Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C033902.285ON70170136290.0
CAGL0J03454g2.285ON69369426330.0
YNL021W (HDA1)2.285ON70669425900.0
Smik_14.3102.285ON70666825880.0
Skud_14.3082.285ON70666825870.0
Suva_14.3262.285ON70666825800.0
NDAI0G006502.285ON68966725680.0
NCAS0G038002.285ON72669125620.0
ZYRO0A01870g2.285ON70769925550.0
TDEL0G021602.285ON71469425360.0
KAFR0H033202.285ON70267725000.0
SAKL0E07700g2.285ON71266824960.0
KNAG0H020102.285ON69367024950.0
KLTH0G10340g2.285ON70870224780.0
Kwal_27.115372.285ON70870924560.0
Kpol_1039.322.285ON65965524470.0
Ecym_33242.285ON70670924370.0
KLLA0E08383g2.285ON70470124240.0
ADL216C2.285ON70570623710.0
TBLA0B069502.285ON79543418280.0
Kpol_1003.372.285ON57830013211e-175
Kpol_246.58.153ON4533623685e-37
SAKL0H25124g8.153ON4483643642e-36
Ecym_23468.153ON4853713652e-36
TPHA0H003208.153ON4503573632e-36
NCAS0B054808.153ON4513723623e-36
KLTH0E06446g8.153ON4493533614e-36
AFR172C8.153ON4493573581e-35
Kwal_55.207908.153ON4493533571e-35
TDEL0B045808.153ON4463573562e-35
KLLA0F09119g8.153ON4523593562e-35
KAFR0C029208.153ON4533563553e-35
TBLA0D021408.153ON4563683527e-35
NDAI0B027108.153ON4533573473e-34
Skud_7.798.153ON4523513447e-34
YGL194C (HOS2)8.153ON4523563447e-34
ZYRO0G19316g8.153ON4483613421e-33
Suva_7.718.153ON4523523412e-33
Smik_7.798.153ON4523563393e-33
CAGL0A03322g8.153ON4503593289e-32
KNAG0G013508.153ON4513323289e-32
Suva_14.113.8ON4333293145e-30
Skud_14.113.8ON4333293101e-29
NDAI0G037403.8ON4333293065e-29
KLTH0F19668g3.8ON4323433057e-29
Kpol_1038.113.8ON4333293057e-29
Kwal_55.221423.8ON4323433049e-29
KNAG0A011603.8ON4333293049e-29
KAFR0A086303.8ON4333293031e-28
CAGL0B01441g3.8ON4333293031e-28
Smik_14.23.8ON4333293031e-28
YNL330C (RPD3)3.8ON4333293031e-28
Ecym_20103.8ON4333513012e-28
AGR395W3.8ON4333513012e-28
TPHA0A003003.8ON4333293003e-28
TBLA0I005603.8ON4333293003e-28
NCAS0C043203.8ON4343293003e-28
KLLA0E01981g3.8ON4323292994e-28
SAKL0C13706g3.8ON4333282994e-28
ZYRO0C03498g3.8ON4333292994e-28
TDEL0A002703.8ON4333292951e-27
TDEL0C050403.362ON4541811992e-15
Skud_16.3533.362ON4712141912e-14
YPR068C (HOS1)3.362ON4701771869e-14
CAGL0D01430g3.362ON4452461851e-13
Suva_16.3963.362ON4771771851e-13
ZYRO0C16390g3.362ON4361781841e-13
Kwal_23.37243.362ON4731771842e-13
NDAI0A051203.362ON5082601842e-13
Ecym_82908.607ON7093551842e-13
KLTH0F10582g3.362ON4742221823e-13
Smik_16.3093.362ON4701771805e-13
SAKL0B07854g3.362ON4891771805e-13
ADL339W3.362ON4372461771e-12
TBLA0B023903.362ON5791781771e-12
KAFR0H008903.362ON4742101743e-12
NCAS0A111803.362ON4901761725e-12
Kpol_376.153.362ON5181771709e-12
YPL116W (HOS3)8.607ON6973671701e-11
Kwal_27.11541singletonOFF102751531e-11
TDEL0A055208.607ON6743471691e-11
KLTH0D09592g8.607ON7053721682e-11
KLLA0B09394g3.362ON4411771635e-11
TPHA0M015903.362ON4942921636e-11
KNAG0H006303.362ON4562311627e-11
NCAS0C017608.607ON7003521638e-11
Ecym_34653.362ON4451831619e-11
Smik_6.3158.607ON6973671611e-10
ADL265W8.607ON6942941602e-10
Suva_16.1948.607ON6993671592e-10
KNAG0J013008.607ON6773491574e-10
SAKL0H08338g8.607ON6901621574e-10
KAFR0H027908.607ON7171631574e-10
TBLA0E040808.607ON6942931557e-10
Skud_16.1648.607ON6973491531e-09
ZYRO0F10780g8.607ON6683411522e-09
KLLA0F00858g8.607ON7153771522e-09
Kpol_479.68.607ON6883501512e-09
TPHA0A011208.607ON6983441469e-09
Kwal_26.85058.607ON7082931469e-09
CAGL0J06974g8.607ON6783681413e-08
NDAI0E024808.607ON6841471396e-08
Kwal_27.11536singletonOFF1951001282e-07
Kwal_27.11540singletonOFF111981072e-05
KNAG0B059804.234ON43189733.7
KLLA0C07579g7.271ON61994734.1
TPHA0F025506.61ON799104725.6
NCAS0C031908.341ON994155709.9
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TPHA0C03390
         (2106 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...  1402   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1018   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1002   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1001   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1001   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...   998   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...   993   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}              991   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...   988   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...   981   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...   967   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...   966   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...   965   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...   959   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...   950   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...   947   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...   943   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...   938   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...   917   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   708   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   513   e-175
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   146   5e-37
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   144   2e-36
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   145   2e-36
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   144   2e-36
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   144   3e-36
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   143   4e-36
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   142   1e-35
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   142   1e-35
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   141   2e-35
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   141   2e-35
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   141   3e-35
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   140   7e-35
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    138   3e-34
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   137   7e-34
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   137   7e-34
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   136   1e-33
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   135   2e-33
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   135   3e-33
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   130   9e-32
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   130   9e-32
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   125   5e-30
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   124   1e-29
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   122   5e-29
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   122   7e-29
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   122   7e-29
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   121   9e-29
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   121   9e-29
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   121   1e-28
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   121   1e-28
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   121   1e-28
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   121   1e-28
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   120   2e-28
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   120   2e-28
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   120   3e-28
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   120   3e-28
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      120   3e-28
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   119   4e-28
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   119   4e-28
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   119   4e-28
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   118   1e-27
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    81   2e-15
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    78   2e-14
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    76   9e-14
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    76   1e-13
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    76   1e-13
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    75   1e-13
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    75   2e-13
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    75   2e-13
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    75   2e-13
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    75   3e-13
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    74   5e-13
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    74   5e-13
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    73   1e-12
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    73   1e-12
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    72   3e-12
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    71   5e-12
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    70   9e-12
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    70   1e-11
Kwal_27.11541 s27 complement(841066..841374) [309 bp, 102 aa] {O...    64   1e-11
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    70   1e-11
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    69   2e-11
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    67   5e-11
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    67   6e-11
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    67   7e-11
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    67   8e-11
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    67   9e-11
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    67   1e-10
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    66   2e-10
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    66   2e-10
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    65   4e-10
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    65   4e-10
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    65   4e-10
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    64   7e-10
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    64   1e-09
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    63   2e-09
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    63   2e-09
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    63   2e-09
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    61   9e-09
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    61   9e-09
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    59   3e-08
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    58   6e-08
Kwal_27.11536 s27 complement(839030..839617) [588 bp, 195 aa] {O...    54   2e-07
Kwal_27.11540 s27 complement(840674..841009) [336 bp, 111 aa] {O...    46   2e-05
KNAG0B05980 Chr2 (1171306..1172601) [1296 bp, 431 aa] {ON} Anc_4...    33   3.7  
KLLA0C07579g Chr3 complement(662466..664325) [1860 bp, 619 aa] {...    33   4.1  
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    32   5.6  
NCAS0C03190 Chr3 complement(626407..629391) [2985 bp, 994 aa] {O...    32   9.9  

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
            Anc_2.285 YNL021W
          Length = 701

 Score = 1402 bits (3629), Expect = 0.0
 Identities = 685/701 (97%), Positives = 685/701 (97%)
 Frame = +1

Query: 1    MSEQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVR 180
            MSEQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVR
Sbjct: 1    MSEQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVR 60

Query: 181  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVRE 360
            MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVRE
Sbjct: 61   MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVRE 120

Query: 361  ATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEAC 540
            ATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEAC
Sbjct: 121  ATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEAC 180

Query: 541  KAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWD 720
            KAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWD
Sbjct: 181  KAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWD 240

Query: 721  IHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKG 900
            IHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKG
Sbjct: 241  IHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKG 300

Query: 901  VGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSL 1080
            VGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSL
Sbjct: 301  VGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSL 360

Query: 1081 ARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQS 1260
            ARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQS
Sbjct: 361  ARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQS 420

Query: 1261 KYWKCFRRKFGNFGGEYENAIESQIPKMFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXX 1440
            KYWKCFRRKFGNFGGEYENAIESQIPKMFPLQDAIRNAQLSHYYDDFGM           
Sbjct: 421  KYWKCFRRKFGNFGGEYENAIESQIPKMFPLQDAIRNAQLSHYYDDFGMISLSLPNLNLP 480

Query: 1441 XXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERET 1620
                 CSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERET
Sbjct: 481  KNSIICSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERET 540

Query: 1621 AVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLL 1800
            AVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLL
Sbjct: 541  AVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLL 600

Query: 1801 GKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSENDKKPRK 1980
            GKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSENDKKPRK
Sbjct: 601  GKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSENDKKPRK 660

Query: 1981 KYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTEDE 2103
            KYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTEDE
Sbjct: 661  KYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTEDE 701

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] {ON}
            highly similar to uniprot|P53973 Saccharomyces cerevisiae
            YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1018 bits (2633), Expect = 0.0
 Identities = 475/694 (68%), Positives = 577/694 (83%), Gaps = 2/694 (0%)
 Frame = +1

Query: 22   KRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKI 201
            KRKL+D+     V             KRPVIVPT+K  +HYTPLKTGICYDVRMRYHAKI
Sbjct: 13   KRKLEDDVASQDV-------------KRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKI 59

Query: 202  FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREATKEEIL 381
            FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDP+L+GV+DIGDLMLKIP+R AT EEIL
Sbjct: 60   FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEIL 119

Query: 382  DVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGR 561
            +VH++EH++F+E TEKM REELL +TEKGDSVY NNDSY ++RL CGGAIEACKAVVEGR
Sbjct: 120  EVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGR 179

Query: 562  VKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGT 741
            VKN+LA+VRPPGHHAEP+AAGGFCLFSNV+VAAK+ILK YPESVR+ILI+DWD+HHGNGT
Sbjct: 180  VKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGT 239

Query: 742  QKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYI 921
            QKAFY+DD VLYISLHRFELGK+YPG  +G YD++G+GKGKGFNCNITWPV GVGD EY+
Sbjct: 240  QKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYM 299

Query: 922  WAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCV 1101
            WAFEQ+V+PM REF+PDLVI+SSGFDAA GDTIGQCHVTP+CYG+MTHMLKSLARGNLCV
Sbjct: 300  WAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCV 359

Query: 1102 VLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFR 1281
            VLEGGYNLD+I+ SAL+VAKILIGEPPDE+P+  R+PK   LE+I+KVI +QSKYWKCF 
Sbjct: 360  VLEGGYNLDAIAISALSVAKILIGEPPDELPDPLREPKAEALEIIDKVISLQSKYWKCFG 419

Query: 1282 RKFGNFGGEYENAIES-QIPKMFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXC 1458
            +++GN G   EN +++  + K FPLQ AIR  Q     +DFG                 C
Sbjct: 420  KRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVIC 479

Query: 1459 SSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDIN 1638
            S N F   ++ V++HDTPE+W  R++ITG IDPSTS++ DS  +FI W +ER+  ++DIN
Sbjct: 480  SPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDIN 539

Query: 1639 IPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTR 1818
            IP+S FE +NY++ L SQ+++I +WDN+ K+  SL K+ FIGIG+A++GIVHLLG RDTR
Sbjct: 540  IPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTR 599

Query: 1819 TVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRV 1995
            +V K+ ++F+G  SLKP+VP ++ESLGDWYFKNSLVFTDH H CW +N+ +KPRKK+GRV
Sbjct: 600  SVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRV 659

Query: 1996 LRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 2097
            LRCD +G++NIIEER EE+TDFILD+F+EWSD+E
Sbjct: 660  LRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
            catalytic subunit of a class II histone deacetylase
            complex that also contains Hda2p and Hda3p; Hda1p
            interacts with the Hda2p-Hda3p subcomplex to form an
            active tetramer; deletion increases histone H2B, H3 and
            H4 acetylation
          Length = 706

 Score = 1002 bits (2590), Expect = 0.0
 Identities = 471/694 (67%), Positives = 571/694 (82%), Gaps = 2/694 (0%)
 Frame = +1

Query: 22   KRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKI 201
            KRKL++  E  + S+    K      KR VIVP   P +HY+PLKTG+CYDVRMRYHAKI
Sbjct: 19   KRKLEENKEEEN-SLSTTSK-----SKRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKI 72

Query: 202  FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREATKEEIL 381
            FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDP+L+GV D+GDLMLKIPVR AT EEIL
Sbjct: 73   FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEIL 132

Query: 382  DVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGR 561
            +VHT+EH++F+ESTEKM+REELL +TEKGDSVY NNDSY SARL CGGAIEACKAVVEGR
Sbjct: 133  EVHTKEHLEFIESTEKMSREELLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGR 192

Query: 562  VKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGT 741
            VKN+LA+VRPPGHHAEPQAAGGFCLFSNV+VAAK+ILK YPESVR+I+I+DWDIHHGNGT
Sbjct: 193  VKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGT 252

Query: 742  QKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYI 921
            QK+FY+DD VLY+SLHRFE+GK+YPG  +G YD+ G+GKG+GFNCNITWPV GVGD EY+
Sbjct: 253  QKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYM 312

Query: 922  WAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCV 1101
            WAFEQ+V+PM REF+PDLVI+SSGFDAA GDTIGQCHVTP+CYG+MTHMLKSLARGNLCV
Sbjct: 313  WAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCV 372

Query: 1102 VLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFR 1281
            VLEGGYNLD+I+ SAL+VAK+LIGEPPDE+P+   DPKP V+EMI+KVIR+QSKYW CFR
Sbjct: 373  VLEGGYNLDAIARSALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKVIRLQSKYWNCFR 432

Query: 1282 RKFGNFGGEYENAI-ESQIPKMFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXC 1458
            R+  N G  +   I +S I K FPLQ AIR  Q  +  D+F                  C
Sbjct: 433  RRHANSGCNFNEPINDSIISKNFPLQKAIRQQQQHYLSDEFNFVTLPLVSMDLPDNTVLC 492

Query: 1459 SSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDIN 1638
            + N  ++ ++ +++HDT ++W  R++I+G ID S+S+I D+SL FI W ++R+  +ID+N
Sbjct: 493  TPNISESNTIIIVVHDTSDIWAKRNVISGTIDLSSSVIIDNSLDFIKWGLDRKYGIIDVN 552

Query: 1639 IPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTR 1818
            IP + FE DNYS  + SQ+V+I LWDN+ KY  S+ K+ FIGIG++ SGIVHLLG RDTR
Sbjct: 553  IPLTLFEPDNYSGMITSQEVLIYLWDNYIKYFPSVAKIAFIGIGDSYSGIVHLLGHRDTR 612

Query: 1819 TVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRV 1995
             VTK  INF+G   LKP+VP +DE+L +WYFKNSL+F+++ H CW EN+ +KPRKK+GRV
Sbjct: 613  AVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRV 672

Query: 1996 LRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 2097
            LRCDTDG++NIIEERFEEATDFILD+F+EWSD E
Sbjct: 673  LRCDTDGLNNIIEERFEEATDFILDSFEEWSDEE 706

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
            (REAL)
          Length = 706

 Score = 1001 bits (2588), Expect = 0.0
 Identities = 462/668 (69%), Positives = 561/668 (83%), Gaps = 2/668 (0%)
 Frame = +1

Query: 100  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 279
            KR VIVP   P +HY+PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 39   KRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 280  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 459
            ENGLINDP+L+GV D+GDLMLKIPVR AT EEIL+VHT+EH++F+ESTEKM+RE+LL +T
Sbjct: 99   ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158

