ++
Sbjct: 294 IGNWTKV--GLQIFDSQVP----------IGATPEYLAGQYILQAASSFLPVIALDPQEN 341

Query: 244 DIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIE 303
           + ++D  +APG KTT+ +A +           + A + +  R K L   +   GC  TI 
Sbjct: 342 ERILDMASAPGGKTTYISALMKNTGC------VFANDANKNRTKSLIANIHRLGCTNTIV 395

Query: 304 VN--VGDFTKIATPEKFKNVTGF---IVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDE 358
            N    +F K+        + GF   ++D  CSG+G+ G+                    
Sbjct: 396 CNYDAREFPKV--------IGGFDRILLDAPCSGTGVIGK-------------------- 427

Query: 359 SESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARK-----LVYSTCSIHAE 413
            +S+ V + E    KD       ++   Q Q++  A+    A       +VYSTCS+  E
Sbjct: 428 DQSVKVSRTE----KD-----FIQIPHLQKQLLLSAIDSVDANSKSGGVIVYSTCSVAVE 478

Query: 414 ENERVV 419
           E+E VV
Sbjct: 479 EDEAVV 484

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 91/216 (42%), Gaps = 54/216 (25%)

Query: 219 YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHA 278
           Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A +           + A
Sbjct: 331 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC------VFA 384

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGS 333
            + +  R K L   +   GC  TI  N    +F K+        + GF   ++D  CSG+
Sbjct: 385 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 436

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKH 393
           G+  +                     +S+ V + E    KD       ++   Q Q++  
Sbjct: 437 GVIAK--------------------DQSVKVSRTE----KD-----FIQIPHLQKQLLLS 467

Query: 394 AMTFPKARK-----LVYSTCSIHAEENERVVIDLLL 424
           A+    A       +VYSTCS+  EENE  VID  L
Sbjct: 468 AIDSVDANSKTGGVIVYSTCSVAVEENE-AVIDYAL 502

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 91/209 (43%), Gaps = 49/209 (23%)

Query: 219 YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHA 278
           Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A +           + A
Sbjct: 323 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC------VFA 376

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGS 333
            + +  R K L   +   GC  TI  N    +F K+        + GF   ++D  CSG+
Sbjct: 377 NDANKSRTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 428

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDE-EFSKKDDLKTR--LSKLASFQFQV 390
           G+ G+                     +S+ V + E +F +   L+ +  LS + S     
Sbjct: 429 GVIGK--------------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCN- 467

Query: 391 VKHAMTFPKARKLVYSTCSIHAEENERVV 419
            KH         +VYSTCS+  EE+E VV
Sbjct: 468 SKHGGV------IVYSTCSVAVEEDEAVV 490

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 92/207 (44%), Gaps = 45/207 (21%)

Query: 219 YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHA 278
           Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A +           + A
Sbjct: 319 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALMKNTGC------VFA 372

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGS 333
            + +  R K L   +   GC  TI  N    +F K+        + GF   ++D  C+G+
Sbjct: 373 NDANKARTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCTGT 424

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDE-EFSKKDDLKTRLSKLASFQFQVVK 392
           G+ G+                     +S+ V + E +F +   L+ +L  L S    V  
Sbjct: 425 GVIGK--------------------DQSVKVSRTEKDFIQVPHLQKQL--LLSAIDSVDS 462

Query: 393 HAMTFPKARKLVYSTCSIHAEENERVV 419
           ++ T      +VYSTCS+  EE+E VV
Sbjct: 463 NSKT---GGIIVYSTCSVAVEEDEMVV 486

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 93/214 (43%), Gaps = 50/214 (23%)

Query: 219 YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHA 278
           Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A +           + A
Sbjct: 322 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC------VFA 375

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGS 333
            + +  R K L   +   GC  TI  N    +F K+        + GF   ++D  CSG+
Sbjct: 376 NDANKSRTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 427

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDE-EFSKKDDLKTR--LSKLASFQFQV 390
           G+ G+                     +S+ V + E +F +   L+ +  LS + S     
Sbjct: 428 GVIGK--------------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCN- 466

Query: 391 VKHAMTFPKARKLVYSTCSIHAEENERVVIDLLL 424
            KH         +VYSTCS+  EE+E  VID  L
Sbjct: 467 SKHGGV------IVYSTCSVAVEEDE-AVIDYAL 493

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 91/209 (43%), Gaps = 49/209 (23%)

Query: 219 YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHA 278
           Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A +           + A
Sbjct: 324 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC------VFA 377

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGS 333
            + +  R K L   +   GC  TI  N    +F K+        + GF   ++D  CSG+
Sbjct: 378 NDANKSRTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 429

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDE-EFSKKDDLKTR--LSKLASFQFQV 390
           G+ G+                     +S+ V + E +F +   L+ +  LS + S     
Sbjct: 430 GVIGK--------------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCN- 468

Query: 391 VKHAMTFPKARKLVYSTCSIHAEENERVV 419
            KH         +VYSTCS+  EE+E VV
Sbjct: 469 SKHGGV------IVYSTCSVAVEEDEAVV 491

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 91/209 (43%), Gaps = 49/209 (23%)

Query: 219 YKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHA 278
           Y  G  I+Q  +S  P   L+P +++ ++D  AAPG KTT+ +A +           + A
Sbjct: 322 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC------VFA 375

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGS 333
            + +  R K L   +   GC  TI  N    +F K+        + GF   ++D  CSG+
Sbjct: 376 NDANKSRTKSLIANIHRLGCTNTIVCNYDAREFPKV--------IGGFDRILLDAPCSGT 427

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDE-EFSKKDDLKTR--LSKLASFQFQV 390
           G+ G+                     +S+ V + E +F +   L+ +  LS + S     
Sbjct: 428 GVIGK--------------------DQSVKVSRTEKDFIQIPHLQKQLLLSAIDSVDCN- 466

Query: 391 VKHAMTFPKARKLVYSTCSIHAEENERVV 419
            KH         +VYSTCS+  EE+E V+
Sbjct: 467 SKHGGV------IVYSTCSVAVEEDEAVI 489

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 113/302 (37%), Gaps = 67/302 (22%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  +L    +  V+D CAAPG+KT      +     +   I + A + 
Sbjct: 144 GNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEALHTNEDEPTGIVV-ANDA 202

Query: 282 DPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF------IVDPSCSGS 333
           D  R+ +L   ++    A  + VN     F +IA  E   +   F      + D  CSG 
Sbjct: 203 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCSGD 262