Query: 460  EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 639
            EKGDSVY NNDSY SARL CGGAIEACKAVVEGRVKN+LA+VRPPGHHAEPQAAGGFCLF
Sbjct: 159  EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 640  SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 819
            SNV+VAAK+ILK YPESVR+I+I+DWDIHHGNGTQK+FY+DD VLY+SLHRFE+GK+YPG
Sbjct: 219  SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPG 278

Query: 820  FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 999
              +G YD+ G+GKG+GFNCNITWPV GVGD EY+WAFEQ+V+PM REF+PDLVI+SSGFD
Sbjct: 279  TIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338

Query: 1000 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 1179
            AA GDTIGQCHVTP+CYG+MTHMLKSLARGNLCVVLEGGYNLD+I+ SAL+VAK+LIGEP
Sbjct: 339  AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 398

Query: 1180 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQ 1356
            PDE+P+S  DPKP V+EMI+KVIR+QSKYW CFRR+  N G  +   I +S + K FPLQ
Sbjct: 399  PDELPDSSSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQ 458

Query: 1357 DAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDI 1536
             AIR  Q  +  D+F +                C+ N +++ +L V++HDT ++W  R++
Sbjct: 459  KAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNV 518

Query: 1537 ITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWD 1716
            I+G ID S+S+I D+ L FI W ++R+  +ID+NIP S FE DNYS  + SQ+V+I LWD
Sbjct: 519  ISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWD 578

Query: 1717 NHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESL 1896
            N+ KY  ++ K+ F+GIG++ SGIVHLLG RDTR VTK  INF+G   LKP+VP +DE+L
Sbjct: 579  NYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL 638

Query: 1897 GDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDA 2073
             +WYFKNSL+F+++ H CW EN+ +KPRKK+GRVLRCDTDG++N IEERFEEATDFILD+
Sbjct: 639  SEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDS 698

Query: 2074 FDEWSDTE 2097
            F+EWSD E
Sbjct: 699  FEEWSDEE 706

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
            (REAL)
          Length = 706

 Score = 1001 bits (2587), Expect = 0.0
 Identities = 465/668 (69%), Positives = 561/668 (83%), Gaps = 2/668 (0%)
 Frame = +1

Query: 100  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 279
            KR VIVP   P +HY+PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 39   KRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 280  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 459
            ENGLINDP+L+GV DIGDLMLKIPVR AT EEIL+VHT+EH++F+ESTEKM+RE+LL +T
Sbjct: 99   ENGLINDPTLSGVDDIGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158

Query: 460  EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 639
            EKGDSVY NNDSY SARL CGGAIEACKAVVEGRVKN+LA+VRPPGHHAEPQAAGGFCLF
Sbjct: 159  EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 640  SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 819
            SNV+VAAK+ILK YPESVR+I+I+DWDIHHGNGTQK+FY+DD VLY+SLHRFE+GK+YPG
Sbjct: 219  SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPG 278

Query: 820  FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 999
              +G YD+ G+GKG+GFNCNITWPV GVGD EY+WAFEQ+V+PM REF+PDLVI+SSGFD
Sbjct: 279  TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338

Query: 1000 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 1179
            AA GDTIGQCHV+P+CYG+MTHMLKSLARGNLCVVLEGGYNLD+I+ SAL+VAK+LIGEP
Sbjct: 339  AADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 398

Query: 1180 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQ 1356
            PDE+P+S  DPKP V+EMI+KVIR+QSKYW CFRR+  N G  +   I +S I K FPLQ
Sbjct: 399  PDELPDSLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQ 458

Query: 1357 DAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDI 1536
             AIR  QL +  ++F                  C+ N F++ +L V++HDT +VW  R++
Sbjct: 459  KAIRQQQLQYLSNEFSFVTLPLINMGLPDNTALCTPNVFESNALLVVVHDTSDVWAKRNV 518

Query: 1537 ITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWD 1716
            I+G ID S+S+I D+ + FI W ++R+  +ID+NIP + FEADNYS  + SQ+V+I LWD
Sbjct: 519  ISGTIDLSSSVIIDNCIDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWD 578

Query: 1717 NHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESL 1896
            N+ KY  ++ K+ FIGIG++ SGIVHLLG RDTR VTK  INF+G   LKP+VP +DE+L
Sbjct: 579  NYIKYFPNVAKIAFIGIGDSHSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL 638

Query: 1897 GDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDA 2073
             +WYFKNSL+F+++ H CW EN+ +KPRKK+GRVLRCDTDG+ N IEERFEEATDFILD+
Sbjct: 639  SEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTDGLSNTIEERFEEATDFILDS 698

Query: 2074 FDEWSDTE 2097
            F+EWSD E
Sbjct: 699  FEEWSDDE 706

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
            (REAL)
          Length = 706

 Score =  998 bits (2580), Expect = 0.0
 Identities = 465/668 (69%), Positives = 559/668 (83%), Gaps = 2/668 (0%)
 Frame = +1

Query: 100  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 279
            KR VIVP   P LHYTPL+TG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 39   KRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 280  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 459
            ENGLINDP+L+GV D+GDLMLKIPVR AT EEIL+VHT+EH++F+ESTEKM+RE+LL +T
Sbjct: 99   ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158

Query: 460  EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 639
            EKGDSVY NNDSY SARL CGGAIEACKAVVEGRVKN+LA+VRPPGHHAEPQAAGGFCLF
Sbjct: 159  EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 640  SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 819
            SNV+VAAK+ILK YPESVR+I+I+DWDIHHGNGTQK+FY+DD VLYISLHRFE+GK+YPG
Sbjct: 219  SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPG 278

Query: 820  FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 999
              +G YD+ G+GKG+GFNCNITWPV GVGD EY+WAFEQ+V+PM REF+PDLVI+SSGFD
Sbjct: 279  TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338

Query: 1000 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 1179
            AA GDTIGQCHVTP+CYG+MTHMLKSLARGNLCVVLEGGYNLD+I+ SAL+VAK+LIGEP
Sbjct: 339  AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGEP 398

Query: 1180 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQ 1356
            PDE+P+   DPKP V+EMI+KV+R+QSKYW CFRR+  N G  +   I +S I K FPLQ
Sbjct: 399  PDELPDPLSDPKPEVIEMIDKVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQ 458

Query: 1357 DAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDI 1536
             AIR  QL +  D+F                  C+ N  ++ +L V++HDT +VW  R++
Sbjct: 459  KAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNV 518

Query: 1537 ITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWD 1716
            I+G ID S+S++ D+ L FI W ++R+  +ID+NIP + FEADNYS  + SQ+V+I LWD
Sbjct: 519  ISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWD 578

Query: 1717 NHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESL 1896
            N+ KY  ++ K+ +IGIG++ SGIVHLLG RDTR VTK  INF+G   LKP+VP +DE+L
Sbjct: 579  NYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL 638

Query: 1897 GDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDA 2073
             +WYFKNSLVFT++ H CW EN+ +KPRKK+GRVLRCDTDG+ N +EERFEEATDFILD+
Sbjct: 639  TEWYFKNSLVFTNNSHQCWKENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDS 698

Query: 2074 FDEWSDTE 2097
            F+EWSD E
Sbjct: 699  FEEWSDEE 706

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
            Anc_2.285 YNL021W
          Length = 689

 Score =  993 bits (2568), Expect = 0.0
 Identities = 466/667 (69%), Positives = 556/667 (83%), Gaps = 2/667 (0%)
 Frame = +1

Query: 103  RPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 282
            R +IVP +   +HYTPLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE
Sbjct: 23   RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82

Query: 283  NGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTE 462
            NGLI DP+L+G+ DIGDLMLKIPVREAT EEIL+VH++EH+ F+EST KM RE+LL  TE
Sbjct: 83   NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142

Query: 463  KGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFS 642
             GDSVY N+DSY SA+L  GGAIEACKAVVEGRVKNALA+VRPPGHHAEP+AAGGFCLFS
Sbjct: 143  SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202

Query: 643  NVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGF 822
            NV++AAK+ILK YPESVRKILI+DWDIHHGNGTQKAFY+DD +LY+SLHRF++GK+YPG 
Sbjct: 203  NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262

Query: 823  PEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDA 1002
              G YD+ G+GKG+GFNCNITWPV GVGD EY+WAFEQIV+PM REF+PDLVI+S+GFDA
Sbjct: 263  IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322

Query: 1003 AHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPP 1182
            A GDTIGQCHVTP+CYG+MTHMLKSLARGN+ VVLEGGYNLDSI+ SAL+VAKILIGEPP
Sbjct: 323  ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382

Query: 1183 DEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAIESQI-PKMFPLQD 1359
            DE+P+  RDPKP V+EMI+KV+R+QSKYWKCF+ KFGN G +++  I + I  K FPLQ 
Sbjct: 383  DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442

Query: 1360 AIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDII 1539
            AIR  Q+ +   +F                  CSSN +++ ++ + +HDTPE+W  RD I
Sbjct: 443  AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502

Query: 1540 TGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDN 1719
             G IDPS+SII DSSL  I WAIER+  VIDINIP++  E +NY S + +Q+V+I+LWDN
Sbjct: 503  QGTIDPSSSIIVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562

Query: 1720 HFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLG 1899
            + KY  ++ K+ F+GIG+A SGIVHLLG RDTR+V KA INFVG   LKP+VP +DESLG
Sbjct: 563  YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622

Query: 1900 DWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAF 2076
            +WYFKNSLVF++  H  W + + KKPRKKYGRVLRCDTDGI NI+EERFEEATDFILD+F
Sbjct: 623  EWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSF 682

Query: 2077 DEWSDTE 2097
            +EWSD+E
Sbjct: 683  EEWSDSE 689

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score =  991 bits (2562), Expect = 0.0
 Identities = 470/691 (68%), Positives = 566/691 (81%), Gaps = 2/691 (0%)
 Frame = +1

Query: 31   LKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTS 210
            +K+E E     I D       + +RPVIVP +   L YTPLKTG+CYDVRMRYHAKIFTS
Sbjct: 43   VKEEPELKKQKITD-------VSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTS 95

Query: 211  YFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVH 390
            YFEYIDPHPEDPRRIYRIYKILAENGLI DP+L+G+ DIGDLMLKIPVR+AT+EEIL+VH
Sbjct: 96   YFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVH 155

Query: 391  TEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKN 570
            ++EH  F+E T  M REELL  TEKGDSVY NNDS+ SA+L  GG+IEACKAVVEGRVKN
Sbjct: 156  SKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKN 215

Query: 571  ALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKA 750
            +LA+VRPPGHHAEPQAAGGFCLFSNV++AAK+ILK YPESVR+I+I+DWDIHHGNGTQKA
Sbjct: 216  SLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKA 275

Query: 751  FYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAF 930
            FY+DD VLYISLHRFELGK+YPG   G YD+ G+GKG+GFNCNITWPV GVGD EYIWAF
Sbjct: 276  FYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAF 335

Query: 931  EQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLE 1110
            EQ+V+PMAREF+PDLVI+SSGFDAA GD+IGQCHVTP+CYG+MTHMLKSLA+GNLCVVLE
Sbjct: 336  EQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLE 395

Query: 1111 GGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKF 1290
            GGYNLD+I+ SAL+VAKILIGEPPDE+P+  RDPKP  +E+I+KVIR+QSKYWKCF+R++
Sbjct: 396  GGYNLDAIARSALSVAKILIGEPPDELPDPLRDPKPEAIEIIDKVIRLQSKYWKCFKRRY 455

Query: 1291 GNFGGEYENAI-ESQIPKMFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSN 1467
            GN G  +++ I ES I K FPLQ AIR  QL+    DF                  CS N
Sbjct: 456  GNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPN 515

Query: 1468 FFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPR 1647
             +++K++ +  HDTPE+W  RD+I G IDPS+SII DS+L FI WA E++  VIDINIP+
Sbjct: 516  VYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQ 575

Query: 1648 SAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVT 1827
            + FE +NYS+ + SQ+V+  +WDN+ KY  ++EK+ FIGIG+A SGIVHLLG RDTR+V 
Sbjct: 576  NLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVV 635

Query: 1828 KAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRC 2004
            K+ INF+    L+ +VP +DESL DWYFKNSLVF+D  H  W + + KKPRKKYGR+LRC
Sbjct: 636  KSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKKPRKKYGRLLRC 695

Query: 2005 DTDGIHNIIEERFEEATDFILDAFDEWSDTE 2097
            +TDGI+NI+EERFEEATDFILD+F+EWSD+E
Sbjct: 696  ETDGINNIVEERFEEATDFILDSFEEWSDSE 726

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
            highly similar to uniprot|P53973 Saccharomyces cerevisiae
            YNL021W HDA1 Putative catalytic subunit of a class II
            histone deacetylase complex that also contains Hda2p and
            Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
            form an active tetramer deletion increases histone H2B H3
            and H4 acetylation
          Length = 707

 Score =  988 bits (2555), Expect = 0.0
 Identities = 471/699 (67%), Positives = 564/699 (80%), Gaps = 2/699 (0%)
 Frame = +1

Query: 7    EQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMR 186
            E  G KRKL++    P     +   V     KR +IVP  +P +HYTPLKTG+CYDVRMR
Sbjct: 10   EDEGSKRKLEESPNGPVEKKPNVASVSNGRQKRQIIVPACEPKIHYTPLKTGLCYDVRMR 69

Query: 187  YHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREAT 366
            YHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDP+L+G  DIG+LMLKIPVREAT
Sbjct: 70   YHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGEDDIGELMLKIPVREAT 129

Query: 367  KEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKA 546
             EE+L VHT+EH++F+E T +M REELL +TE GDSVY N+DSY +A+L CGGAIEACKA
Sbjct: 130  VEELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDSYSAAKLPCGGAIEACKA 189

Query: 547  VVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIH 726
            VVEGRVKNALA++RPPGHHAEP+ AGGFCLFSNV+VAA++ILK YPESVR+ILI+DWDIH
Sbjct: 190  VVEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILKNYPESVRRILILDWDIH 249

Query: 727  HGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVG 906
            HGNGTQKAFY DD VLYISLHRFELGK+YPG   G YD+ G+GKG+GFNCNITWPV GVG
Sbjct: 250  HGNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEGKGEGFNCNITWPVGGVG 309

Query: 907  DVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLAR 1086
            D EY+ AFEQIV+PMARE+RPDLVI+SSGFDAA GDTIGQCHV+P+CYG+MTHMLKSLAR
Sbjct: 310  DAEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLAR 369

Query: 1087 GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKY 1266
            GNLCV LEGGYNLD+I+ SAL+VAKILIGEPP+E+P+  ++PK   +EMI+KVI VQSKY
Sbjct: 370  GNLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPKLEAIEMIDKVIHVQSKY 429

Query: 1267 WKCFRRKFGNFGGEYENAI-ESQIPKMFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXXX 1443
            WKCFRR  GN G  ++  + ES I K FPLQ AIR  Q      ++G             
Sbjct: 430  WKCFRR-LGNSGCNFKEPVTESLITKNFPLQKAIRQEQFHQLEKEYGFVTLPVPKLELPE 488

Query: 1444 XXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETA 1623
                CS + F+  ++ + +HDTPE+W  RD+ITG+IDPSTSI  DS L FI W++ R+  
Sbjct: 489  DTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSLARKYG 548

Query: 1624 VIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLG 1803
            VID+NIP+S FE DNYS+ + SQ+V+I LWDN  KY  SL K+ F+G+G+A SGIVHLLG
Sbjct: 549  VIDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDAYSGIVHLLG 608

Query: 1804 KRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPRK 1980
             RDTR+V KA INFVG   LKP+VP +DESLGDWYFKNSLVF+D  + CW +N+ KKPR+
Sbjct: 609  HRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWVDNENKKPRR 668

Query: 1981 KYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 2097
            K+GRVLRC++DGI+N +EERF+EATDFILD+F+EWSD+E
Sbjct: 669  KFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
            Anc_2.285 YNL021W
          Length = 714

 Score =  981 bits (2536), Expect = 0.0
 Identities = 460/694 (66%), Positives = 558/694 (80%), Gaps = 2/694 (0%)
 Frame = +1

Query: 22   KRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKI 201
            KRK++++++          +       + VIVP   PNLHYTPLKT +CYDVRMRYHAKI
Sbjct: 21   KRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHAKI 80

Query: 202  FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREATKEEIL 381
            FTSYFEYIDPHPEDPRRIYR+YKILAENGLINDP+L+G+ +IGDLMLKIPVREAT EEIL
Sbjct: 81   FTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEEIL 140

Query: 382  DVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGR 561
            +VH++E+++F+E + +M REELL +TEKGDSVY NNDSY+SA+LSCGG I+ACKAVVEGR
Sbjct: 141  EVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGR 200

Query: 562  VKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGT 741
            VKNALA+VRPPGHHAEP+A GGFCLFSNV+VAA++ILK YPESVR+ILI+DWDIHHGNGT
Sbjct: 201  VKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGT 260

Query: 742  QKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYI 921
            QKAFY D  VLYISLHRFE+GK+YPG   G YD+ G+GKG+GFNCNITWPV GVGD EY+
Sbjct: 261  QKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYM 320

Query: 922  WAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCV 1101
             AFEQIV+PMAREF+PDLVI+SSGFDAA GDTIGQCHVTP+CYG MTHMLKSLARGNLCV
Sbjct: 321  LAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLCV 380

Query: 1102 VLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFR 1281
             LEGGYNLD+I+ SAL+VAK+LIGEPPDE+P+  +DPK   +EMI+ VI  QSKYWKCF+
Sbjct: 381  ALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKCFQ 440

Query: 1282 RKFGNFGGEY-ENAIESQIPKMFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXC 1458
            RKFGN G  + E   E+ I K FPLQ AIR  Q      ++G                 C
Sbjct: 441  RKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSVLC 500

Query: 1459 SSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDIN 1638
            S   F+  ++ +++HDTPE+W  RD+ITG+IDPSTSII DS L F  W + R+  VID+N
Sbjct: 501  SPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVIDVN 560

Query: 1639 IPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTR 1818
            IP+S FE DNYS+ + SQ+V++ +WDN+ KY  SL K+ F+G G+A +GIVHLLG RDTR
Sbjct: 561  IPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHRDTR 620

Query: 1819 TVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRV 1995
               KA ++F+G   LKP+VP +DESL DWYFKNSL+FTD  H CW++N+ KKPRKK+GRV
Sbjct: 621  ATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKKPRKKFGRV 680

Query: 1996 LRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 2097
            LRCDTDG+++ +EERFEEATDFILD F+EWSD+E
Sbjct: 681  LRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
            YNL021W
          Length = 702

 Score =  967 bits (2500), Expect = 0.0
 Identities = 450/677 (66%), Positives = 553/677 (81%), Gaps = 6/677 (0%)
 Frame = +1

Query: 85   IQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 264
            + V+PKR VIVPT+KP +HY PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
Sbjct: 26   LNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 85

Query: 265  YKILAENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREE 444
            YKILAENGLIND  L+GV DIGD+MLKIPVREAT +EIL+VH+ EH++FLEST  M RE 
Sbjct: 86   YKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREV 145

Query: 445  LLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAG 624
            LL +TEKGDSVY NNDSY+SA+LSCGGAIEACKAVVEG+VKNALA+VRPPGHH+EP+++G
Sbjct: 146  LLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSG 205

Query: 625  GFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELG 804
            GFCLFSNV+VAAK+ILK YPESVRKI+I+DWDIHHGNGTQKAFY+D+ VLY+SLHRFE G
Sbjct: 206  GFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAG 265

Query: 805  KFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIV 984
            K+YPG  +G YD+ G+GKG+GFNCNITWP  GVGD EY+WAFEQIV+PM REF+PDLVI+
Sbjct: 266  KYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVII 325

Query: 985  SSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKI 1164
            SSGFDAA GD IGQCHVTP+CYG+MTHMLKSLARGNL VVLEGGYNLDSI+ SAL+VAK 
Sbjct: 326  SSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKT 385

Query: 1165 LIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEY-ENAIESQIPK 1341
            LIGEPPDE+P+  +DPKP  LEMI KVI++QSKYWKCF+R+ GN+   + E A ++   K
Sbjct: 386  LIGEPPDELPDPLKDPKPEALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVASDTLATK 445

Query: 1342 MFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVW 1521
             FPLQ AIR  Q  + + ++                  CS N   A+++ +++HDTP++W
Sbjct: 446  TFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIW 505

Query: 1522 GNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAF----EADNYSSNLLS 1689
              +DII+  +DP +SII DS+L F+ WA  R+  +ID+NIP+S        DNYSS + +
Sbjct: 506  LEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINA 565

Query: 1690 QDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKP 1869
            Q++++ LWDNH K++  + K+ FIG+G++ SG+VHLLG RDT+   KA INF+    LKP
Sbjct: 566  QEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKP 625

Query: 1870 IVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFE 2046
            +VP +DESL DWYFKNSLVF++  H CW + + KKPRKKYGRVLRCDTDG+++ IEERF+
Sbjct: 626  LVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKKPRKKYGRVLRCDTDGLNSTIEERFD 685

Query: 2047 EATDFILDAFDEWSDTE 2097
            EATDFILD+F+EWSD+E
Sbjct: 686  EATDFILDSFEEWSDSE 702

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
            similar to uniprot|P53973 Saccharomyces cerevisiae
            YNL021W HDA1 Putative catalytic subunit of a class II
            histone deacetylase complex that also contains Hda2p and
            Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
            form an active tetramer deletion increases histone H2B H3
            and H4 acetylation
          Length = 712

 Score =  966 bits (2496), Expect = 0.0
 Identities = 452/668 (67%), Positives = 543/668 (81%), Gaps = 4/668 (0%)
 Frame = +1

Query: 106  PVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAEN 285
            PVIVP   P +HYT LKTG+CYDVRMRYHAKI+TSYFEYIDPHPEDPRRIYRIYKILAEN
Sbjct: 45   PVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAEN 104

Query: 286  GLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEK 465
            GLI DP+L+GV +IG+LMLKIPVREAT EEIL VHT+EH+ FLE T KMTRE+LL +TE 
Sbjct: 105  GLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETET 164

Query: 466  GDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSN 645
            GDSVY NNDS +SA+LSCGGAIEACKAVVEGRVKNALA++RPPGHHAEP+ AGGFCLFSN
Sbjct: 165  GDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSN 224

Query: 646  VSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFP 825
            V+VAA++ILK YPESVR+I+I+DWDIHHGNGTQKAFY D+ VLY+SLHR+ELGK+YPG  
Sbjct: 225  VAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTV 284

Query: 826  EGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAA 1005
             GNY++ G+GKG+GFNCNI WP  G+GD EY+WAF+Q+V+PM REF+PDLVI+SSGFDAA
Sbjct: 285  HGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAA 344

Query: 1006 HGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPD 1185
             GDTIGQCHV+P+CYG+MTHMLKSLARGNLCVVLEGGYNLDSI+ SAL VAKILIGEPPD
Sbjct: 345  DGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPD 404

Query: 1186 EIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEY-ENAIESQIPKMFPLQDA 1362
            E+P   + PKP  +E I  VIR QSKYW CF+    N G  + E   ES I K FPLQ A
Sbjct: 405  ELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPLQQA 464

Query: 1363 IRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIIT 1542
            IR  QL    + FG                 CS N + A+++ V +HDTPE+W  R+ IT
Sbjct: 465  IRQEQLQQLSEKFGFVTLPLLNMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPIT 524

Query: 1543 GIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNH 1722
            G IDPSTSII D++L  I W+++R+ +VID+NIP+S FE DNYS+ + SQ+V++ +WDN+
Sbjct: 525  GTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNY 584

Query: 1723 FKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGD 1902
             KY  SL K+ FIG+G+A SGIVHLLG RDTR+V KAA++FV +  LK +VP +DESLG+
Sbjct: 585  LKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGN 644

Query: 1903 WYFKNSLVFTDHFHGCW---SENDKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDA 2073
            WYFKNSLVFT   H CW      +KKPRK++GRVL+CDT G++NI+EERF+EATDFILD+
Sbjct: 645  WYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDS 704

Query: 2074 FDEWSDTE 2097
            F+EWSD+E
Sbjct: 705  FEEWSDSE 712

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
            YNL021W
          Length = 693

 Score =  965 bits (2495), Expect = 0.0
 Identities = 447/670 (66%), Positives = 549/670 (81%), Gaps = 4/670 (0%)
 Frame = +1

Query: 100  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 279
            KR +IV    P L YTPLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 24   KRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 83

Query: 280  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 459
            ENGLI DP L+G+ DIGDLMLKIPVREAT +E+L+VH++EH++F+ES  KM+ +ELL  T
Sbjct: 84   ENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST 143

Query: 460  EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 639
            E GDSVY NNDS  SA+LSCGGAIEACKAVVEGRVKNA A+VRPPGHH+EP++AGGFCLF
Sbjct: 144  ETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLF 203

Query: 640  SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 819
            SNV+VA+K+IL+ YPESVR+I+I+DWDIHHGNGTQKAFY+DD VLYISLHRFELGK+YPG
Sbjct: 204  SNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 263

Query: 820  FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 999
              +G+YDK G+GKG+GFNCNITWPV GVGD EY+WAFEQ+V+PM+REFRPDLVI+S+GFD
Sbjct: 264  TAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFD 323

Query: 1000 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 1179
            AA GDTIGQCHV+P+CYG+MTHMLKSLA GNLCVVLEGGYNLD+I+ SAL+VAK+LIGEP
Sbjct: 324  AADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 383

Query: 1180 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYE-NAIESQIPKMFPLQ 1356
            P+E+ +  +DPKP  +E+INKVIR+QSKYWKCF+R+ GN G  +E +  ES     FPLQ
Sbjct: 384  PEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTDNFPLQ 443

Query: 1357 DAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDI 1536
             AIR  Q S    +FG                 CS   +   ++ +L+ DTPE+W  RD+
Sbjct: 444  SAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDV 503

Query: 1537 ITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWD 1716
            I G IDPS SII D++L FI WA+ER   VID+NIP+S FE DNYS+ + +Q+VM  +WD
Sbjct: 504  IQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWD 563

Query: 1717 NHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESL 1896
            N+ ++  S  K+ F+G+G+A SGIVHLLG RDTR+  K+ INF+   +LKP++P +DE+L
Sbjct: 564  NYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETL 623

Query: 1897 GDWYFKNSLVFTDHFHGCWSEND---KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFIL 2067
            GDWYFKNSLVF+D  H CW +N+   KKPRKK+GRVLRC++DG+ NIIEERFEEATDF+L
Sbjct: 624  GDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEATDFML 683

Query: 2068 DAFDEWSDTE 2097
            D+F+EWS+++
Sbjct: 684  DSFEEWSESD 693

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
            highly similar to uniprot|P53973 Saccharomyces cerevisiae
            YNL021W HDA1 Putative catalytic subunit of a class II
            histone deacetylase complex that also contains Hda2p and
            Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
            form an active tetramer deletion increases histone H2B H3
            and H4 acetylation
          Length = 708

 Score =  959 bits (2478), Expect = 0.0
 Identities = 458/702 (65%), Positives = 555/702 (79%), Gaps = 4/702 (0%)
 Frame = +1

Query: 4    SEQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRM 183
            SEQI   ++   ES   +   G++  V     KRP IVP  +P LHYTPLKTG+CYDVRM
Sbjct: 13   SEQINGLKR-DHESATLNDGTGNQASVA----KRPTIVPACRPKLHYTPLKTGLCYDVRM 67

Query: 184  RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREA 363
            RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DP+L+GV  IGDLMLKIPVREA
Sbjct: 68   RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVREA 127

Query: 364  TKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACK 543
            T EEIL VHT+EH++F+  T  MTR++LL +TEKGDSVY NNDSY+SA+LSCGGAIEACK
Sbjct: 128  TDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACK 187

Query: 544  AVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDI 723
            AVVEGRVKNALA+VRPPGHHAEP+ AGGFCLFSNV+VAA++ILK YPESVRKI+++DWD+
Sbjct: 188  AVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDV 247

Query: 724  HHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGV 903
            HHGNGTQKAFY+DD VLYISLHR ELGK+YPG   GN D+VG+GKG+GFNCNI WP KGV
Sbjct: 248  HHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGV 307

Query: 904  GDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLA 1083
            GD EY+WAFEQ+++PM REFRPDLVI+SSGFDAA GDT+GQCHVTP+CYG+MTHMLKSLA
Sbjct: 308  GDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLA 367

Query: 1084 RGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSK 1263
            RGNLC VLEGGY+LDSI+ SALAVAK+LIGEPPDE+P   + PK   +E+I+ VI+ QSK
Sbjct: 368  RGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVV-KQPKLEAVEVIDSVIKTQSK 426

Query: 1264 YWKCFRRKFGNFGGEY-ENAIESQIPKMFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXX 1440
            YWKCF+   GN G  + E A ++ I K FPLQ+AIR  Q+    ++F             
Sbjct: 427  YWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLFKKELP 486

Query: 1441 XXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERET 1620
                 CS N + A ++ V +HDTP +W  R   TG IDPSTSII D++L  I WA  R  
Sbjct: 487  DDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASSRNY 546

Query: 1621 AVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLL 1800
             VIDINIP+S  E DNYS+ + +Q+V++ +WDN+ KY  SL ++ F+ IG+A SG+VHLL
Sbjct: 547  GVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGVVHLL 606

Query: 1801 GKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEN---DKK 1971
            G RDTR+V K+A++FV    L+P++P +DE+L DWYFKNSLVF    H CW  +   +KK
Sbjct: 607  GHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGNENKK 666

Query: 1972 PRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 2097
            PRKK+GRVL+CD+DGI+NI+EERFEEATDFILD F+EWSD+E
Sbjct: 667  PRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
            (HDA1) - histone deacetylase, shares sequence similarity
            with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score =  950 bits (2456), Expect = 0.0
 Identities = 455/709 (64%), Positives = 556/709 (78%), Gaps = 10/709 (1%)
 Frame = +1

Query: 1    MSEQIGDKRK--LKDESEFP----SVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTG 162
            M+E +G K++  LK E+ F     +  + +E    +   KRPVIVP  +  LHYTPLKTG
Sbjct: 1    MTEAVGIKQEDSLKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTG 60

Query: 163  ICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLML 342
            +CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DP+L+GV DIGDLML
Sbjct: 61   LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLML 120

Query: 343  KIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
            KIP REAT EEIL VHT EH++FL  T  MTRE+LL +TEKGDSVY NNDSY+SA+LSCG
Sbjct: 121  KIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCG 180

Query: 523  GAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 702
            GAIEAC+AVVEGRVKNALA+VRPPGHHAEP  AGGFCLFSNV+VAA++ILK YPESV+KI
Sbjct: 181  GAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI 240

Query: 703  LIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNI 882
            +I+DWD+HHGNGTQKAFY DD VLY+SLHR ELGK+YPG   GN D+VG+GKG+GFNCNI
Sbjct: 241  MILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNI 300

Query: 883  TWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMT 1062
             WP KGVGD EYIWAFEQ+V+PM REF+PDLVI+SSGFDAA GDT+GQCHVTP+CYG+MT
Sbjct: 301  PWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT 360

Query: 1063 HMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINK 1242
            HMLKSLARGN+C VLEGGY+LDSI+ SAL VAK+LIGEPPDE+P   + PKP  +E+I+ 
Sbjct: 361  HMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVV-KQPKPEAVEVIDA 419

Query: 1243 VIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQDAIRNAQLSHYYDDFGMXXXX 1419
            VI++QS+YW+CF+    N G  ++  + E+ + + FPLQ AIR  Q+     ++      
Sbjct: 420  VIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLP 479

Query: 1420 XXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFIN 1599
                        CS N + ++S+ V +HDTPE+W  R   TG IDPSTSII D++L  I 
Sbjct: 480  LIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIK 539

Query: 1600 WAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEAT 1779
            WA +R   VIDINIP+S  E DNYS+ L +Q+V++ +WD++ KY  SL K+ F+ IG+A 
Sbjct: 540  WASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAY 599

Query: 1780 SGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSE 1959
            SG+VHLLG RDTR V KAAI+F+    L+P+VP +DESL DWYFKNSLVF    H CW  
Sbjct: 600  SGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGN 659

Query: 1960 N---DKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 2097
            +   +KKPRKK+GRVL+C++DG++NI+EERFEEATDFILD F+EWSD+E
Sbjct: 660  DGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
            (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score =  947 bits (2447), Expect = 0.0
 Identities = 435/655 (66%), Positives = 536/655 (81%), Gaps = 2/655 (0%)
 Frame = +1

Query: 133  NLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLT 312
            +L YTPLKTG+CYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP+L+
Sbjct: 4    SLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALS 63

Query: 313  GVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNND 492
            G+ DIGDLM KIPVREAT EEIL+VH +E +++LE T+ + R+ELLSKTE GDSVY NND
Sbjct: 64   GIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNND 123

Query: 493  SYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSIL 672
            SY SA+LSCGGAIEACKA+V+G+VKN+LAIVRPPGHH+EP+ AGGFCLFSNV+VA K+IL
Sbjct: 124  SYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNIL 183

Query: 673  KTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGD 852
            K YP+ V+K++IVDWDIHHGNGTQKAFY DD VLY+SLHRFELGK+YPG   G YD+VG+
Sbjct: 184  KNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGE 243