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKH 393
           G   RK ++                          +++ +  L      L + Q  ++  
Sbjct: 263 GTM-RKNVNVW-----------------------RDWTSQGGL-----GLHNIQLNILNR 293

Query: 394 AMTF--PKARKLVYSTCSIHAEENERVVIDLLLDETIKKAG--WRVANREKVIPTWPRRG 449
            +    PK R LVYSTCS++  ENE V+   L     +K G   RV N ++ +P   R  
Sbjct: 294 GLHLLKPKGR-LVYSTCSMNPIENEAVIAAAL-----RKWGSKIRVINCDEKLPGLVRSK 347

Query: 450 WVDEFKEVFRD-------------------DEEKCKEIAGGCIRALPKEDGGIGFFAVCF 490
            +D +    RD                   +EEK +     CIR  P +     FF    
Sbjct: 348 GIDSWPVFNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRVYPHQQNTGAFFITVI 407

Query: 491 ER 492
           E+
Sbjct: 408 EK 409

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 76/304 (25%), Positives = 116/304 (38%), Gaps = 71/304 (23%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQ---IHA 278
           G I  Q+  S  P  VL       V+D CAAPG+KT    A ++    KD       + A
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKT----AQLIEALHKDTDEPTGFVVA 200

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIAT---PEKFKNVTGF---IVDPSC 330
            + D  R+ +L   ++    A  + VN     F +I      EK +++  F   + D  C
Sbjct: 201 NDADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVPC 260

Query: 331 SGSGIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQV 390
           SG G   RK ++                              KD        L + Q+ +
Sbjct: 261 SGDGTM-RKNVNVW----------------------------KDWNAQGALGLHTVQWNI 291

Query: 391 VKHAMTFPKAR-KLVYSTCSIHAEENERVVIDLLLDETIKKAG--WRVANREKVIPTWPR 447
           +   +   K   +LVYSTCS++  ENE VV      + ++K G   R+ N ++ +P   R
Sbjct: 292 LNRGLHLLKPNGRLVYSTCSLNPIENEAVVA-----QALRKWGNKIRLVNCDEKLPGLVR 346

Query: 448 RGWVDEFKEVFRDDEEKCKEIAG-------------------GCIRALPKEDGGIGFFAV 488
              + ++  + RD E K K   G                    CIR  P +    GFF  
Sbjct: 347 SKGISQWPVLNRDLETKNKNDEGVLESWFPPSEEEASLFNLDACIRVYPHQQNTGGFFIT 406

Query: 489 CFER 492
            FE+
Sbjct: 407 VFEK 410

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 116/301 (38%), Gaps = 65/301 (21%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  +L+      V+D CAAPG+KT     Y+     +     + A + 
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHRDNDEPSGFVV-ANDA 200

Query: 282 DPERAKVLQKMVRTAGCARTIEVN--VGDFTKI-ATPEKF--KNVTGF---IVDPSCSGS 333
           D +R+ +L   ++    A  I VN     F ++ A P+    K++  F   + D  CSG 
Sbjct: 201 DAKRSHMLVHQLKRLNSANLIVVNHDAQFFPRVKAHPDHTNKKDILRFDRVLCDVPCSGD 260

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKH 393
           G   RK ++                          +++ ++ L      L + Q  ++  
Sbjct: 261 GTM-RKNVNVW-----------------------RDWTTQNGL-----ALHNVQLNILNR 291

Query: 394 AMTFPKA-RKLVYSTCSIHAEENERVVIDLLLDETIKKAGWRV-----------ANREKV 441
            +   K+  +LVYSTCS++  ENE VV      E ++K G +V             R   
Sbjct: 292 GLHLLKSGGRLVYSTCSMNPIENEAVVA-----EALRKWGGKVRLVDCSDKLPGLVRSNG 346

Query: 442 IPTWPRRGWVDEFKEVFRD----------DEEKCKEIAGGCIRALPKEDGGIGFFAVCFE 491
           I  WP      E KE   D          DEE  +     C+R  P +    GFF    E
Sbjct: 347 INQWPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFFITVLE 406

Query: 492 R 492
           +
Sbjct: 407 K 407

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 117/300 (39%), Gaps = 61/300 (20%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  +L+      V+D CAAPG+KT      +     +     I A + 
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHIDSDEPSGFVI-ANDA 198

Query: 282 DPERAKVLQKMVRTAGCARTIEVN--------VGDFTKIATPEKFKNVTGFIVDPSCSGS 333
           D +R+ +L   ++    +  + VN        +   TK A+ ++       + D  CSG 
Sbjct: 199 DNKRSHLLVHQLKRLSTSNVLIVNHDAQFFPNLKINTKDASSQEDLKFDRILCDVPCSGD 258

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKH 393
           G   RK ++                         + ++ ++ L      L + QF ++  
Sbjct: 259 GTM-RKNVNVW-----------------------KNWNTQNALG-----LHNVQFNILDR 289

Query: 394 AMTFPKAR-KLVYSTCSIHAEENERVVIDLL---------------LDETIKKAG---WR 434
            +T  K   KLVYSTCS++  ENE VV  +L               L   I+  G   W 
Sbjct: 290 GLTLLKETGKLVYSTCSLNPIENEAVVAAVLRKWGDKVRLVCCDDKLKGLIRSKGLTTWP 349

Query: 435 VANREKVIPTWPRRGWVDEF-KEVFRDDEEKCKEI-AGGCIRALPKEDGGIGFFAVCFER 492
           V NR+  +   PR    D+  K  +   EE+  +     C+R  P +    GFF   FE+
Sbjct: 350 VINRD--MEEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTGGFFITMFEK 407

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 114/305 (37%), Gaps = 72/305 (23%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  VL       V+D CAAPG+KT      +     +     + A + 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDTDEPTGFVV-ANDA 201

Query: 282 DPERAKVLQKMVRTAGCARTIEVN------------VGDFTKIATPEKFKNVTGFIVDPS 329
           D +R+ +L   ++    A  + VN              D +  A   KF  V   + D  
Sbjct: 202 DSKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRV---LCDVP 258

Query: 330 CSGSGIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQ 389
           CSG G   RK ++                          +++ +  L      L + QF 
Sbjct: 259 CSGDGTM-RKNVNVW-----------------------RDWTPQGGLG-----LHTVQFN 289