Query: 853  GKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCH 1032
            GKG+GFNCNI W V G+GD EYIWAFEQIV+PM REFRPDLVIVSSGFDAA GDTIG+CH
Sbjct: 244  GKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCH 303

Query: 1033 VTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDP 1212
            VTP+CYG+MTHMLKSLA G LCVVLEGGYNLD+I+ SALAVAK+LIGEPPDE+P  D+DP
Sbjct: 304  VTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDP 363

Query: 1213 KPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQDAIRNAQLSHY 1389
            KP  +EMI++VI ++SKYWKCF+R+  N   EY+  I ES   K FP+QDAIR  Q+ + 
Sbjct: 364  KPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYL 423

Query: 1390 YDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSI 1569
             +D+ M                CS++  ++    + +HDTPE+W  RD I G+ID S S+
Sbjct: 424  TNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASL 483

Query: 1570 IFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEK 1749
              D+SL+F +WA++R   +ID+NIP++ +E DNYS++L +Q+V+I LWDN+ KY  ++ K
Sbjct: 484  YMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNK 543

Query: 1750 LCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVF 1929
            + +IG+GEA SG+VHLLG RDTR+V K+ I FVG   LK +VP ++ESL DWYFK SL+F
Sbjct: 544  IAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLF 603

Query: 1930 TDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSD 2091
             D  H CW END KKPRK+YGRVLRCD+DGI ++IEERFEEATDFI+D+ DEW++
Sbjct: 604  ADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
            similar to Ashbya gossypii ADL216C
          Length = 706

 Score =  943 bits (2437), Expect = 0.0
 Identities = 443/709 (62%), Positives = 553/709 (77%), Gaps = 10/709 (1%)
 Frame = +1

Query: 1    MSEQIGDKRKLKDESEFPSVSIGDEG------KVIQVLPKRPVIVPTQKPNLHYTPLKTG 162
            M+++   KRKL+ +    + +IG E       K+     KRP+IVP  KP +HY PLKTG
Sbjct: 1    MNQESKQKRKLEIDG---NDTIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTG 57

Query: 163  ICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLML 342
            +CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DP+L+GV DIG+LML
Sbjct: 58   LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLML 117

Query: 343  KIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
            KIP+REAT++EIL VH++EH++FL++T  M+RE+LL +TE GDSVY NNDS +SA+LSCG
Sbjct: 118  KIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCG 177

Query: 523  GAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 702
            GAIEACKAVVEGRVKNALA+VRPPGHHAEP+ AGGFCLFSNV+VAA++ILK YPESVRK+
Sbjct: 178  GAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKV 237

Query: 703  LIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNI 882
            +I+DWDIHHGNGTQ+AFY D+ VLY+SLHR+ELG++YPG   GNY++ G+GKG+GFNCNI
Sbjct: 238  MILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNI 297

Query: 883  TWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMT 1062
             W   GVGD EY+WAFEQIVIPM REF+PDLVI+SSGFDAA GDTIGQCHV+P CYG+MT
Sbjct: 298  PWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMT 357

Query: 1063 HMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINK 1242
            HMLKSLA+GN+CVVLEGGYNLDSI+ SAL V K+LIGEPPDE+P+  + PKP  +  I  
Sbjct: 358  HMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIET 417

Query: 1243 VIRVQSKYWKCFRRKFGNFGGEYENAIESQIP-KMFPLQDAIRNAQLSHYYDDFGMXXXX 1419
            VIR Q+KYW CF+ K GN G  ++  ++  +  K FPLQ A+R  Q      ++      
Sbjct: 418  VIREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLP 477

Query: 1420 XXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFIN 1599
                        CS N  +  +L + +HDTPEVW  R+ +TG IDPSTSII D++L   N
Sbjct: 478  LLDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITN 537

Query: 1600 WAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEAT 1779
            WA+ R   +IDINIP+S FE DNYS+ L SQ+V+  LWD++ K+   L ++ F+GIG+A 
Sbjct: 538  WALGRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAY 597

Query: 1780 SGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCW-- 1953
            SG VHLLG RDTR++ K AI+F     L+P+VP +DES+ DWYFKNSL+FT  +H CW  
Sbjct: 598  SGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGT 657

Query: 1954 -SENDKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 2097
               + KKPRKK+GRVL+C++DG++NI+EERFEEATDFILD+F+EWSD+E
Sbjct: 658  EGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
            similar to uniprot|P53973 Saccharomyces cerevisiae
            YNL021W HDA1 Putative catalytic subunit of a class II
            histone deacetylase complex that also contains Hda2p and
            Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
            form an active tetramer deletion increases histone H2B H3
            and H4 acetylation
          Length = 704

 Score =  938 bits (2424), Expect = 0.0
 Identities = 444/701 (63%), Positives = 547/701 (78%), Gaps = 9/701 (1%)
 Frame = +1

Query: 22   KRKLKDESEFPSVS-IGDEGKVIQVLPK----RPVIVPTQKPNLHYTPLKTGICYDVRMR 186
            K+  ++  E PS+  I +EG    +  K    RPVIVP  KP + Y+ LKTGICYDVRMR
Sbjct: 4    KKPAEEPLERPSIKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMR 63

Query: 187  YHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREAT 366
            YHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DP+L+G   IGDLM+K+PVREA 
Sbjct: 64   YHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVREAE 123

Query: 367  KEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKA 546
            +EEIL VH+ +H+ F+  TE++ RE LL +TE GDSVY NNDSY+SA+LSCGGAIEACKA
Sbjct: 124  EEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKA 183

Query: 547  VVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIH 726
            VVEGRVKN++A+VRPPGHHAEP+ AGGFCLFSNV+VAA ++LK+YPESVRKI+IVDWDIH
Sbjct: 184  VVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIH 243

Query: 727  HGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVG 906
            HGNGTQKAFY+DD VLY+SLHR++LGK+YPG   GNYD+ G+GKG+GFNCNITWP  GVG
Sbjct: 244  HGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVG 303

Query: 907  DVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLAR 1086
            D EY+WAFEQ+++PM REF PDLV++SSGFDAA GDTIGQCHVTP CYG+MTHML SLA+
Sbjct: 304  DAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAK 363

Query: 1087 GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKY 1266
            GNLCVVLEGGYNLDSI+ SAL V K+L+GEPPDE+P   + P P   +MI  VIR QSKY
Sbjct: 364  GNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKY 423

Query: 1267 WKCFRRKFGNFGGEYENAIESQI-PKMFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXXX 1443
            W CF+ + GN G  +++AI S +  + FPLQ+AIR  Q+S     F              
Sbjct: 424  WSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQLPILDLNLPA 483

Query: 1444 XXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETA 1623
                C+S    +++L V++HDTPE+W  RD  TGIIDPS+SII D++LK INWA++R   
Sbjct: 484  NTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDRRYG 543

Query: 1624 VIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLG 1803
            +IDINIP++ FE  NY     SQ+++I LWDN+ K+ ++L+K+ FIGIG+A  GIVHLLG
Sbjct: 544  IIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLG 603

Query: 1804 KRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCW---SENDKKP 1974
             RDTR+V K AI+F+    LK +VP +DE+LGDWYFKNSLVFT   H CW   +  +KK 
Sbjct: 604  HRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANENKKL 663

Query: 1975 RKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 2097
            RKKYGRVL+ D DG+ NI +ERFEEATDFILD+F+EWS++E
Sbjct: 664  RKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YNL021W
            (HDA1)
          Length = 705

 Score =  917 bits (2371), Expect = 0.0
 Identities = 444/706 (62%), Positives = 542/706 (76%), Gaps = 7/706 (0%)
 Frame = +1

Query: 1    MSEQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVR 180
            M E+   KRKL++ S     + G   +   ++ KRPVIVP  +P + Y PLKTG+CYDVR
Sbjct: 1    MEERTQQKRKLEEGSPDGEANGGQASRKA-IVQKRPVIVPPVRPKISYVPLKTGLCYDVR 59

Query: 181  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVRE 360
            MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DP+L+G+ +IG+LM KIPVRE
Sbjct: 60   MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVRE 119

Query: 361  ATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEAC 540
            AT+EEIL VH++EH++FL++T  M RE+LL +TE GDSVY NNDS ISARLSCGGAIEAC
Sbjct: 120  ATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEAC 179

Query: 541  KAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWD 720
            KAVVEGRVKNA+A+VRPPGHHAEP  AGGFCLFSNV+VAA++ILK YPESVR+++I+DWD
Sbjct: 180  KAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWD 239

Query: 721  IHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKG 900
            IHHGNGTQKAFY D+ VLY+SLHR+ELGK+YPG   GNYD+ GDGKG+GFNCNI W   G
Sbjct: 240  IHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSG 299

Query: 901  VGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSL 1080
            VGD EY+WAFEQ+VIPM REF+PDLVI+SSGFDAA GDTIGQCHV+P CYG++THMLKSL
Sbjct: 300  VGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSL 359

Query: 1081 ARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINK-VIRVQ 1257
            ARGN+CVVLEGGYNLDSI+ SAL VAK+LIGEPPDE+P+  + PKP  +  I+  +++ Q
Sbjct: 360  ARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQ 419

Query: 1258 SKYWKCFRRKFGNFGGEY-ENAI-ESQIPKMFPLQDAIR-NAQLSHYYDDFGMXXXXXXX 1428
            SKYW CF+ + GN G  + E A+ +S   K FPLQ       Q      ++         
Sbjct: 420  SKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLN 479

Query: 1429 XXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAI 1608
                     CS N     ++ + +HDTPE+W  RD +TG IDPSTSII D+++  INWA+
Sbjct: 480  MELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWAL 539

Query: 1609 ERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGI 1788
             R   VIDINIP+S FE DNYS+ L SQ+V+  LWD++ K    L ++ F+GIG+A SG 
Sbjct: 540  GRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGF 599

Query: 1789 VHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCW---SE 1959
            VHLLG RDTR+V K AI F     L+P+VP +DESLGDWYFKNSLVFT  +H CW     
Sbjct: 600  VHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGN 659

Query: 1960 NDKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 2097
            + KKPRKK+GRVLR   DG++NI+EER EEATDFILD+F+EWS++E
Sbjct: 660  DSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] {ON}
            Anc_2.285 YNL021W
          Length = 795

 Score =  708 bits (1828), Expect = 0.0
 Identities = 326/434 (75%), Positives = 385/434 (88%), Gaps = 1/434 (0%)
 Frame = +1

Query: 100  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 279
            K+ +IVP Q P +HY PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 40   KKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99

Query: 280  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 459
            ENGLINDP+L+GV +IGDLMLK+P+REAT  EIL+VH+ EH ++LE T    RE+LL +T
Sbjct: 100  ENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET 159

Query: 460  EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 639
            E GDSVY NNDS+ SA+LSCGGAIEACKAVVEGRVKNA+A+VRPPGHH+EP++AGGFCLF
Sbjct: 160  ENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLF 219

Query: 640  SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 819
            SNV+VA K+ILK YPESVRK+LI+DWDIHHGNGTQKAFY DDNVLYISLHRFELGK+YPG
Sbjct: 220  SNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPG 279

Query: 820  FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 999
              +G YD+ G+GKG+GFNCNITWP+  VGD EY+WAFEQ+V+PM+REF+PDLVI+SSGFD
Sbjct: 280  TIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFD 339

Query: 1000 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 1179
            AA GDTIGQCHV+P+CYG+MTHMLKSLARGNLCVVLEGGYNLD+I+ SAL+V+KILIGEP
Sbjct: 340  AADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGEP 399

Query: 1180 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQ 1356
            PDE+P+  +DPKP V+EMI+K+IR+QSKYWKCFRR+ GN G  ++ +I +S I K FPLQ
Sbjct: 400  PDELPDPLKDPKPEVIEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQ 459

Query: 1357 DAIRNAQLSHYYDD 1398
             AIRN Q    +D+
Sbjct: 460  TAIRNFQSKKLFDE 473

 Score =  276 bits (707), Expect = 2e-81
 Identities = 127/215 (59%), Positives = 168/215 (78%), Gaps = 1/215 (0%)
 Frame = +1

Query: 1456 CSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDI 1635
            CS    ++K+L VL+HD+P++W  RD+ TG++D S++II DS+L FI W+++R   VIDI
Sbjct: 581  CSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDRNYGVIDI 640

Query: 1636 NIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDT 1815
            NIP++ FE DNYSS L +Q+ ++S WDN+ KY   +EK+ FIG G+A +GIVHLLG RDT
Sbjct: 641  NIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVHLLGHRDT 700

Query: 1816 RTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGR 1992
            R+V K+ INF+G   LK +VP +DE+L DWYFKNSLVFTD  H  W++N+ KKPRKK+GR
Sbjct: 701  RSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKKPRKKFGR 760

Query: 1993 VLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 2097
            VLR   DGI N+IEERF+EATDFILD+F+EWSD E
Sbjct: 761  VLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  513 bits (1321), Expect = e-175
 Identities = 239/300 (79%), Positives = 269/300 (89%)
 Frame = +1

Query: 94  LPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI 273
           +PKR VIVP ++P LHYTPLKTG+CYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKI
Sbjct: 50  MPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKI 109

Query: 274 LAENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLS 453
           LAENGLI D +L+G+ DIGD+MLKIPVR AT+EEIL VHT EH+ F+E+ E  +REEL+ 
Sbjct: 110 LAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIK 169

Query: 454 KTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFC 633
            TEK DSVY NNDSY SA+LSCGG IEAC+AVVEGRVKN+LAIVRPPGHHAEPQAAGGFC
Sbjct: 170 LTEKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFC 229

Query: 634 LFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFY 813
           LFSNVSVAA+SIL+TYPESVRKILI+DWDIHHGNGTQKAFYED+NVLYISLHR+E   FY
Sbjct: 230 LFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFY 289

Query: 814 PGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSG 993
           PG   G YD+VG+GKG+GFNCNITWPV GVGD EY+WAFE +V+P+ REFRPDLVIVSSG
Sbjct: 290 PGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  287 bits (734), Expect = 2e-87
 Identities = 127/216 (58%), Positives = 175/216 (81%), Gaps = 1/216 (0%)
 Frame = +1

Query: 1459 SSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDIN 1638
            S   FKA++L +L+HDTPE+WG+RDIITG++DPSTS++ D+S+KFI WA +R  +++DIN
Sbjct: 363  SQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSILDIN 422

Query: 1639 IPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTR 1818
            IP+S  E + +SS+  + ++M+SLWDNH +YI +L K+CFIGIGE+  GIVHL+G+RD R
Sbjct: 423  IPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGERDLR 482

Query: 1819 TVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEN-DKKPRKKYGRV 1995
             ++KA INFVG+  LK +  + DE++ DWYFKNSLVFT+  H CW E+ +K+PRKK+GRV
Sbjct: 483  VLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPRKKFGRV 542

Query: 1996 LRCDTDGIHNIIEERFEEATDFILDAFDEWSDTEDE 2103
            L+ D+DGI +II ERF+EATDFILDAF+EWSD E +
Sbjct: 543  LKSDSDGIISIINERFDEATDFILDAFEEWSDEESD 578

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13120)
            [1362 nt, 454 aa]
          Length = 453

 Score =  146 bits (368), Expect = 5e-37
 Identities = 105/362 (29%), Positives = 185/362 (51%), Gaps = 14/362 (3%)
 Frame = +1

Query: 160  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 339
            G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + D+ +  
Sbjct: 25   GSAYCPRVSYHFNPKVSNYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 76

Query: 340  LKIPVREATKEEILDVHTEEHMQFLESTEKMTREEL-------LSKTEKGDSVYLNNDSY 498
                 R ATK+E+LD H+++++ FL+   K+T E L       L K   GD   +  + Y
Sbjct: 77   ----TRSATKDELLDFHSDDYVSFLQ---KVTPENLSKMPRGTLEKYNIGDDCPIFQNLY 129

Query: 499  ISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILK 675
              + L  G +++A + ++  +  + +AI    G HHA+     GFC  +++ +A  ++L+
Sbjct: 130  DYSALYAGASLDASRKLINNQ--SDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLR 187

Query: 676  TYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDG 855
             +P    ++L +D D+HHG+G Q+AFY  D V  IS H++  G+F+PG   GNYD++G  
Sbjct: 188  YHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPG--TGNYDEIGCA 240

Query: 856  KGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCH 1032
            +GK F  N+  P++ G+ D  YI  F+ I+ P+   ++P ++I   G D+   D +G  +
Sbjct: 241  QGKHFAMNV--PLEDGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFN 298

Query: 1033 VTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKILIGEPPDEIPE 1197
            +    +G     ++S     L VV  GGY   ++S      + +    +L  E P++IP 
Sbjct: 299  LNIKAHGECVKFIRSFGIPML-VVGGGGYTPRNVSRLWTYETGVLNNVLLPAELPEDIPF 357

Query: 1198 SD 1203
             D
Sbjct: 358  RD 359

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
            similar to uniprot|P53096 Saccharomyces cerevisiae
            YGL194C HOS2 Histone deacetylase required for gene
            activation via specific deacetylation of lysines in H3
            and H4 histone tails subunit of the Set3 complex a
            meiotic-specific repressor of sporulation specific genes
            that contains deacetylase activity
          Length = 448

 Score =  144 bits (364), Expect = 2e-36
 Identities = 101/364 (27%), Positives = 181/364 (49%), Gaps = 10/364 (2%)
 Frame = +1

Query: 142  YTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVS 321
            Y P + G  Y   + YH     S + Y   HP  P      ++++  + L++   L  + 
Sbjct: 14   YLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKP------FRLMLTDHLVSSYGLHKIM 67

Query: 322  DIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREEL----LSKTEKGDSVYLNN 489
            D+ +       REAT++E+L+ H+ ++++FL      T  ++    L K   GD   +  
Sbjct: 68   DLYE------TREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGDDCPIFQ 121

Query: 490  DSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKS 666
              +  + L  G +++A + ++ G+  + +AI    G HHA+     GFC  +++ +A  +
Sbjct: 122  GIFEYSSLYAGASLDASRKLIAGQ--SEIAINWSGGLHHAKKAKPSGFCYVNDIVLAILN 179

Query: 667  ILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKV 846
            +L+ +P    ++L VD D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G++D++
Sbjct: 180  LLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPG--TGDFDEI 232

Query: 847  GDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQ 1026
            G  +GK F  N+     G+ D  YI  F+ I+ P+   ++P ++I   G D+   D +G 
Sbjct: 233  GCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRLGC 291

Query: 1027 CHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKILIGEPPDEI 1191
             ++    +G     +KS     L VV  GGY   ++S      + L    +L  E P+ I
Sbjct: 292  FNLNIRAHGECVKFVKSFGIPML-VVGGGGYTPRNVSRLWTYETGLLNDVLLPQEIPENI 350

Query: 1192 PESD 1203
            P  D
Sbjct: 351  PFRD 354

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
            similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  145 bits (365), Expect = 2e-36
 Identities = 104/371 (28%), Positives = 187/371 (50%), Gaps = 12/371 (3%)
 Frame = +1

Query: 127  KPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPS 306
            K +    P + G  Y  ++ YH     S + Y   HP  P      ++++  + L++   
Sbjct: 46   KTSQQQLPFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKP------FRLMLTDHLVSCYG 99

Query: 307  LTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGD 471
            L  + D+ +       REATKEE+L+ H  ++++FL     E+  K+ R  L  K   GD
Sbjct: 100  LHKIMDLYE------TREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSL-EKFNIGD 152

Query: 472  SVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNV 648
               +    +  + L  G +++A + ++  +  + +AI    G HHA+     GFC  +++
Sbjct: 153  DCPIFQGMFDYSILYAGASLDAARKLINNQ--SEIAINWSGGLHHAKKSNPSGFCYVNDI 210

Query: 649  SVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPE 828
             +A  S+L+ +P    ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   
Sbjct: 211  VLAIISLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPG--T 263

Query: 829  GNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAA 1005
            G+ D++G  KGK F+ N+  P++ G+ D  YI  F+ I+ P+   ++P ++I   G D+ 
Sbjct: 264  GDLDEIGCSKGKKFSLNV--PLQDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSL 321

Query: 1006 HGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKILI 1170
              D +G  ++    +G     +KS     LCV   GGY   ++S      + +    +L 
Sbjct: 322  GHDRLGCFNLNIKAHGECVKFVKSFGIPILCVG-GGGYTPRNVSRLWAYETGVLNDVLLP 380

Query: 1171 GEPPDEIPESD 1203
             + P +IP +D
Sbjct: 381  SDIPKDIPFTD 391

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
            Anc_8.153 YGL194C
          Length = 450

 Score =  144 bits (363), Expect = 2e-36
 Identities = 101/357 (28%), Positives = 180/357 (50%), Gaps = 12/357 (3%)
 Frame = +1

Query: 160  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 339
            G  Y  R+ YH     S + Y   HP  P      ++ +  + L++   L  + D+ +  
Sbjct: 22   GSTYSPRVSYHYNPKVSNYHYGVKHPMKP------FRFMLTDHLVSSYGLHNIMDLYE-- 73

Query: 340  LKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYIS 504
                 REATKEE+L  H+E++++FL     ++  KM R     K   GD   +  + Y  
Sbjct: 74   ----TREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTF-DKYNIGDDCPIFQNIYEY 128

Query: 505  ARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTY 681
             +L  G +++A + ++  +  + +AI    G HHA+     GFC  +++ +A  ++L+ +
Sbjct: 129  CKLYAGASLDASRKLINDQ--SDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRYH 186

Query: 682  PESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG 861
            P    ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   GNYD++G  +G
Sbjct: 187  P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPG--TGNYDEIGCAEG 239

Query: 862  KGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVT 1038
            K F  N+  P+  G+ D  YI  F+ ++ P+   F+P  +I   G D+   D +G  ++ 
Sbjct: 240  KHFAMNV--PLNDGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFNLN 297

Query: 1039 PNCYGYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKILIGEPPDEIP 1194
               +G     ++S     + VV  GGY   ++S      + +    +L  E P+++P
Sbjct: 298  IKAHGECVKFIRSFGI-PMVVVGGGGYTPRNVSRLYAYETGILNNVLLQSELPEDMP 353

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] {ON}
            Anc_8.153
          Length = 451

 Score =  144 bits (362), Expect = 3e-36
 Identities = 107/372 (28%), Positives = 189/372 (50%), Gaps = 12/372 (3%)
 Frame = +1

Query: 124  QKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDP 303
            ++P   Y   + G  Y  R+ YH     S + Y   HP  P      ++++  + L++  
Sbjct: 14   EQPQFEY---EFGSSYTPRVSYHFNPKVSNYHYGVRHPMKP------FRLMLTDHLVSSY 64

Query: 304  SLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKG 468
             L  + D+ +       REAT+EE+   H++++++FL     E+  KM R  L  K   G
Sbjct: 65   GLHKIMDLYE------TREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTL-EKFNIG 117

Query: 469  DSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSN 645
            D   +  + Y  + L  G +++A + ++  +  + +AI    G HHA+     GFC  ++
Sbjct: 118  DDCPIFQNIYDYSTLYTGASLDASRKLINDQ--SDIAINWSGGLHHAKKNNPSGFCYVND 175

Query: 646  VSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFP 825
            + ++  ++L+ +P    ++L +D D+HHG+G Q+AFY  D V  IS H+F  G+F+PG  
Sbjct: 176  IVLSILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPG-- 228

Query: 826  EGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDA 1002
             G++D++G  KGK F  N+  P++ G+ D  YI  F+ I+ P+   ++P ++I   G D+
Sbjct: 229  TGDFDEIGCAKGKHFAMNV--PLEDGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADS 286

Query: 1003 AHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKIL 1167
               D +G  ++    +G     +KS     L VV  GGY   ++S      + +    +L
Sbjct: 287  LGHDRLGCFNLNIKAHGECVKFVKSFGIPML-VVGGGGYTPRNVSRLWTYETGVLNNVLL 345

Query: 1168 IGEPPDEIPESD 1203
              E P+EIP  D
Sbjct: 346  PSEIPEEIPFRD 357

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
            highly similar to uniprot|P53096 Saccharomyces cerevisiae
            YGL194C HOS2 Histone deacetylase required for gene
            activation via specific deacetylation of lysines in H3
            and H4 histone tails subunit of the Set3 complex a
            meiotic-specific repressor of sporulation specific genes
            that contains deacetylase activity
          Length = 449

 Score =  143 bits (361), Expect = 4e-36
 Identities = 100/353 (28%), Positives = 176/353 (49%), Gaps = 7/353 (1%)
 Frame = +1

Query: 160  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 339
            G  Y+  + YH     S F Y   HP  P      ++++  + L++   L  + D+ +  
Sbjct: 21   GAPYEPNVSYHFNSDVSQFHYGVRHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 72

Query: 340  LKIPVREATKEEILDVHTEEHMQFLESTEKMTREEL----LSKTEKGDSVYLNNDSYISA 507
                 R AT+EE+ + H +++++FL         +L    L K   GD   +    Y  +
Sbjct: 73   ----TRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQYS 128

Query: 508  RLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYP 684
             L  G +++A + ++ G+  + +AI    G HHA+  +  GFC  +++ ++  ++L+ +P
Sbjct: 129  TLYAGASLDATRKLINGQ--SEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRYHP 186

Query: 685  ESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGK 864
                ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   GN D+ G  +GK
Sbjct: 187  ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPG--TGNLDETGCSRGK 239

Query: 865  GFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTP 1041
             F  N+  P++ G+ D  YI  F+ I+ P+   F+P ++I   G D+   D +G  ++  
Sbjct: 240  HFALNV--PLEDGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNV 297

Query: 1042 NCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIG-EPPDEIPE 1197
              +G     +KS     L V+  GGY   ++S        +L G   P EIPE
Sbjct: 298  KAHGECVRFVKSFGIPML-VLGGGGYTPRNVSRLWTYETALLNGVSVPQEIPE 349

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGL194C
            (HOS2)
          Length = 449

 Score =  142 bits (358), Expect = 1e-35
 Identities = 101/357 (28%), Positives = 180/357 (50%), Gaps = 12/357 (3%)
 Frame = +1

Query: 160  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 339
            G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  V D+ +  
Sbjct: 21   GASYTPRVSYHYNSRVSQYHYGVRHPMKP------FRLMLTDHLVSRYGLHKVMDLYE-- 72

Query: 340  LKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYIS 504
                 R ATKEE+L  H ++++ FL     E+  K+ R  L  K   GD   +    +  
Sbjct: 73   ----TRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSL-EKFNIGDDCPIFQGLFEY 127

Query: 505  ARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTY 681
            + L  G +++A + ++ G+  + +AI    G HHA+     GFC  +++ +A  ++L+ +
Sbjct: 128  SMLYAGASLDASRKLINGQ--SEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYH 185

Query: 682  PESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG 861
            P    ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G+ D++G  +G
Sbjct: 186  P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPG--TGDLDEIGCSRG 238

Query: 862  KGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVT 1038
            K F+ N+  P+  G+ D  YI  F+ I+ P+   ++P ++I   G D+   D +G  ++ 
Sbjct: 239  KHFSLNV--PLNDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLN 296

Query: 1039 PNCYGYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKILIGEPPDEIP 1194
               +G     +KS     LCV   GGY   ++S      + +    +L  + P++IP
Sbjct: 297  IRAHGECVKFVKSFGIPMLCVG-GGGYTPRNVSRLWTYETGILNDVLLPSDIPEDIP 352

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
            YGL194C (HOS2) - (putative) histone deacetylase [contig
            139] FULL
          Length = 449

 Score =  142 bits (357), Expect = 1e-35
 Identities = 101/353 (28%), Positives = 177/353 (50%), Gaps = 7/353 (1%)
 Frame = +1

Query: 160  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 339
            G  +   + YH     S F Y   HP  P      ++++  + L++   L  + D+ +  
Sbjct: 21   GASHQPAVSYHFNDDVSQFHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 72

Query: 340  LKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYIS 504
                 R AT+EE+ + H+E++++FL     ++  K+ R  L  K   GD   +    Y  
Sbjct: 73   ----TRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSL-EKFNIGDDCPIFQGLYQY 127

Query: 505  ARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTY 681
            + L  G +++A + ++ G+  + +AI    G HHA+     GFC  +++ ++  ++L+ +
Sbjct: 128  STLYAGASLDATRKLINGQ--SEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYH 185

Query: 682  PESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG 861
            P    ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   GN D++G  +G
Sbjct: 186  P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPG--TGNLDEIGCSRG 238

Query: 862  KGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTP 1041
            K F  N+     G+ D  YI  F+ I+ P+   F+P ++I   G D+   D +G  ++  
Sbjct: 239  KHFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNV 297

Query: 1042 NCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGE-PPDEIPE 1197
              +G     +KS     L VV  GGY   ++S        +L G   P+EIPE
Sbjct: 298  KAHGECVKYVKSFGLPML-VVGGGGYTPRNVSRLWAYETGLLNGVLLPEEIPE 349

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
            Anc_8.153 YGL194C
          Length = 446

 Score =  141 bits (356), Expect = 2e-35
 Identities = 106/357 (29%), Positives = 181/357 (50%), Gaps = 12/357 (3%)
 Frame = +1

Query: 160  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 339
            G  Y  R+ YH     S + Y   HP  P      +++L  + L++   L  + D+ +  
Sbjct: 21   GSAYCPRVSYHFNPKVSNYHYGVRHPMKP------FRLLLTDHLVSSYGLHKIMDLYE-- 72

Query: 340  LKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYIS 504
                 R AT EEI + HT++++ FL     E+  KM R  L  K   GD   +  + +  
Sbjct: 73   ----TRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTL-EKFNIGDDCPIFQNLFNY 127

Query: 505  ARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTY 681
             +L  G +++A + ++  +  + +AI    G HHA+     GFC  +++ +A  ++L+ +
Sbjct: 128  CKLYAGASLDAARKLINDQ--SDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYH 185

Query: 682  PESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG 861
            P    ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   GN+D+VG   G
Sbjct: 186  P----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPG--TGNHDEVGCANG 238

Query: 862  KGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVT 1038
            K F  N+  P++ G+ D  YI  F+ I+ P+   ++P ++I   G D+   D IG  ++T
Sbjct: 239  KHFAMNV--PLEDGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGCFNLT 296

Query: 1039 PNCYGYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKILIGEPPDEIP 1194
               +G     ++S     L VV  GGY   ++S      + +    +L  E P+EIP
Sbjct: 297  IKGHGECVKFIRSFGIPML-VVGGGGYTPRNVSRLWAYETGVLNNVLLSKELPEEIP 352

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
            similar to uniprot|P53096 Saccharomyces cerevisiae
            YGL194C HOS2 Histone deacetylase required for gene
            activation via specific deacetylation of lysines in H3
            and H4 histone tails subunit of the Set3 complex a
            meiotic-specific repressor of sporulation specific genes
            that contains deacetylase activity
          Length = 452

 Score =  141 bits (356), Expect = 2e-35
 Identities = 104/359 (28%), Positives = 178/359 (49%), Gaps = 11/359 (3%)
 Frame = +1

Query: 160  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 339
            G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  V D+ +  
Sbjct: 24   GTSYSPRVSYHFNSKVSQYHYGVKHPMKP------FRLMLTDHLVSAYGLHKVMDLYE-- 75

Query: 340  LKIPVREATKEEILDVHTEEHMQFLESTEKMTREEL----LSKTEKGDSVYLNNDSYISA 507
                 R ATK+E+   H+E+++ FL      T  +L    L K   GD   +    +  A
Sbjct: 76   ----TRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQGMFDYA 131

Query: 508  RLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYP 684
             L  G +++A + ++ G+  + +AI    G HHA+     GFC  +++ +A  ++L+ +P
Sbjct: 132  ALYAGASLDASRKLLNGQ--SEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYHP 189

Query: 685  ESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGK 864
                ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G+ D++G  +GK
Sbjct: 190  ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPG--TGDLDEIGCSRGK 242

Query: 865  GFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTP 1041
             F  N+  P++ G+ D  YI  F+ I+ P+   FRP ++I   G D+   D +G  ++  
Sbjct: 243  HFALNV--PLQDGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNI 300

Query: 1042 NCYGYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKILIGEPPDEIPESD 1203
              +G     +KS     L VV  GGY   ++S      + L    +L  + P+ IP  D
Sbjct: 301  KAHGECVRFVKSFGVPML-VVGGGGYTPRNVSRLWTYETGLLNGVLLQPKLPEGIPFRD 358

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
            Anc_8.153 YGL194C
          Length = 453

 Score =  141 bits (355), Expect = 3e-35
 Identities = 101/356 (28%), Positives = 177/356 (49%), Gaps = 11/356 (3%)
 Frame = +1

Query: 160  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 339
            G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + D+ +  
Sbjct: 23   GSSYTPRVSYHFNPKVSNYHYGVNHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 74

Query: 340  LKIPVREATKEEILDVHTEEHMQFLESTEKMTREEL----LSKTEKGDSVYLNNDSYISA 507
                 REATKEE+   H+ +++ FLE     T  ++    L K   G    +  + Y  +
Sbjct: 75   ----TREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFENIYDYS 130