Query: 390 VVKHAMTFPKAR-KLVYSTCSIHAEENERVVIDLLLDETIKKAG--WRVANREKVIPTWP 446
           ++   +   K + +LVYSTCS++  ENE VV      E ++K G   R+ + E  +P   
Sbjct: 290 ILNRGLHLLKNKGRLVYSTCSMNPIENEAVVA-----EALRKWGDKIRLVSCEDKLPGLV 344

Query: 447 RRGWVDEFKEVFRD-------------------DEEKCKEIAGGCIRALPKEDGGIGFFA 487
           R   V ++  + R+                   +EE  K     CIR  P +    GFF 
Sbjct: 345 RSKGVSQWPVIDRNMTPREKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGFFI 404

Query: 488 VCFER 492
             FE+
Sbjct: 405 TVFEK 409

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 112/294 (38%), Gaps = 54/294 (18%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTH-TAAYILGGPSKDQKIQIHAFE 280
           G I  Q+  S  P  +L       V+D CAAPG+KT     A    GP     +   A +
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGPEPSGFVV--AND 202

Query: 281 KDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGSGI 335
            D  R+ +L   ++    A  I VN     F +I T E  K+   F   + D  CSG G 
Sbjct: 203 ADYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDGT 262

Query: 336 FGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAM 395
             RK I+                              KD        L + Q  ++   +
Sbjct: 263 M-RKNINVW----------------------------KDWATASGLGLHTVQVNILNRGL 293

Query: 396 TFPK-ARKLVYSTCSIHAEENERVVIDLL--LDETIK--KAGWRVAN--REKVIPTWP-- 446
              K   +LVYSTCS++  ENE VV   L    + IK  + G ++    R + I  WP  
Sbjct: 294 NLLKDGGRLVYSTCSLNPIENEAVVAAALRKWGDKIKLVECGDKLPGLIRSQGISQWPVY 353

Query: 447 RRGW-----VDEFKEVF---RDDEEKCKEIAGGCIRALPKEDGGIGFFAVCFER 492
            +G+      DE  +       DEE  K     C+R  P +    GFF   FE+
Sbjct: 354 DKGFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAVFEK 407

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 112/295 (37%), Gaps = 53/295 (17%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  +L    +  V+D CAAPG+KT      +     +   I I A + 
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKDTDEPTGI-IVANDS 217

Query: 282 DPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTG----FIVDPSCSGSGI 335
           D  R+ +L   ++    +  + VN     F  I T     N+T      + D  CSG G 
Sbjct: 218 DMRRSYLLVHQLKRLNSSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGDGT 277

Query: 336 FGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAM 395
             RK I+  N                     D  F     L    + + +   Q++++  
Sbjct: 278 L-RKNINIWN---------------------DWRFQNALGLHRLQNNILNRGLQLLRNG- 314

Query: 396 TFPKARKLVYSTCSIHAEENERVVIDLLLDETIKKAGWRVAN------REKVIPTWP--- 446
                 +LVYSTCS++  ENE V+ + L +   + +     +      R + I +WP   
Sbjct: 315 -----GRLVYSTCSMNPIENEAVIANALRNWAGEVSLVNFDDELPGLIRSRGISSWPVID 369

Query: 447 ------RRGWVDEFKEVF--RDDEEKCKEIAGGCIRALPKEDGGIGFFAVCFERD 493
                  RG  +     F    DE+K   +   CIR  P +     FF   FE++
Sbjct: 370 RNGEMRERGDPETLDSWFPPTADEQKTFNLE-KCIRVYPHQQDTGAFFIAVFEKN 423

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 76/304 (25%), Positives = 117/304 (38%), Gaps = 71/304 (23%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQ---IHA 278
           G I  Q+  S  P  VL       V+D CAAPG+KT    A +L    +D       + A
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKT----AQLLEALHRDTDEPTGFVVA 200

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATP---EKFKNVTGF---IVDPSC 330
            + D  R+ +L   ++    A  I VN     F +I T    EK  ++  F   + D  C
Sbjct: 201 NDADNRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPC 260

Query: 331 SGSGIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQV 390
           SG G   RK ++                          +++ ++ L      L   Q  +
Sbjct: 261 SGDGTM-RKNVNVW-----------------------RDWNTQNALG-----LHQVQANI 291

Query: 391 VKHAM-TFPKARKLVYSTCSIHAEENERVVIDLLLDETIKKAG--WRVANREKVIPTWPR 447
           +   +    K  +LVYSTCS++  ENE VV      + ++K G   R+ N +  +P   R
Sbjct: 292 LNRGLHLLKKGGRLVYSTCSMNPIENEAVVA-----QALRKWGDKVRLVNCDDKLPGLVR 346

Query: 448 RGWVDEFKEVFRDDEEKCKEIAGG-------------------CIRALPKEDGGIGFFAV 488
              + ++  + R+ EE  K   G                    CIR  P +    GFF  
Sbjct: 347 NKGISKWPTLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGFFIT 406

Query: 489 CFER 492
            FE+
Sbjct: 407 VFEK 410

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 77/302 (25%), Positives = 117/302 (38%), Gaps = 67/302 (22%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  VL       V+D CAAPG+KT      +     +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHMEDDEPSGFVV-ANDA 203

Query: 282 DPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPE---KFKNVTGF---IVDPSCSGS 333
           D +R+ +L   ++    A  + VN     F +I   E   + K+V  F   + D  CSG 
Sbjct: 204 DAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHEDATQKKDVLRFDRVLCDVPCSGD 263

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKH 393
           G   RK ++                          +++ +  L      L + Q  ++  
Sbjct: 264 GTM-RKNVNVW-----------------------RDWNTQSGLG-----LHTVQLNILNR 294

Query: 394 AMTF--PKARKLVYSTCSIHAEENERVVIDLLLDETIKKAG--WRVAN---------REK 440
            +    PK R LVYSTCS++  ENE VV   L     +K G   R+ N         R K
Sbjct: 295 GLHLLKPKGR-LVYSTCSMNPIENEAVVAAAL-----RKWGDKIRLVNCDDKLPGLVRSK 348

Query: 441 VIPTWP---------RRGWVDEFKEVFRDDEEKCKEI-AGGCIRALPKEDGGIGFFAVCF 490
            I TWP         ++G  +  +  F    E+ ++     CIR  P +    GFF   F
Sbjct: 349 GISTWPVVDRNMEEKKKGDENTVESWFAPTPEEAEKFDLSSCIRVYPHQQNTGGFFITVF 408