Query: 508  RLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYP 684
             L  G +++A + ++ G+  + +AI    G HHA+     GFC  +++ ++  ++L+ +P
Sbjct: 131  TLYTGASLDASRKLINGQ--SEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYHP 188

Query: 685  ESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGK 864
                ++L +D D+HHG+G Q+AFY  D V  IS H++  G+F+PG   GNYD++G   GK
Sbjct: 189  ----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPG--TGNYDEIGCSGGK 241

Query: 865  GFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTP 1041
             F  N+  P+  G+ D  YI  F+ I+ P+   ++P ++I   G D+   D +G  ++  
Sbjct: 242  HFAMNV--PLNDGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 1042 NCYGYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKILIGEPPDEIP 1194
              +G     + S     L VV  GGY   ++S      + +    +L  E P+E+P
Sbjct: 300  KAHGECVKFVSSFGIPML-VVGGGGYTPRNVSRLWAYETGILNNVLLPKELPEELP 354

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
            Anc_8.153 YGL194C
          Length = 456

 Score =  140 bits (352), Expect = 7e-35
 Identities = 103/368 (27%), Positives = 187/368 (50%), Gaps = 12/368 (3%)
 Frame = +1

Query: 127  KPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPS 306
            +P  +Y   + G  Y  R+ YH     S + +   HP  P      ++++  + L++   
Sbjct: 15   QPQFNY---EFGSTYAPRVSYHFNPKVSSYHFGVRHPMKP------FRLMLTDHLVSGYG 65

Query: 307  LTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGD 471
            L  + D+ +       R+A+ +E+L+ HT++++ FL     ++  KM R  L  K   GD
Sbjct: 66   LHKIMDLYE------TRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTL-DKFNIGD 118

Query: 472  SVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNV 648
               + ++ Y  + L  G +++A + ++ G+  + +AI    G HHA+  +  GFC  +++
Sbjct: 119  DCPIFHNLYEYSSLYTGASLDASRKLLNGQ--SDIAINWSGGLHHAKKTSPSGFCYINDI 176

Query: 649  SVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPE 828
             ++  ++L+ +P    ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   
Sbjct: 177  VLSILNLLRFHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPG--T 229

Query: 829  GNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAA 1005
            GNYD+ G   GK F  N+  P+K G+ D  YI  F+ I+ P+   + P ++I   G D+ 
Sbjct: 230  GNYDETGCSNGKHFALNV--PLKDGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSL 287

Query: 1006 HGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKILI 1170
              D +G  ++    +G     +KS     L VV  GGY   ++S      + +    +L 
Sbjct: 288  GHDRLGCFNLNIKAHGECVKFVKSFGIPML-VVGGGGYTPKNVSRLWTYETGILNNVLLS 346

Query: 1171 GEPPDEIP 1194
             E P +IP
Sbjct: 347  PELPSDIP 354

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  138 bits (347), Expect = 3e-34
 Identities = 103/357 (28%), Positives = 179/357 (50%), Gaps = 12/357 (3%)
 Frame = +1

Query: 169  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKI 348
            Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + D+ +     
Sbjct: 28   YTPRVSYHFNPKVSNYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE----- 76

Query: 349  PVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARL 513
              R AT EE++  H+E+++ FL     E+  KM R  L  K   GD   +  + Y  + L
Sbjct: 77   -TRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRGTL-EKFNIGDDCPIFQNLYDYSTL 134

Query: 514  SCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPES 690
              G +++A + ++  +  + +AI    G HHA+     GFC  +++ ++  ++L+ +P  
Sbjct: 135  YTGASLDATRKLINDQ--SDIAINWSGGLHHAKKNNPSGFCYINDIVLSIVNLLRYHP-- 190

Query: 691  VRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGF 870
              ++L +D D+HHG+G Q+AFY  D V  IS H+F  G+F+PG   G+YD+ G  KGK F
Sbjct: 191  --RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPG--TGDYDETGCAKGKHF 245

Query: 871  NCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNC 1047
              N+  P++ G+ D  YI  F+ I+ P+   ++P +++   G D+   D +G  ++    
Sbjct: 246  AMNV--PLEDGIDDDSYINLFKSIMDPLITSYKPTVIVQQCGADSLGHDRLGCFNLNIKG 303

Query: 1048 YGYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKILIGEPPDEIPESD 1203
            +G     +KS     L VV  GGY   ++S      + +    +L  E P+ IP  D
Sbjct: 304  HGECVKFIKSFGIPML-VVGGGGYTPRNVSRLWTYETGILNNVLLPNELPEGIPFRD 359

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
            YGL194C (REAL)
          Length = 452

 Score =  137 bits (344), Expect = 7e-34
 Identities = 99/351 (28%), Positives = 176/351 (50%), Gaps = 7/351 (1%)
 Frame = +1

Query: 169  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKI 348
            Y  R+ YH     S++ Y   HP  P      ++++  + L++   L  + D+ +     
Sbjct: 24   YSPRVSYHFNPKVSHYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE----- 72

Query: 349  PVREATKEEILDVHTEEHMQFLESTEKMTREEL----LSKTEKGDSVYLNNDSYISARLS 516
              R AT++E+L+ H+E+++ FL         +L    L     GD   +  + Y    L 
Sbjct: 73   -TRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 517  CGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESV 693
             G +++A + ++  +  + +AI    G HHA+  +  GFC  +++ ++  ++L+ +P   
Sbjct: 132  TGASLDATRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 694  RKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFN 873
             +IL +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G+  ++G  KGK F 
Sbjct: 187  -RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPG--TGDLTEIGCDKGKHFA 242

Query: 874  CNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCY 1050
             N+  P++ G+ D  YI  F+ IV P+   F+P L++   G D+   D +G  ++    +
Sbjct: 243  LNV--PLEDGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 1051 GYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGE-PPDEIPES 1200
            G     +KS     L VV  GGY   ++S        IL     P++IPE+
Sbjct: 301  GECVKFVKSFGLPML-VVGGGGYTPRNVSRLWTYETGILNDVLLPEDIPEN 350

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
            HOS2Histone deacetylase required for gene activation via
            specific deacetylation of lysines in H3 and H4 histone
            tails; subunit of the Set3 complex, a meiotic-specific
            repressor of sporulation specific genes that contains
            deacetylase activity
          Length = 452

 Score =  137 bits (344), Expect = 7e-34
 Identities = 98/356 (27%), Positives = 177/356 (49%), Gaps = 11/356 (3%)
 Frame = +1

Query: 169  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKI 348
            Y  R+ YH     S++ Y   HP  P      ++++  + L++   L  + D+ +     
Sbjct: 24   YSPRVSYHFNSKVSHYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE----- 72

Query: 349  PVREATKEEILDVHTEEHMQFLESTEKMTREEL----LSKTEKGDSVYLNNDSYISARLS 516
              R AT++E+L  H+E+++ FL         +L    L     GD   +  + Y    L 
Sbjct: 73   -TRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 517  CGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESV 693
             G +++A + ++  +  + +AI    G HHA+  +  GFC  +++ ++  ++L+ +P   
Sbjct: 132  TGASLDATRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 694  RKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFN 873
             +IL +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G+  ++G  KGK F 
Sbjct: 187  -RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPG--TGDLTEIGCDKGKHFA 242

Query: 874  CNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCY 1050
             N+  P++ G+ D  YI  F+ IV P+   F+P L++   G D+   D +G  ++    +
Sbjct: 243  LNV--PLEDGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 1051 GYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKILIGEPPDEIPESD 1203
            G     +KS     L VV  GGY   ++S      + +    +L  + P++IP  D
Sbjct: 301  GECVKFVKSFGLPML-VVGGGGYTPRNVSRLWTYETGILNDVLLPEDIPEDIPFRD 355

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
            similar to uniprot|P53096 Saccharomyces cerevisiae
            YGL194C HOS2 Histone deacetylase required for gene
            activation via specific deacetylation of lysines in H3
            and H4 histone tails subunit of the Set3 complex a
            meiotic-specific repressor of sporulation specific genes
            that contains deacetylase activity
          Length = 448

 Score =  136 bits (342), Expect = 1e-33
 Identities = 101/361 (27%), Positives = 182/361 (50%), Gaps = 12/361 (3%)
 Frame = +1

Query: 160  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 339
            G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + D+ +  
Sbjct: 20   GSSYCPRVSYHFNPKVSNYHYGTKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 71

Query: 340  LKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYIS 504
                 R AT EE+   H+EE++ F+     E+  K+ R  L  K   GD   +  + Y  
Sbjct: 72   ----TRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTL-EKFNIGDDCPIFPNLYDY 126

Query: 505  ARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTY 681
            + L  G +++A + ++  +  + +AI    G HHA+     GFC  +++ +A  ++L+ +
Sbjct: 127  SSLYAGASLDASRKLINDQ--SDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRYH 184

Query: 682  PESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG 861
            P    ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   GN+D+VG  +G
Sbjct: 185  P----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPG--TGNHDEVGCARG 237

Query: 862  KGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVT 1038
            K F  N+  P++ G+ D  YI  F+ I+ P+   ++P +++   G D+   D +G  ++ 
Sbjct: 238  KHFALNV--PLQDGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFNLN 295

Query: 1039 PNCYGYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKILIGEPPDEIPESD 1203
               +G   + ++S     L VV  GGY   ++S      + +    +L  + P+ IP  D
Sbjct: 296  VKAHGECVNFVRSFGLPML-VVGGGGYTPRNVSRLWTYETGILNNVLLPKDLPEGIPFRD 354

Query: 1204 R 1206
            R
Sbjct: 355  R 355

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
            YGL194C (REAL)
          Length = 452

 Score =  135 bits (341), Expect = 2e-33
 Identities = 101/352 (28%), Positives = 176/352 (50%), Gaps = 8/352 (2%)
 Frame = +1

Query: 169  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKI 348
            Y  R+ YH     S++ Y   HP  P R+      +  + L++   L  + D+ +     
Sbjct: 24   YSPRVSYHFNPKASHYHYGVKHPMKPIRL------MLTDHLVSSYGLHKIMDLYE----- 72

Query: 349  PVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARL 513
              R ATK+E+ + HTE+++ FL     E+  K+ R  L      GD   +  + Y    L
Sbjct: 73   -TRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTL-ENFNIGDDCPIFQNLYDYTTL 130

Query: 514  SCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPES 690
              G  ++A + ++  +  + +AI    G HHA+  +  GFC  +++ ++  ++L+ +P  
Sbjct: 131  YTGATLDATRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 691  VRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGF 870
              ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G+  ++G  KGK F
Sbjct: 187  --RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPG--TGDLTEIGCDKGKHF 241

Query: 871  NCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNC 1047
              N+  P++ G+ D  YI  F+ IV P+   F+P +++   G D+   D +G  ++    
Sbjct: 242  ALNV--PLEDGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKA 299

Query: 1048 YGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGE-PPDEIPES 1200
            +G     +KS     L VV  GGY   ++S        IL     P++IPE+
Sbjct: 300  HGECVKFVKSFGLPML-VVGGGGYTPKNVSRLWAYETGILNDVLLPEDIPEN 350

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
            YGL194C (REAL)
          Length = 452

 Score =  135 bits (339), Expect = 3e-33
 Identities = 98/356 (27%), Positives = 176/356 (49%), Gaps = 11/356 (3%)
 Frame = +1

Query: 169  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKI 348
            Y  R+ YH     S++ Y   HP  P      ++++  + L++   L  + D+ +     
Sbjct: 24   YSPRVSYHFNSKVSHYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE----- 72

Query: 349  PVREATKEEILDVHTEEHMQFLESTEKMTREEL----LSKTEKGDSVYLNNDSYISARLS 516
              R AT++E+L  H+E+++ FL         +L    L     GD   +  + Y    L 
Sbjct: 73   -TRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 517  CGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESV 693
             G +++A + ++  +  + +AI    G HHA+  +  GFC  +++ ++  ++L+ +P   
Sbjct: 132  TGASLDATRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 694  RKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFN 873
             +IL +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G+  ++G  KGK F 
Sbjct: 187  -RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPG--TGDLTEIGCDKGKHFA 242

Query: 874  CNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCY 1050
             N+  P++ G+ D  YI  F+ IV P+   F+P L++   G D+   D +G  ++    +
Sbjct: 243  LNV--PLEDGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 1051 GYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKILIGEPPDEIPESD 1203
            G     +KS     L VV  GGY   ++S      + +    +L    P++IP  D
Sbjct: 301  GECVKFVKSFGLPML-VVGGGGYTPRNVSRLWTYETGILNDVLLPENIPEDIPFRD 355

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
            similar to uniprot|P53096 Saccharomyces cerevisiae
            YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
            YNL330c RPD3
          Length = 450

 Score =  130 bits (328), Expect = 9e-32
 Identities = 100/359 (27%), Positives = 178/359 (49%), Gaps = 14/359 (3%)
 Frame = +1

Query: 160  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 339
            G  Y  R+ YH     S++ Y   HP  P      ++++  + L++   L  + D+    
Sbjct: 21   GSNYAPRVSYHINPEVSHYHYGVRHPMKP------FRLMLTDHLVSGYGLHKIMDL---- 70

Query: 340  LKIPVREATKEEILDVHTEEHMQFLESTEKMTREEL-------LSKTEKGDSVYLNNDSY 498
                 R+AT EE+ + H+E+++ FL    K+T E L       L K   GD   +  + +
Sbjct: 71   --YKTRKATAEEMEEFHSEDYVNFLS---KVTPENLSKLPRGTLEKFNIGDDCPIFPNIF 125

Query: 499  ISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILK 675
              + L  G +++A + ++  +  + +AI    G HHA+  +  GFC  +++ +A  ++L+
Sbjct: 126  QYSSLYTGASLDASRKLINNQ--SDIAINWSGGLHHAKKNSPSGFCYINDIVLAILNLLR 183

Query: 676  TYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDG 855
             +P    ++L +D D+HHG+G Q+AFY  D V  IS H++  G+F+PG   G  D+ G  
Sbjct: 184  YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPG--TGKNDETGCA 236

Query: 856  KGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCH 1032
             GK F  N+  P++ G+ D  YI  F+ I+ P+   F+P +++   G D+   D +G  +
Sbjct: 237  DGKHFAMNV--PLEDGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRLGCFN 294

Query: 1033 VTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSIS-----NSALAVAKILIGEPPDEIP 1194
            +    +G     ++S     L VV  GGY   ++S      + +    +L  E PD +P
Sbjct: 295  LNIKAHGECVKFVRSFGIPML-VVGGGGYTPRNVSRLWTYETGILNNVLLPEELPDNLP 352

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
            YGL194C
          Length = 451

 Score =  130 bits (328), Expect = 9e-32
 Identities = 92/332 (27%), Positives = 167/332 (50%), Gaps = 6/332 (1%)
 Frame = +1

Query: 160  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 339
            G    +R+ YH     S++ Y   HP  P      ++++  + L++   +  V D+ +  
Sbjct: 22   GAARPLRVSYHFNPKVSHYHYGVKHPMKP------FRLMLTDHLVSGYGMHKVMDLYE-- 73

Query: 340  LKIPVREATKEEILDVHTEEHMQFLESTEKMTREEL----LSKTEKGDSVYLNNDSYISA 507
                 R AT +E+ + HTE+++ FL+        +L    L K   GD   +  + Y  A
Sbjct: 74   ----TRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQNLYDYA 129

Query: 508  RLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYP 684
             L  G +++A + ++ G+  + +AI    G HHA+  +  GFC  +++ ++  ++L+ +P
Sbjct: 130  TLYTGASLDATRKLINGQ--SDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLRYHP 187

Query: 685  ESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGK 864
                ++L +D D+HHG+G Q+AFY  D V  IS H++  G F+PG   G+ D+ G   G+
Sbjct: 188  ----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPG--TGDIDETGCDAGE 240

Query: 865  GFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTP 1041
             F  N+  P++ G+ D  YI  F+ ++ P+   + P ++I   G D+   D +G  ++  
Sbjct: 241  RFALNV--PLEDGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFNLNI 298

Query: 1042 NCYGYMTHMLKSLARGNLCVVLEGGYNLDSIS 1137
              +G     +KS     L VV  GGY   ++S
Sbjct: 299  KAHGECVKFVKSFGIPML-VVGGGGYTPRNVS 329

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
            YNL330C (REAL)
          Length = 433

 Score =  125 bits (314), Expect = 5e-30
 Identities = 90/329 (27%), Positives = 160/329 (48%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL     +               +
Sbjct: 20   RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ E   RE +  K   GD   + +  Y    +S G
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126  GSMEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L VD D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    VG GKGK ++ N
Sbjct: 180  VLYVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDVGVGKGKNYSVN 235

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  Y   FE +V  +   ++P  V++ +G D+  GD +G  +++   +  
Sbjct: 236  V--PLRDGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHAN 293

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     + VV  GGY + +++ +
Sbjct: 294  CVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
            YNL330C (REAL)
          Length = 433

 Score =  124 bits (310), Expect = 1e-29
 Identities = 87/329 (26%), Positives = 158/329 (48%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL     +               +
Sbjct: 20   RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ E   RE +  K   GD   + +  Y    +S G
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126  GSMEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    +G G GK +  N
Sbjct: 180  VLYIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPG--TGELRDIGVGTGKNYAVN 235

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +G 
Sbjct: 236  V--PLRDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGN 293

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     + VV  GGY + +++ +
Sbjct: 294  CVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
            Anc_3.8
          Length = 433

 Score =  122 bits (306), Expect = 5e-29
 Identities = 89/329 (27%), Positives = 158/329 (48%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL     +               +
Sbjct: 20   RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKKMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ E   +E +  K   GD   + +  Y    +S G
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126  GSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    VG GKGK +  N
Sbjct: 180  VLYIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPG--TGELRDVGVGKGKYYAVN 235

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  Y   FE +V  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 236  V--PLRDGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHAN 293

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     + VV  GGY + +++ +
Sbjct: 294  CVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
            similar to uniprot|P32561 Saccharomyces cerevisiae
            YNL330C RPD3 Histone deacetylase regulates transcription
            and silencing
          Length = 432

 Score =  122 bits (305), Expect = 7e-29
 Identities = 91/343 (26%), Positives = 163/343 (47%), Gaps = 7/343 (2%)
 Frame = +1

Query: 136  LHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTG 315
            L +  LK       R+ Y      S + Y   HP  P RI   + ++   GL     +  
Sbjct: 6    LPFDDLKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKKMEI-- 63

Query: 316  VSDIGDLMLKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVY 480
                         + ATK+E+   H++E++ FL     ++ E   +E +  K   GD   
Sbjct: 64   ----------YRAKPATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESV--KFNVGDDCP 111

Query: 481  LNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVA 657
            + +  Y    +S GG++E    +  G+    +AI    G HHA+   A GFC  +++ + 
Sbjct: 112  VFDGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLG 169

Query: 658  AKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNY 837
               +L+ +P    ++L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G  
Sbjct: 170  IIELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGEL 221

Query: 838  DKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGD 1014
               G GKGK ++ N+  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD
Sbjct: 222  RDTGVGKGKYYSVNV--PLRDGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGD 279

Query: 1015 TIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
             +G  +++   +    + +KS     L VV  GGY + +++ +
Sbjct: 280  RLGCFNLSMRGHANCVNYVKSFGIPML-VVGGGGYTMRNVART 321

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
            complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  122 bits (305), Expect = 7e-29
 Identities = 87/329 (26%), Positives = 157/329 (47%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL     +               +
Sbjct: 20   RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKKMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ +   +E +  K   GD   + +  Y    +S G
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126  GSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G     G GKGK +  N
Sbjct: 180  VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDTGVGKGKNYAVN 235

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 236  V--PLRDGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHAN 293

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     L VV  GGY + +++ +
Sbjct: 294  CVNFVKSFGI-PLMVVGGGGYTMRNVART 321

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
            (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  121 bits (304), Expect = 9e-29
 Identities = 92/343 (26%), Positives = 162/343 (47%), Gaps = 7/343 (2%)
 Frame = +1

Query: 136  LHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTG 315
            L +  LK       R+ Y      S + Y   HP  P RI   + ++   GL     +  
Sbjct: 6    LPFDELKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKKMEI-- 63

Query: 316  VSDIGDLMLKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVY 480
                         + ATK+E+   HT+E++ FL     ++ E   +E +  K   GD   
Sbjct: 64   ----------YRAKPATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESV--KFNVGDDCP 111

Query: 481  LNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVA 657
            + +  Y    +S GG++E    +  G+    +AI    G HHA+   A GFC  +++ + 
Sbjct: 112  VFDGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLG 169

Query: 658  AKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNY 837
               +L+ +P    ++L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G  
Sbjct: 170  IIELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGEL 221

Query: 838  DKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGD 1014
               G GKGK +  N+  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD
Sbjct: 222  RDTGVGKGKYYAVNV--PLRDGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGD 279

Query: 1015 TIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
             +G  +++   +    + +KS     L VV  GGY + +++ +
Sbjct: 280  RLGCFNLSMRGHANCVNYVKSFGIPML-VVGGGGYTMRNVART 321

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
            Anc_3.8 YNL330C
          Length = 433

 Score =  121 bits (304), Expect = 9e-29
 Identities = 87/329 (26%), Positives = 159/329 (48%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL     +               +
Sbjct: 20   RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ E   +E +  K   GD   + +  Y    +S G
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E+   +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126  GSMESAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    +G GKG+ +  N
Sbjct: 180  VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDIGVGKGQNYAVN 235

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  Y   FE +V  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 236  V--PLRDGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHAS 293

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     + VV  GGY + +++ +
Sbjct: 294  CVNYVKSF-NIPMMVVGGGGYTMRNVART 321

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
            YNL330C
          Length = 433

 Score =  121 bits (303), Expect = 1e-28
 Identities = 86/329 (26%), Positives = 158/329 (48%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL     +               +
Sbjct: 20   RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKKMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ +   +E +  K   GD   + +  Y    +S G
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126  GSMEGAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    +G GKGK +  N
Sbjct: 180  VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDIGVGKGKNYAVN 235

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 236  V--PLRDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHAN 293

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     + VV  GGY + +++ +
Sbjct: 294  CVNYVKSF-NIPMMVVGGGGYTMRNVART 321

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
            highly similar to uniprot|P32561 Saccharomyces cerevisiae
            YNL330c RPD3 histone deacetylase B or uniprot|P53096
            Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  121 bits (303), Expect = 1e-28
 Identities = 87/329 (26%), Positives = 158/329 (48%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL     +               +
Sbjct: 20   RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKKMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ E   +E +  K   GD   + +  Y    +S G
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126  GSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    +G GKGK +  N
Sbjct: 180  VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDIGVGKGKYYAVN 235

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 236  V--PLRDGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHAN 293

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     + VV  GGY + +++ +
Sbjct: 294  CVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YNL330C
            (REAL)
          Length = 433

 Score =  121 bits (303), Expect = 1e-28
 Identities = 86/329 (26%), Positives = 157/329 (47%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL     +               +
Sbjct: 20   RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ E   RE +  K   GD   + +  Y    +S G
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126  GSMEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    +G G GK +  N
Sbjct: 180  VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDIGVGTGKNYAVN 235

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 236  V--PLRDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHAN 293

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     + VV  GGY + +++ +
Sbjct: 294  CVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
            RPD3Histone deacetylase; regulates transcription,
            silencing, and other processes by influencing chromatin
            remodeling; forms at least two different complexes which
            have distinct functions and members
          Length = 433

 Score =  121 bits (303), Expect = 1e-28
 Identities = 86/329 (26%), Positives = 157/329 (47%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL     +               +
Sbjct: 20   RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKKMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ E   RE +  K   GD   + +  Y    +S G
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126  GSMEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    +G G GK +  N
Sbjct: 180  VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDIGVGAGKNYAVN 235

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 236  V--PLRDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHAN 293

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     + VV  GGY + +++ +
Sbjct: 294  CVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
            similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  120 bits (301), Expect = 2e-28
 Identities = 91/351 (25%), Positives = 165/351 (47%), Gaps = 7/351 (1%)
 Frame = +1

Query: 112  IVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGL 291
            +V  QKP   +  L        R+ Y        + Y   HP  P RI   + ++   GL
Sbjct: 1    MVFVQKP---FDDLTVNSSQKKRVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGL 57

Query: 292  INDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSK 456
                 +               + ATK+E+   HT+E++ FL     ++ +   +E +  K
Sbjct: 58   YKKMEI------------YRAKPATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESV--K 103

Query: 457  TEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFC 633
               GD   + +  Y    +S GG++E    +  G+    +AI    G HHA+   A GFC
Sbjct: 104  FNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFC 161

Query: 634  LFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFY 813
              +++ +    +L+ +P    ++L +D D+HHG+G ++AFY  D V+  S H++  G+F+
Sbjct: 162  YLNDIVLGIIELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFF 215

Query: 814  PGFPEGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSS 990
            PG   G     G GKGK ++ N+  P++ G+ D  Y   FE ++  +   ++P  V++  
Sbjct: 216  PG--TGELRDTGVGKGKYYSVNV--PLRDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQC 271

Query: 991  GFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
            G D+  GD +G  +++   +    + +KS     + VV  GGY + +++ +
Sbjct: 272  GGDSLSGDRLGCFNLSMRGHANCVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  120 bits (301), Expect = 2e-28
 Identities = 91/351 (25%), Positives = 165/351 (47%), Gaps = 7/351 (1%)
 Frame = +1

Query: 112  IVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGL 291
            +V  QKP   +  L        R+ Y        + Y   HP  P RI   + ++   GL
Sbjct: 1    MVFVQKP---FDELTVNSSQKKRVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGL 57

Query: 292  INDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSK 456
                 +               + ATK+E+   HT+E++ FL     ++ +   +E +  K
Sbjct: 58   YKKMEI------------YRAKPATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESV--K 103

Query: 457  TEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFC 633
               GD   + +  Y    +S GG++E    +  G+    +AI    G HHA+   A GFC
Sbjct: 104  FNVGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFC 161

Query: 634  LFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFY 813
              +++ +    +L+ +P    ++L +D D+HHG+G ++AFY  D V+  S H++  G+F+
Sbjct: 162  YLNDIVLGIIELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFF 215

Query: 814  PGFPEGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSS 990
            PG   G     G GKGK ++ N+  P++ G+ D  Y   FE ++  +   ++P  V++  
Sbjct: 216  PG--TGELRDTGVGKGKYYSVNV--PLRDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQC 271

Query: 991  GFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
            G D+  GD +G  +++   +    + +KS     + VV  GGY + +++ +
Sbjct: 272  GGDSLSGDRLGCFNLSMRGHANCVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
            Anc_3.8 YNL330C
          Length = 433

 Score =  120 bits (300), Expect = 3e-28
 Identities = 86/329 (26%), Positives = 158/329 (48%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL     +               +
Sbjct: 20   RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKKMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ +   +E +  K   GD   + +  +    +S G
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV--KFNVGDDCPVFDGLFEYCSISGG 125

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126  GSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    VG GKGK +  N
Sbjct: 180  VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDVGIGKGKNYAVN 235

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 236  V--PLRDGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHAN 293

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     + VV  GGY + +++ +
Sbjct: 294  CVNFVKSF-NIPMMVVGGGGYTMRNVART 321

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
            YNL330C
          Length = 433

 Score =  120 bits (300), Expect = 3e-28
 Identities = 85/329 (25%), Positives = 157/329 (47%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL  +  +               +
Sbjct: 20   RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKNMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ +   +E +  K   GD   + +  Y    +S G
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126  GSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----R 179

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G     G G GK +  N
Sbjct: 180  VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDTGVGNGKNYAVN 235

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 236  V--PLRDGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHAN 293

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     + VV  GGY + +++ +
Sbjct: 294  CVNFVKSF-NIPMMVVGGGGYTMRNVART 321

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  120 bits (300), Expect = 3e-28
 Identities = 87/329 (26%), Positives = 157/329 (47%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL     +               +
Sbjct: 21   RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKKMEI------------YRAK 68

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ E   +E +  K   GD   + +  Y    +S G
Sbjct: 69   PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESV--KFNVGDDCPVFDGLYEYCSISGG 126

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 127  GSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----R 180

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G     G GKGK +  N
Sbjct: 181  VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDTGVGKGKYYAVN 236

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 237  V--PLRDGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHAN 294

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     + VV  GGY + +++ +
Sbjct: 295  CVNYVKSFGI-PMMVVGGGGYTMRNVART 322

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
            highly similar to uniprot|P32561 Saccharomyces cerevisiae
            YNL330C RPD3 Histone deacetylase regulates transcription
            and silencing
          Length = 432

 Score =  119 bits (299), Expect = 4e-28
 Identities = 86/329 (26%), Positives = 157/329 (47%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL     +               +
Sbjct: 20   RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKKMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ +   +E +  K   GD   + +  Y    +S G
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126  GSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G     G GKGK +  N
Sbjct: 180  VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDTGVGKGKYYAVN 235

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 236  V--PLRDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHAN 293

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     L +V  GGY + +++ +
Sbjct: 294  CVNYMKSFG-VPLMIVGGGGYTMRNVART 321

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
            similar to uniprot|P32561 Saccharomyces cerevisiae
            YNL330C RPD3 Histone deacetylase regulates transcription
            and silencing
          Length = 433

 Score =  119 bits (299), Expect = 4e-28
 Identities = 87/328 (26%), Positives = 157/328 (47%), Gaps = 6/328 (1%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL     +               +
Sbjct: 20   RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKKMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFLESTE----KMTREELLSKTEKGDSVYLNNDSYISARLSCGG 525
             ATK+E+   HT+E++ FL         M ++E + K   GD   + +  Y    +S GG
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESV-KFNVGDDCPVFDGLYEYCSISGGG 126

Query: 526  AIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 702
            ++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++
Sbjct: 127  SMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RV 180

Query: 703  LIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNI 882
            L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G     G GKGK ++ N+
Sbjct: 181  LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDTGVGKGKYYSVNV 236

Query: 883  TWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYM 1059
              P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +   
Sbjct: 237  --PLRDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANC 294

Query: 1060 THMLKSLARGNLCVVLEGGYNLDSISNS 1143
             + +KS     + VV  GGY + +++ +
Sbjct: 295  VNYVKSFGI-PMMVVGGGGYTMRNVART 321

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
            similar to uniprot|P32561 Saccharomyces cerevisiae
            YNL330C RPD3 Histone deacetylase regulates transcription
            and silencing
          Length = 433

 Score =  119 bits (299), Expect = 4e-28
 Identities = 86/329 (26%), Positives = 157/329 (47%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        + Y   HP  P RI   + ++   GL     +               +
Sbjct: 20   RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKKMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ +   +E +  K   GD   + +  Y    +S G
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126  GSMEGAARLNRGKCD--VAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G     G GKGK +  N
Sbjct: 180  VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDTGVGKGKYYAVN 235

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  Y   FE +V  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 236  V--PLRDGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHAN 293

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     + +V  GGY + +++ +
Sbjct: 294  CVNFVKSFGL-PMMIVGGGGYTMRNVART 321

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
            Anc_3.8 YNL330C
          Length = 433

 Score =  118 bits (295), Expect = 1e-27
 Identities = 87/329 (26%), Positives = 157/329 (47%), Gaps = 7/329 (2%)
 Frame = +1

Query: 178  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 357
            R+ Y        F Y   HP  P RI   + ++   GL     +               +
Sbjct: 20   RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKKMEI------------YRAK 67

Query: 358  EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 522
             ATK+E+   HT+E++ FL     ++ E   +E +  K   GD   + +  Y    +S G
Sbjct: 68   PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 523  GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
            G++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126  GSMEGAARLNRGKCD--VAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 700  ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 879
            +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    +G G GK +  N
Sbjct: 180  VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDIGVGSGKYYAVN 235

Query: 880  ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 1056
            +  P++ G+ D  +   FE +V  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 236  V--PLRDGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHAN 293

Query: 1057 MTHMLKSLARGNLCVVLEGGYNLDSISNS 1143
              + +KS     + VV  GGY + +++ +
Sbjct: 294  CVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
            Anc_3.362 YPR068C
          Length = 454

 Score = 81.3 bits (199), Expect = 2e-15
 Identities = 54/181 (29%), Positives = 92/181 (50%), Gaps = 1/181 (0%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 777
            HHA  Q A GFC  +++ +  + + +   +  +KI  +D+D+HHG+G +KAF    NV  
Sbjct: 206  HHAFKQKASGFCYVNDIVLLIQKLRR---KGFQKISYIDFDLHHGDGVEKAFQFSSNVQT 262

Query: 778  ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAR 957
            ISLH FE+G F+PG   GN  +  D +    N  +   + G+ D       EQIV P+  
Sbjct: 263  ISLHLFEVG-FFPG--TGNLSE-SDKRRNVVNIPL---LHGLDDTSLEQLIEQIVKPVIE 315

Query: 958  EFRPDLVIVSSGFDAAHGDTIGQCHVT-PNCYGYMTHMLKSLARGNLCVVLEGGYNLDSI 1134
               PD++++  G D   GD   +  ++       +T ++ +     + ++  GGYN+  +
Sbjct: 316  RHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAKCITELINNTKDCPVILLGGGGYNVTLM 375

Query: 1135 S 1137
            S
Sbjct: 376  S 376

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
            YPR068C (REAL)
          Length = 471