Query: 491 ER 492
           E+
Sbjct: 409 EK 410

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 78/305 (25%), Positives = 119/305 (39%), Gaps = 73/305 (23%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQ---IHA 278
           G I  Q+  S  P  VL       V+D CAAPG+KT    A ++    KD       + A
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKT----AQLIEALHKDTDEPTGFVVA 200

Query: 279 FEKDPERAKVLQKMVRTAGCARTIEVN--VGDFTKI---ATPEKFKNVTGF---IVDPSC 330
            + D +R+ +L   ++    A  + VN     F +I      EK K +  F   + D  C
Sbjct: 201 NDADAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPC 260

Query: 331 SGSGIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQV 390
           SG G   RK ++                         ++++ +  L      L + Q  +
Sbjct: 261 SGDGTM-RKNVNVW-----------------------KDWNTQGGLG-----LHTVQLNI 291

Query: 391 VKHAMTFPKAR-KLVYSTCSIHAEENERVVIDLLLDETIKKAGWRVA-----------NR 438
           +   +   K+  +LVYSTCS++  ENE VV      E ++K G ++             R
Sbjct: 292 LNRGLNLLKSGGRLVYSTCSMNPIENEAVVA-----EALRKWGSKIKLVNCDDKLVGLVR 346

Query: 439 EKVIPTWP---------RRGWVDEFKEVFRDDEEKCKEI--AGGCIRALPKEDGGIGFFA 487
            K I  WP          +G     +  F   EE+ +EI     CIR  P +    GFF 
Sbjct: 347 SKGISNWPVLDRNMAVKNKGDEGTIESWFPPTEEE-REIFHLDSCIRVYPHQQNTGGFFI 405

Query: 488 VCFER 492
             FE+
Sbjct: 406 TVFEK 410

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 109/302 (36%), Gaps = 67/302 (22%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  VL       V+D CAAPG+KT       L   S +    + A + 
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLE-ALHRDSNEPTGFVVANDS 197

Query: 282 DPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF------IVDPSCSGS 333
           D  RA +L   ++    A  + VN     F KI       N +G       + D  CSG 
Sbjct: 198 DSRRAYMLVHQLKRLNSANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILCDVPCSGD 257

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKH 393
           G   RK ++                         ++++ ++ L      L + Q  ++  
Sbjct: 258 GTM-RKNVNVW-----------------------KDWNTQNAL-----GLHNVQLNILNR 288

Query: 394 AMTFPKAR-KLVYSTCSIHAEENERVVIDLL---------------LDETIKKAG---WR 434
            +   K   +LVYSTCS++  ENE VV   L               L   ++  G   W 
Sbjct: 289 GLQLLKDNGRLVYSTCSLNPIENEAVVAAALRKWGNKIKLVDCQNKLQGLVRSNGISHWS 348

Query: 435 VANREKVIPT----WPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPKEDGGIGFFAVCF 490
           V +RE    T      +  W +        D EK       C+R  P +    GFF   F
Sbjct: 349 VYDREMNAITKDSESTKSSWFEP------TDAEKENFNLEHCMRVYPHQQNTGGFFIAVF 402

Query: 491 ER 492
           E+
Sbjct: 403 EK 404

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 106/299 (35%), Gaps = 61/299 (20%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  VL       V+D CAAPG+KT      +     +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVV-ANDA 203

Query: 282 DPERAKVLQKMVRTAGCARTIEVN--VGDFTKI---ATPEKFKNVTGF---IVDPSCSGS 333
           D  R+ +L   ++    A  + VN     F +I          +V  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCSGD 263

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLS-KLASFQFQVVK 392
           G   RK ++                                D  T+    L + Q  ++ 
Sbjct: 264 GTM-RKNVNVWK-----------------------------DWNTQAGLGLHAVQLNILN 293

Query: 393 HAMTFPKAR-KLVYSTCSIHAEENERVVIDLL---------------LDETIKKAG---W 433
             +   K   +LVYSTCS++  ENE VV + L               L   I+  G   W
Sbjct: 294 RGLHLLKNNGRLVYSTCSLNPIENEAVVAEALRKWGDKIRLVNCDDKLPGLIRSKGVSKW 353

Query: 434 RVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPKEDGGIGFFAVCFER 492
            V +R     T    G +D F      +EE  K     C+R  P +    GFF   FE+
Sbjct: 354 PVYDRNLTEKTKGDEGTLDSF--FSPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 108/299 (36%), Gaps = 61/299 (20%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  VL       V+D CAAPG+KT      +     +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVV-ANDA 203

Query: 282 DPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPE---KFKNVTGF---IVDPSCSGS 333
           D  R+ +L   ++    A  + VN     F +I   E   K  +V  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVPCSGD 263

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLS-KLASFQFQVVK 392
           G   RK ++                                D  T+    L + Q  ++ 
Sbjct: 264 GTM-RKNVNVWK-----------------------------DWNTQAGLGLHTVQLNILN 293

Query: 393 HAMTFPK-ARKLVYSTCSIHAEENERVVIDLL---------------LDETIKKAG---W 433
             +   K   +LVYSTCS++  ENE V+ + L               L   ++  G   W
Sbjct: 294 RGLHLLKDGGRLVYSTCSLNPIENEAVIAEALRKWGDKIRLVNCDDKLSGLVRSKGVSKW 353

Query: 434 RVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALPKEDGGIGFFAVCFER 492
            V +R     T    G ++ F      +EE  K     C+R  P +    GFF   FE+
Sbjct: 354 PVYDRNLTEKTKGDEGTLESF--FAPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 107/298 (35%), Gaps = 62/298 (20%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  VL    +  V+D CAAPG+KT      +     +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQEDEPTGFVV-ANDA 203

Query: 282 DPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGSGIF 336
           D +R+ +L   ++    A  + VN     F +I +    K    F   + D  CSG G  
Sbjct: 204 DAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGDGTM 263

Query: 337 GRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMT 396
            RK ++                              +D        L + Q  ++   + 
Sbjct: 264 -RKNVNVW----------------------------RDWGTASGLGLHTVQLNILNRGLN 294

Query: 397 FPK-ARKLVYSTCSIHAEENERVVIDLLLDETIKKAG--WRVAN---------REKVIPT 444
             K   +LVYSTCS++  ENE V+   L     +K G   R+ N         R K I  
Sbjct: 295 LLKDGGRLVYSTCSLNPIENESVIAAAL-----RKWGDKIRLVNCDEKLPGLVRSKGITQ 349

Query: 445 WP---------RRGWVDEFKEVFRDDEEKCKEI-AGGCIRALPKEDGGIGFFAVCFER 492
           WP          +G     +  F   EE+        CIR  P +    GFF   FE+
Sbjct: 350 WPVYDKNFALKEKGDEGVIETWFPPTEEEATRFHLENCIRVYPHQQNTGGFFITVFEK 407

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 110/302 (36%), Gaps = 67/302 (22%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  VL       V+D CAAPG+KT      +     +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVV-ANDA 203

Query: 282 DPERAKVLQKMVRTAGCARTIEVN--VGDFTKI---ATPEKFKNVTGF---IVDPSCSGS 333
           D  R+ +L   ++    A  + VN     F +I       K  ++  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPCSGD 263

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLS-KLASFQFQVVK 392
           G   RK ++                                D  T+    L + Q  ++ 
Sbjct: 264 GTM-RKNVNVWK-----------------------------DWNTQAGLGLHTVQLNILN 293

Query: 393 HAMTFPKAR-KLVYSTCSIHAEENERVVIDLLLDETIKKAG--WRVAN---------REK 440
             +   K+  +LVYSTCS++  ENE V+      E ++K G   R+ N         R K
Sbjct: 294 RGLHLLKSNGRLVYSTCSLNPIENEAVIA-----EALRKWGDKIRLVNCDDKLTGLIRSK 348

Query: 441 VIPTWP---------RRGWVDEFKEVFRDDEEKCKEI-AGGCIRALPKEDGGIGFFAVCF 490
            +  WP          +G     +  F   EE+  +     C+R  P +    GFF   F
Sbjct: 349 GVSKWPVYDRNLTEKNKGDEGTLESFFPPSEEEASKFNLKNCMRVYPHQQNTGGFFISVF 408

Query: 491 ER 492
           E+
Sbjct: 409 EK 410

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/301 (23%), Positives = 111/301 (36%), Gaps = 64/301 (21%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTH-TAAYILGGPSKDQKIQIHAFE 280
           G I  Q+  S  P  VL+      V+D CAAPG+KT     A  + GP     +   A +
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGPEPSGFVV--AND 196

Query: 281 KDPERAKVLQKMVRTAGCARTIEVNVG---------DFTKIATPEKFKNVTGFIVDPSCS 331
            D +R+ +L   ++    A  + VN           D  K    +++      + D  CS
Sbjct: 197 SDSKRSHMLVHQLKRLNSANLMVVNHDAQFFPKIQLDSNKGRHNKEYLKFDRILCDVPCS 256

Query: 332 GSGIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVV 391
           G G   RK ++                         ++++ ++ L      L + Q  ++
Sbjct: 257 GDGTI-RKNVNIW-----------------------KDWNTQNSL-----GLHNVQLNIL 287

Query: 392 KHAMTFPKA-RKLVYSTCSIHAEENERVVIDLL---------------LDETIKKAG--- 432
              +   K+  +LVYSTCS+   ENE V+   L               L   I   G   
Sbjct: 288 NRGIQLLKSGGRLVYSTCSLSPIENEAVISATLRKWGNKIKLVDCKEMLPGLISSPGISK 347

Query: 433 WRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEI-AGGCIRALPKEDGGIGFFAVCFE 491
           W V +R   I +   +G        F+  EE+  +     CIR  P +    GFF    E
Sbjct: 348 WEVYDRTMSIVS---KGAEKSKDTWFQPTEEEANDFNLSHCIRVFPHQQNTGGFFIAVLE 404

Query: 492 R 492
           +
Sbjct: 405 K 405

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 107/302 (35%), Gaps = 67/302 (22%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  VL       V+D CAAPG+KT      +     +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVV-ANDA 203

Query: 282 DPERAKVLQKMVRTAGCARTIEVN--VGDFTKI---ATPEKFKNVTGF---IVDPSCSGS 333
           D  R+ +L   ++    A  + VN     F +I          +V  F   + D  CSG 
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILCDVPCSGD 263

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLS-KLASFQFQVVK 392
           G   RK ++                                D  T+    L + Q  ++ 
Sbjct: 264 GTM-RKNVNVWK-----------------------------DWNTQAGLGLHTVQLNILN 293

Query: 393 HAMTFPKAR-KLVYSTCSIHAEENERVVIDLLLDETIKKAG--WRVAN---------REK 440
             +   K   +LVYSTCS++  ENE VV      E ++K G   R+ N         R K
Sbjct: 294 RGLHLLKNNGRLVYSTCSLNPIENEAVVA-----EALRKWGDKIRLVNCDDKLPGLIRSK 348

Query: 441 VIPTWP---------RRGWVDEFKEVFRDDEEKCKEI-AGGCIRALPKEDGGIGFFAVCF 490
            +  WP          +G     +  F   EE+        C+R  P +    GFF   F
Sbjct: 349 GVSKWPVYDRNLTEKTKGDEGTLESFFSPSEEEASRFNLQNCMRVYPHQQNTGGFFITVF 408

Query: 491 ER 492
           E+
Sbjct: 409 EK 410

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 114/296 (38%), Gaps = 55/296 (18%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  VL       V+D CAAPG+KT      +     +     + A + 
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMDTDEPTGFVV-ANDA 204

Query: 282 DPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATP---EKFKNVTGF---IVDPSCSGS 333
           D  R+ +L   ++    A  + VN     F +I      +K K++  F   + D  CSG 
Sbjct: 205 DSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVPCSGD 264

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKH 393
           G   RK ++                         ++++ +  L      L + Q+ ++  
Sbjct: 265 GTM-RKNVNVW-----------------------KDWNTQSGLG-----LHTVQYNILNR 295

Query: 394 AMTFPKAR-KLVYSTCSIHAEENERVVIDLL--LDETIK--KAGWRVAN--REKVIPTWP 446
            +   K+  +LVYSTCS++  ENE VV   L    + IK    G ++    R + I  WP
Sbjct: 296 GLNLLKSGGRLVYSTCSLNPIENEAVVAQALRTWGDKIKLVNCGDKLPGLVRSQGISQWP 355

Query: 447 ---------RRGWVDEFKEVFRDDEEKCKEI-AGGCIRALPKEDGGIGFFAVCFER 492
                     +G     +  F   EE+ K      CIR  P +    GFF    E+
Sbjct: 356 VIDRNMTEKNKGDEGTIESWFPPSEEEAKNFHLENCIRVYPHQQNTGGFFITVIEK 411

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 108/297 (36%), Gaps = 60/297 (20%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQ-IHAFE 280
           G I  Q+  S  P  VL       V+D CAAPG+KT      +    S+D+    + A +
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALHS--SEDEPTGFVVAND 202

Query: 281 KDPERAKVLQKMVRTAGCARTIEVN--VGDFTKIATPEKFKNVTGF---IVDPSCSGSGI 335
            D  R+ +L   ++    A  + VN     F ++ T ++      F   + D  CSG G 
Sbjct: 203 ADARRSHMLVHQLKRLNSANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGT 262

Query: 336 FGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAM 395
             RK ++                              KD        L + Q  ++K  +
Sbjct: 263 M-RKNVNVW----------------------------KDWGTASGLGLHTVQLNILKRGL 293

Query: 396 T-FPKARKLVYSTCSIHAEENERVVIDL---------LLDETIKKAGWRVANREKVIPTW 445
               K  +LVYSTCS++  ENE VV            L+D + K  G     R K I  W
Sbjct: 294 NLLKKGGRLVYSTCSMNPIENEAVVAAALRQWGDKIKLVDCSDKLPGLV---RSKGISNW 350

Query: 446 P---------RRGWVDEFKEVFRDDEEKCKEI-AGGCIRALPKEDGGIGFFAVCFER 492
           P          +G     +  F    E+  +     CIR  P +    GFF    E+
Sbjct: 351 PVIDKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFFITVIEK 407

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 70/302 (23%), Positives = 110/302 (36%), Gaps = 66/302 (21%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  VL+      V+D CAAPG+KT       L   S +    + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIE-ALHAESDEPSGFVIANDA 203

Query: 282 DPERAKVLQKMVRTAGCARTIEVNVG---------DFTKIATPEKFKNVTGFIVDPSCSG 332
           D +R+ +L   ++    A  + VN           D T+ +   +F      + D  CSG
Sbjct: 204 DYKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDVPCSG 263

Query: 333 SGIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVK 392
            G   RK ++       G  +                             L   Q  +++
Sbjct: 264 DGTM-RKNVNVWKDWNTGSGLG----------------------------LHIVQLNILE 294

Query: 393 HAMTFPK-ARKLVYSTCSIHAEENERVVIDLLLDETIKKAG--WRVANREKVIPTWPRRG 449
             +   K   KLVYSTCS++  ENE V+   L     ++ G   R+ N +  +P   R  
Sbjct: 295 RGLNLLKEGGKLVYSTCSLNPIENEAVIAAAL-----RRWGDKVRLVNCDDQLPGLVRSK 349

Query: 450 WVDEFK------EVFRDDEEKC---------KEIAG----GCIRALPKEDGGIGFFAVCF 490
            + E+K      +V     E C         +E+       C+R    +    GFF   F
Sbjct: 350 GITEWKVYDKQFQVREKGHENCLDSWFPPTAEEVEKFHLENCMRVYQHQQNTGGFFITVF 409

Query: 491 ER 492
           E+
Sbjct: 410 EK 411

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 109/295 (36%), Gaps = 65/295 (22%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  VL       V+D CAAPG+KTT     +     +     + A + 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKDTDEPTGFVV-ANDA 201

Query: 282 DPERAKVLQKMVRTAGCARTIEVN--VGDFTKIAT---PEKFKNVTGF---IVDPSCSGS 333
           D  R+ +L   ++    A  + VN     F +I     P K K    F   + D  CSG 
Sbjct: 202 DSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPCSGD 261

Query: 334 GIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKH 393
           G   RK ++                              KD        L + Q  ++  
Sbjct: 262 GTM-RKNVNVW----------------------------KDWNTQGALGLHTVQLNILDR 292

Query: 394 AMTFPKAR-KLVYSTCSIHAEENERVVIDLLLDETIKKAG--WRVANREKVIPTWPRRGW 450
            +   +   +LVYSTCS++  ENE VV      E +++ G   R+ +  + +P   R   
Sbjct: 293 GLHLLQNNGRLVYSTCSMNPIENEAVVA-----EALRRWGDKVRLVDCSEKLPGLIRSQG 347

Query: 451 VDEFKEVFRDDEEKCKEIAG-------------------GCIRALPKEDGGIGFF 486
           + ++  + R+ EE+ KE  G                    C+R  P +    GFF
Sbjct: 348 ITQWPVIDRNMEERKKEDEGMINSWFPPSEEEVSKFHLERCMRVYPHQQNTGGFF 402

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 107/304 (35%), Gaps = 71/304 (23%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  VL       V+D CAAPG+KT      +    ++     + A + 
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALHMENAEPTGFVV-ANDS 203

Query: 282 DPERAKVLQKMVRTAGCARTIEVN------------VGDFTKIATPEKFKNVTGFIVDPS 329
           D  R+ +L   ++    A  + VN            VGD  K     KF  +   + D  
Sbjct: 204 DYRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGD-NKAKDALKFDRI---LCDVP 259

Query: 330 CSGSGIFGRKFIDTLNKKKEGEDVDEDDESESIPVEQDEEFSKKDDLKTRLS-KLASFQF 388
           CSG G   RK ++                                D  T+    L + Q+
Sbjct: 260 CSGDGTM-RKNVNVWK-----------------------------DWNTQAGLGLHTIQY 289

Query: 389 QVVKHAMTFPK-ARKLVYSTCSIHAEENERVVIDLLLDETIKKAGWRVANREKVIPTWPR 447
            ++   +   K   +LVYSTCS++  ENE VV   L     K    ++ N +  +P   R
Sbjct: 290 NILNRGLHLLKTGGRLVYSTCSLNPIENEAVVARALRTWGSKI---KIINCDDKLPGLIR 346

Query: 448 RGWVDEFKEVFRDDEEKCKEIAG-------------------GCIRALPKEDGGIGFFAV 488
              V ++    R+ E K K   G                    C+R  P +    GFF  
Sbjct: 347 SNGVTQWPVFDRNMESKNKGDEGTLESWFPPTDEEVTAFNLQNCMRVYPHQQNTGGFFIT 406

Query: 489 CFER 492
             E+
Sbjct: 407 VIEK 410

>Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}
           YPL266W (REAL)
          Length = 318

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 42/111 (37%), Gaps = 20/111 (18%)

Query: 205 FGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYI 264
           F       I  + L  QG   I D+A   P+        D+V++     GN T       
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRIL--- 75

Query: 265 LGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATP 315
                 +Q   + A E DP  A  L K VR     + +E+ +GDF K   P
Sbjct: 76  ------EQAKSVVAVEMDPRMAAELTKRVRGTQVEKKLEIMLGDFMKTELP 120

>YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essential
           18S rRNA dimethylase (dimethyladenosine transferase),
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'-terminal loop of 18S rRNA, part of 90S and 40S
           pre-particles in nucleolus, involved in pre-ribosomal
           RNA processing
          Length = 318

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 42/111 (37%), Gaps = 20/111 (18%)

Query: 205 FGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYI 264
           F       I  + L  QG   I D+A   P+        D+V++     GN T       
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRIL--- 75

Query: 265 LGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATP 315
                 +Q   + A E DP  A  L K VR     + +E+ +GDF K   P
Sbjct: 76  ------EQAKNVVAVEMDPRMAAELTKRVRGTPVEKKLEIMLGDFMKTELP 120

>Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 42/111 (37%), Gaps = 20/111 (18%)

Query: 205 FGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYI 264
           F       I  + L  QG   I D+A   P+        D+V++     GN T       
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRIL--- 75

Query: 265 LGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATP 315
                 +Q   + A E DP  A  L K VR     + +E+ +GDF K   P
Sbjct: 76  ------EQAKNVVAVEMDPRMAAELTKRVRGTPVEKKLEIMLGDFMKTELP 120

>Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 42/111 (37%), Gaps = 20/111 (18%)

Query: 205 FGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYI 264
           F       I  + L  QG   I D+A   P+        D+V++     GN T       
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKAQIRPS--------DVVLEVGPGTGNLTVRIL--- 75

Query: 265 LGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATP 315
                 +Q   + A E DP  A  L K VR     + +E+ +GDF K   P
Sbjct: 76  ------EQAKNVVAVEMDPRMAAELTKRVRGTPVEKKLEILLGDFMKTELP 120

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 46/120 (38%), Gaps = 6/120 (5%)

Query: 222 GKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQKIQIHAFEK 281
           G I  Q+  S  P  VL       V+D CAAPG+KT      +     +     + A + 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALHATEDEPTGFVV-ANDA 203

Query: 282 DPERAKVLQKMVRTAGCARTIEVN--VGDFTKIAT---PEKFKNVTGFIVDPSCSGSGIF 336
           D  R+ +L   ++    A  + VN     F ++       +F      + D  CSG G  
Sbjct: 204 DARRSHMLVHQLKRLNSANLMVVNHDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSGDGTM 263

>KAFR0B06650 Chr2 complement(1386066..1387784) [1719 bp, 572 aa]
           {ON} Anc_6.174 YGL095C
          Length = 572

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 9/93 (9%)

Query: 145 DDANDITPVRWF---RINPIRTPLSKGVEGILEELEKKFPTRVDHWSKIEQGTIYHDEFI 201
           +D N +  +R F   R   + +  S   + +L EL KKF TR+D + K       + + I
Sbjct: 431 EDINYLHKIRSFYDKRSTRVESSTSSNKDDLLSELAKKFNTRMDAYKKTNVSNNVYMQHI 490

Query: 202 PNLFGVHT---KDKITSHE---LYKQGKIIIQD 228
           P L  + T    +K+++ E   L KQ    IQD
Sbjct: 491 PKLSNILTDLSNNKLSTEEFPFLNKQATAQIQD 523

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 44/111 (39%), Gaps = 20/111 (18%)

Query: 205 FGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYI 264
           F       I  + L  QG   I D+A   P+        DIV++     GN TT      
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTTRIL--- 75

Query: 265 LGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATP 315
                 ++  ++ A E DP  A  L K V      + +E+ +GDFTK   P
Sbjct: 76  ------EKARKVVAVEFDPRMAAELTKRVHGTAAEKKLEIILGDFTKTELP 120

>KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {ON}
           Anc_6.1 YPL266W
          Length = 318

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 43/111 (38%), Gaps = 20/111 (18%)

Query: 205 FGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYI 264
           F       I  + L  QG   I D+A+  P+        D+V++     GN T       
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKANIKPS--------DVVLEVGPGTGNLTVRIL--- 75

Query: 265 LGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATP 315
                 +Q  ++ A E DP  A  L K V      R +E+ +GDF K   P
Sbjct: 76  ------EQARKVVAVEMDPRMAAELTKRVHGTPAERKLEIILGDFMKTELP 120

>Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON}
           complement(42834..43793) [960 nt, 320 aa]
          Length = 319

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 43/111 (38%), Gaps = 20/111 (18%)

Query: 205 FGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYI 264
           F       I  + L  QG   I D+A+  P+        DIV++     GN T       
Sbjct: 31  FNTDLGQHILKNPLVAQG---IVDKANIKPS--------DIVLEVGPGTGNLTVRIL--- 76

Query: 265 LGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATP 315
                 +Q  ++ A E DP  A  L K V      + +E+ +GDF K   P
Sbjct: 77  ------EQARKVVAVEMDPRMAAELTKRVHGTPAEKKLEIMLGDFMKTELP 121

>ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 319

 Score = 33.9 bits (76), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 42/111 (37%), Gaps = 20/111 (18%)

Query: 205 FGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYI 264
           F       I  + L  QG   I D+A   P+        D V++     GN T       
Sbjct: 31  FNTDLGQHILKNPLVAQG---IVDKAQLRPS--------DTVLEVGPGTGNLTVRIL--- 76

Query: 265 LGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATP 315
                 +Q  + +A E DP  A  L K VR     R +E+ +GDF K   P
Sbjct: 77  ------EQVRKAYAVEMDPRMAAELTKRVRGTDGERKLEILLGDFIKTDLP 121

>CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266w DIM1
          Length = 317

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 42/111 (37%), Gaps = 20/111 (18%)

Query: 205 FGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYI 264
           F       I  + L  QG   I D+A   P+        DIV++     GN T       
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTVRIL--- 75

Query: 265 LGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATP 315
                 +Q  ++ A E DP  A  L K V      + +E+ +GDF K   P
Sbjct: 76  ------EQARKVVAVEMDPRMAAELTKRVHGTPAEKKLEIMLGDFMKTELP 120

>SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 322

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 42/111 (37%), Gaps = 20/111 (18%)

Query: 205 FGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYI 264
           F       I  + L  QG   I D+A   P+        D+V++     GN T       
Sbjct: 31  FNTDLGQHILKNPLVAQG---IVDKAQIKPS--------DVVLEVGPGTGNLTVRIL--- 76

Query: 265 LGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATP 315
                 +Q  ++ A E DP  A  L K V      + +E+ +GDF K   P
Sbjct: 77  ------EQARRVVAVEMDPRMAAELTKRVHGTAAEKKLEILLGDFMKTELP 121

>Smik_13.389 Chr13 (612617..613213) [597 bp, 198 aa] {ON} YMR184W
           (REAL)
          Length = 198

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 11/118 (9%)

Query: 349 EGEDVD--EDDESESIPVEQDEEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYS 406
           EGE V+   D +   I   +DE  +K ++L    SKL+S +    K        +KL  +
Sbjct: 90  EGESVEGHTDRQYNIISYNEDELLTKINNLSEPGSKLSSKELDFYK--------KKLDSN 141

Query: 407 TCSIHAEENERVVIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEK 464
              I   ++ ++V+  + DET KKA  +      V  T     W   F ++F +  +K
Sbjct: 142 IAKILQSDHTKIVLSQIFDETDKKAAVKTIKHWMVTDTT-ISNWCPAFLKLFENQSQK 198

>NDAI0K00950 Chr11 (215066..220258) [5193 bp, 1730 aa] {ON}
           Anc_8.753
          Length = 1730

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 50/111 (45%), Gaps = 15/111 (13%)

Query: 119 TSLRSEMVKLQVKMKLKSWGDLISSQDDANDITP----VRWFRINPIRTPLSKGVEGILE 174
           T L   ++ L +   L    + I S +DAN++        ++ +  +  PL K + G + 
Sbjct: 553 TELYHTLIALNIDTSLDECLNTILSTEDANNLKQNDCLYDYYALQLL--PLQKAMRGHVL 610

Query: 175 ELEKKFPTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKII 225
           + E         W +    T  H  F+  +  V+ +D + +HELY++ +I+
Sbjct: 611 QFE---------WYQNSLLTNMHPNFLSKVRNVNIQDTLLTHELYRKHEIL 652

>ACR026W Chr3 (404011..404970) [960 bp, 319 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL266W (DIM1)
          Length = 319

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 42/111 (37%), Gaps = 20/111 (18%)

Query: 205 FGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYI 264
           F       I  + L  QG   I D+A   P+        DIV++     GN T       
Sbjct: 30  FNTDLGQHILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTVRIL--- 75

Query: 265 LGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATP 315
                 +Q  ++ A E DP  A  L K V      + +E+ +GDF K   P
Sbjct: 76  ------EQARKVVAVEFDPRMAAELTKRVHGTPAEKKLEIMLGDFMKTELP 120

>NDAI0I02710 Chr9 (636403..637362) [960 bp, 319 aa] {ON} Anc_6.1
           YPL266W
          Length = 319

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 41/111 (36%), Gaps = 20/111 (18%)

Query: 205 FGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYI 264
           F       I  + L  QG   I D+A   P+        DIV++     GN T       
Sbjct: 31  FNTDLGQHILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTVRIL--- 76

Query: 265 LGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATP 315
                 +Q   + A E DP  A  L K V      + +E+ +GDF K   P
Sbjct: 77  ------EQARNVIAVEMDPRMAAELTKRVHGTPGEKKLEIMLGDFMKTELP 121

>NCAS0D02250 Chr4 (419581..420540) [960 bp, 319 aa] {ON} Anc_6.1
           YPL266W
          Length = 319

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 42/111 (37%), Gaps = 20/111 (18%)

Query: 205 FGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYI 264
           F       I  + L  QG   I D+A   P+        DIV++     GN T       
Sbjct: 31  FNTDLGQHILKNPLVAQG---IVDKAQIKPS--------DIVLEVGPGTGNLTVRIL--- 76

Query: 265 LGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATP 315
                 +Q  ++ A E DP  A  L K V      + +E+ +GDF K   P
Sbjct: 77  ------EQARKVVAVEMDPRMAAELTKRVHGTPSEKKLEILLGDFMKTDLP 121

>KLLA0D00594g Chr4 complement(57894..58856) [963 bp, 320 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 320

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 42/111 (37%), Gaps = 20/111 (18%)

Query: 205 FGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLNPGKDDIVIDSCAAPGNKTTHTAAYI 264
           F       I  + L  QG   I D+A   P+        DIV++     GN T       
Sbjct: 31  FNTDLGQHILKNPLVAQG---IVDKAQIKPS--------DIVLEIGPGTGNLTVRIL--- 76

Query: 265 LGGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGCARTIEVNVGDFTKIATP 315
                 +Q  ++ A E DP  A  L K V      + +E+ +GDF K   P
Sbjct: 77  ------EQARKVVAVEFDPRMAAELTKRVHGTPVEKKLEILLGDFMKTELP 121

>TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 155 WFRINPIRTPLSK---GVEGILEELEKKFPTRVDHWSKIEQ----GTIYHDEFIPNLFGV 207
            FR+NP R  +     GVE I   +++K+  ++    +IE+    G + H E   N FG+
Sbjct: 94  MFRLNPKRVFMDDAYGGVETIASLIKEKYGLKIFKLDQIEEFAEKGDLVHLETPLNPFGI 153

Query: 208 HTKDKITSHELYKQGKIIIQDRASCFP 234
            T     +  ++K+G ++  D     P
Sbjct: 154 CTNIVALAERVHKKGALLSVDSTLAPP 180

>Kwal_27.11892 s27 complement(991891..994110) [2220 bp, 739 aa] {ON}
           YBR156C (SLI15) - Mitotic spindle protein involved in
           chromosome segregation. [contig 27] FULL
          Length = 739

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 2/59 (3%)

Query: 178 KKFPTRVDHWSKIEQGTIYH--DEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFP 234
           ++ P R DH ++  Q T+    D  IP L       K+T+ +LY  G   I  R S  P
Sbjct: 350 QRRPLRADHTNRSIQETLKSIFDTQIPKLLQSEISGKLTNEKLYVDGNTKIVKRNSLIP 408

>Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)
          Length = 785

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%)

Query: 156 FRINPIRTPLSKGVEGILEELEKKFPTRVDHWSKIEQGT 194
           FR    R   +  V+GILEE++K     VDH SK  QGT
Sbjct: 699 FRFLLARLNKTGYVKGILEEVDKDLTDLVDHDSKTFQGT 737

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,146,776
Number of extensions: 2626604
Number of successful extensions: 15516
Number of sequences better than 10.0: 136
Number of HSP's gapped: 15756
Number of HSP's successfully gapped: 158
Length of query: 494
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 380
Effective length of database: 40,409,475
Effective search space: 15355600500
Effective search space used: 15355600500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)