 Score = 78.2 bits (191), Expect = 2e-14
 Identities = 58/214 (27%), Positives = 101/214 (47%), Gaps = 2/214 (0%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 777
            HHA  Q A GFC  ++V +  + + K     + KI  VD+D+HHG+G ++AF     +  
Sbjct: 212  HHAFKQKANGFCYINDVVLLIQRLRKM---KLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 778  ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYI-WAFEQIVIPMA 954
            IS+H +E G F+PG   G+ +    GK       +  P+K   D  Y+     +I+ P+ 
Sbjct: 269  ISIHLYEPG-FFPG--TGSLNDARKGKSV-----VNIPLKHGCDDSYLDLVASKIISPLI 320

Query: 955  REFRPDLVIVSSGFDAAHGDTIGQCHVT-PNCYGYMTHMLKSLARGNLCVVLEGGYNLDS 1131
            +   PD++I+  G D   GD   +  +T       + +++K   R ++ ++  GGYN D 
Sbjct: 321  KRHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYN-DL 379

Query: 1132 ISNSALAVAKILIGEPPDEIPESDRDPKPGVLEM 1233
            + +         +      I ++D   K G  +M
Sbjct: 380  LMSRFYTYLTWCVTREFSTIGQADDSSKDGPFDM 413

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
            HOS1Class I histone deacetylase (HDAC) family member that
            deacetylates Smc3p on lysine residues at anaphase onset;
            has sequence similarity to Hda1p, Rpd3p, Hos2p, and
            Hos3p; interacts with the Tup1p-Ssn6p corepressor complex
          Length = 470

 Score = 76.3 bits (186), Expect = 9e-14
 Identities = 53/177 (29%), Positives = 84/177 (47%), Gaps = 2/177 (1%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 777
            HHA  Q A GFC  ++V +  + + K     + KI  VD+D+HHG+G +KAF     +  
Sbjct: 210  HHAFKQRASGFCYINDVVLLIQRLRKA---KLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 778  ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAF-EQIVIPMA 954
            IS+H +E     PGF  G        K K     +  P+K   D  Y+     +IV P+ 
Sbjct: 267  ISVHLYE-----PGFFPGTGSLSDSRKDKNV---VNIPLKHGCDDNYLELIASKIVNPLI 318

Query: 955  REFRPDLVIVSSGFDAAHGDTIGQCHVT-PNCYGYMTHMLKSLARGNLCVVLEGGYN 1122
                P+ +I+  G D   GD   +  +T       + +++KS  R ++ ++  GGYN
Sbjct: 319  ERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYN 375

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar to
            uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 75.9 bits (185), Expect = 1e-13
 Identities = 64/246 (26%), Positives = 118/246 (47%), Gaps = 3/246 (1%)
 Frame = +1

Query: 394  EEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNA 573
            E  +  +ES +++TR   L+K    D   +     +   +S G  +   + ++EG  +  
Sbjct: 135  EAELSDVESGDEVTRRSTLAKFNLLDDCPIFPYLPLYCYVSTGATLSLAQYILEGS-ERT 193

Query: 574  LAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKA 750
            +AI    G HH+    A GFC  +++++   ++ +     V +I  VD+D+HHG+G +KA
Sbjct: 194  IAINWDGGRHHSMKTKASGFCYINDIALLIMTLRRG---GVDRISYVDFDLHHGDGVEKA 250

Query: 751  FYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAF 930
            F     V  ISLH +E G F+P    G+ +    GK      NI   + G+ D       
Sbjct: 251  FKYSKQVQTISLHMYETG-FFP--CSGSLEDNSSGKS---IVNIPL-LHGLDDSTLQDIA 303

Query: 931  EQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVL- 1107
            ++I++P   + +P+++++  G D   GD   +  +  +  G  + +   + + N  +VL 
Sbjct: 304  KRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQL--SIKGLTSTITSLIEQFNCHIVLL 361

Query: 1108 -EGGYN 1122
              GGYN
Sbjct: 362  GGGGYN 367

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
            YPR068C (REAL)
          Length = 477

 Score = 75.9 bits (185), Expect = 1e-13
 Identities = 50/177 (28%), Positives = 91/177 (51%), Gaps = 2/177 (1%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 777
            HHA  Q A GFC  ++V +  + + K     + K+  +D+D+HHG+G +KAF     +  
Sbjct: 212  HHAFKQKANGFCYINDVVLLIQRLRKL---KLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 778  ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYI-WAFEQIVIPMA 954
            IS+H +E G F+PG   G+ +   +GK       +  P+K   D  Y+     +I+ P+ 
Sbjct: 269  ISVHLYEPG-FFPG--TGSLNDSQNGKN-----IVNIPLKHGCDDNYLNLVASKIIHPLI 320

Query: 955  REFRPDLVIVSSGFDAAHGDTIGQCHVT-PNCYGYMTHMLKSLARGNLCVVLEGGYN 1122
            +   P+++I+  G D   GD   +  +T       + +++KS  + ++ ++  GGYN
Sbjct: 321  KRHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYN 377

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa] {ON}
            similar to uniprot|Q12214 Saccharomyces cerevisiae
            YPR068C
          Length = 436

 Score = 75.5 bits (184), Expect = 1e-13
 Identities = 54/178 (30%), Positives = 85/178 (47%), Gaps = 3/178 (1%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 777
            HHA  + A GFC  +++ +    I K   +  +++  +D+D+HHG+G ++AF    NV  
Sbjct: 195  HHAMKKRASGFCYVNDIVLL---IQKLRSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 778  ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAR 957
            IS+H FE G F+P         + D K KG N        G+ D        Q+VIP+  
Sbjct: 252  ISMHLFECG-FFP-----TSGSLEDNK-KGKNIANIPLAHGLNDEYLNEIVTQVVIPLTD 304

Query: 958  EFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVL---EGGYN 1122
               P ++I+  G D   GD   +  +T    G   ++LK + R   C ++    GGYN
Sbjct: 305  RHSPQVIIIQCGGDGLMGDEYNEWQLT--IKGLCENILKIVNRYKNCSIVLLGGGGYN 360

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
            (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
            [contig 254] FULL
          Length = 473

 Score = 75.5 bits (184), Expect = 2e-13
 Identities = 49/177 (27%), Positives = 84/177 (47%), Gaps = 2/177 (1%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 777
            HHA    A GFC  +++++  + + +     + KI  +D+D+HHG+G ++AF    NV  
Sbjct: 224  HHAFKSKASGFCYVNDIAILIQKLRR---RGIHKISYLDFDLHHGDGVERAFQHSANVQT 280

Query: 778  ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPV-KGVGDVEYIWAFEQIVIPMA 954
            IS+H +E G F+PG   G       G+       +  PV  G+ D        ++VIP  
Sbjct: 281  ISIHMYEEG-FFPG--TGTLKDASSGRN-----IVNIPVLHGMDDTFLNEVVNRVVIPCL 332

Query: 955  REFRPDLVIVSSGFDAAHGDTIGQCHVT-PNCYGYMTHMLKSLARGNLCVVLEGGYN 1122
                P++VI+  G D   GD   +  +T       +  +++     N+ ++  GGYN
Sbjct: 333  HNHNPEVVIIQCGGDGLIGDKYKEWQLTLKGLTDTIMKVVEDFPSSNIVLLGGGGYN 389

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3.362
            YPR068C
          Length = 508

 Score = 75.5 bits (184), Expect = 2e-13
 Identities = 67/260 (25%), Positives = 121/260 (46%), Gaps = 6/260 (2%)
 Frame = +1

Query: 361  ATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISA--RLSCGGAIE 534
            +T EE ++   E+     ++ ++M RE+L     +GD       SY+    ++  G  + 
Sbjct: 155  STTEEPVNKRAEKENSN-DNEKEMIREKLKGYNLEGDCPIF---SYLPVYCQVIVGATLS 210

Query: 535  ACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIV 711
              K +     +  +A+    G HHA    A GFC  +++ +  + +        ++I  +
Sbjct: 211  LAKHITAVANERTIAVNWDGGRHHALRNKASGFCYINDIVLLIQQLRSN---GYKRITYI 267

Query: 712  DWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWP 891
            D+D+HHG+G Q++F    +V  IS H FE G F+P        K+G         NI   
Sbjct: 268  DFDLHHGDGVQRSFQYSTSVQTISAHMFEPG-FFPCTGSLKESKMGKN-----IVNIPL- 320

Query: 892  VKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHML 1071
            + GV D+      E+++IP  + + P+++++  G D   GD   +  +T   +G + ++L
Sbjct: 321  LHGVDDMLMNEIVEKVMIPCVKRYDPEILVIQCGGDGLIGDGYAEWQLT--IHGLVNNIL 378

Query: 1072 KSLARGNLCVVL---EGGYN 1122
            K L     C V+    GGYN
Sbjct: 379  KLLRIFPGCPVVLLGGGGYN 398

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
            similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 75.5 bits (184), Expect = 2e-13
 Identities = 89/355 (25%), Positives = 149/355 (41%), Gaps = 64/355 (18%)
 Frame = +1

Query: 424  EKMTRE--ELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKN-----ALAI 582
            EK+ R+  E+  +   GD +YL  ++  + R S G       ++ +G V       A   
Sbjct: 129  EKIGRKQVEVPDEWNVGD-IYLCEETVYALRGSIGAVEYGVDSIFKGEVNKDTANRAFVA 187

Query: 583  VRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ------ 744
            +RPPGHH+      GFCL +N  +A +    TY   V   +I+D+D+HHG+GTQ      
Sbjct: 188  IRPPGHHSHAATPSGFCLLNNAHIAVEYAADTY--GVTHAVILDFDLHHGDGTQDICWKR 245

Query: 745  -------------------KAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG-- 861
                               K F E   V Y S+H  ++  F       + DKV D     
Sbjct: 246  AGFKADDIQDAKGEYNEFDKKFAEFPKVGYFSMH--DINSFPTELNYASKDKVKDASTCI 303

Query: 862  -KGFNCNITW-----PVKGVGDVEYIWA-------------FEQIVIPMAREFRP--DLV 978
                + NI W     P +   +   ++              F+   + MA++ +P   LV
Sbjct: 304  MDAHDVNI-WNIHLLPYETEEEFNKLYQTRYRTLFAKADEFFKAAKLSMAKDGKPFKGLV 362

Query: 979  IVSSGFDAAHGDTIGQ----CHVTPNCYGYMTHMLKSLAR----GNLCVVLEGGYNLDSI 1134
            ++S+GFDA+  + +       +V  + Y   T     LA+    G +  +LEGGY+  +I
Sbjct: 363  VMSAGFDASEYEQVSMQRHGVNVPTSFYSTFTKDALKLAQMHTNGKIISLLEGGYSDAAI 422

Query: 1135 SNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFR-RKFGN 1296
               A  V   LIG     +   +   + G  +++ +++R     WK ++ RK G+
Sbjct: 423  ---ASGVFSHLIG-----LQNQNWITEWGSAQVVKEIVRGCKPRWKPYKTRKAGD 469

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar to
            uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 74.7 bits (182), Expect = 3e-13
 Identities = 57/222 (25%), Positives = 109/222 (49%), Gaps = 8/222 (3%)
 Frame = +1

Query: 481  LNNDSYISARLS--CGGAIEACKAVVEG---RVKNALAIVRPPG-HHAEPQAAGGFCLFS 642
            L++D Y+ A L   C     A  ++V     R + A++I    G HHA    A GFC  +
Sbjct: 176  LSHDCYLFAYLPLYCQVIAGATLSLVRAACLRHERAISINWDGGRHHASRSRASGFCYIN 235

Query: 643  NVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGF 822
            ++++  + + +     +R+I  +D+D+HH +G ++AF    +V  IS+H  E G F+PG 
Sbjct: 236  DIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQTISVHLHEPG-FFPG- 290

Query: 823  PEGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 999
              G+  +   GK       +  PV+ G+ D       +++++P  R   P+++++  G D
Sbjct: 291  -TGSLKEASVGKNV-----VNIPVQHGMDDTFLNQIVQRVIMPCIRSHNPEVLVIQCGGD 344

Query: 1000 AAHGDTIGQCHVT-PNCYGYMTHMLKSLARGNLCVVLEGGYN 1122
               GD   +  +T       + ++++     N+ ++  GGYN
Sbjct: 345  GLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYN 386

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
            YPR068C (REAL)
          Length = 470

 Score = 73.9 bits (180), Expect = 5e-13
 Identities = 51/177 (28%), Positives = 89/177 (50%), Gaps = 2/177 (1%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 777
            HHA  Q A GFC  ++V +  + + K     + KI  +D+D+HHG+G +KAF     +  
Sbjct: 210  HHAFKQRASGFCYINDVVLLIQRLRKI---KLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 778  ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYI-WAFEQIVIPMA 954
            IS+H +E G F+PG   G+ D    GK       +  P+K   D  Y+     +I+ P+ 
Sbjct: 267  ISVHIYEPG-FFPG--TGSLDDSRGGKNV-----VNIPLKHGCDDSYLNLIASKIINPLI 318

Query: 955  REFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYG-YMTHMLKSLARGNLCVVLEGGYN 1122
             +  P+++I+  G D   GD   +  +T       + + +K  ++ ++ ++  GGYN
Sbjct: 319  DKHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYN 375

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
            similar to uniprot|Q12214 Saccharomyces cerevisiae
            YPR068C
          Length = 489

 Score = 73.9 bits (180), Expect = 5e-13
 Identities = 52/177 (29%), Positives = 88/177 (49%), Gaps = 2/177 (1%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 777
            HH+    A GFC  +++ +A + + + +      I  VD+D+HHG+G ++AF    NV  
Sbjct: 242  HHSFKSRASGFCYINDIVLAIQRLRRNFSN----ISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 778  ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMA 954
            ISLH  E G F+PG   G+ +   DG     +  I  P++ G  D   +   E +VIP  
Sbjct: 298  ISLHNHEPG-FFPG--TGSMESSQDG-----HSIINIPLRHGADDDCLMKITESVVIPCI 349

Query: 955  REFRPDLVIVSSGFDAAHGDTIGQCHVT-PNCYGYMTHMLKSLARGNLCVVLEGGYN 1122
            ++  P ++++  G D   GD   +  +T       +  +L SL   ++ ++  GGYN
Sbjct: 350  QKHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYN 406

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 72.8 bits (177), Expect = 1e-12
 Identities = 69/246 (28%), Positives = 114/246 (46%), Gaps = 12/246 (4%)
 Frame = +1

Query: 568  NALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ 744
            +ALA+    G HHA    A GFC  +++++  +++ +   +   ++  VD+D+HHG+G +
Sbjct: 182  SALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QGFLRVSYVDFDLHHGDGVE 238

Query: 745  KAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWP-VKGVGDVEYI 921
             AF    NV   SLH FE G F+PG         G  K    N  +  P + GV D    
Sbjct: 239  NAFRYSKNVQTCSLHLFEPG-FFPG--------TGACKNCTDNSVLNVPLLHGVDDSTLD 289

Query: 922  WAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLAR---GN 1092
               + IV P  +   P+++I+  G D   GD  G+  +  + +G   ++LK +       
Sbjct: 290  HVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQL--SIHGLTRNILKLVQAHKFKK 347

Query: 1093 LCVVLEGGYN--LDS-----ISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIR 1251
            + ++  GGYN  L S     +++  LA  K +  E  D+  E  RD      E+I    +
Sbjct: 348  IALLGGGGYNGRLQSRFYAYLTSMLLAQCKGIPTEIGDDEDELIRDH-----ELIEMYEQ 402

Query: 1252 VQSKYW 1269
               K+W
Sbjct: 403  EDYKFW 408

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
            YPR068C
          Length = 579

 Score = 72.8 bits (177), Expect = 1e-12
 Identities = 50/178 (28%), Positives = 90/178 (50%), Gaps = 3/178 (1%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 777
            HH+  + A GFC  +++ +    I K   +  RKI  +D+D+HHG+G +K+F    ++  
Sbjct: 299  HHSRKKKASGFCYVNDIVLC---IQKLGEKGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 778  ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAR 957
            IS+H FE G F+P    G+ ++       GFN      + G+ D    +   +++IP+ +
Sbjct: 356  ISVHLFEPG-FFP--CTGSLEET----KHGFNIVNIPTLHGLDDNYLTYLLNRVIIPLIK 408

Query: 958  EFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVL---EGGYN 1122
            + +P+ ++V  G D   GD   +  +T +  G   +++  L     C V+    GGYN
Sbjct: 409  KHKPECLVVQCGGDGLIGDRYKEWQMTIS--GLTKNIMLVLQNFPECSVVLLGGGGYN 464

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
            YPR068C
          Length = 474

 Score = 71.6 bits (174), Expect = 3e-12
 Identities = 56/210 (26%), Positives = 95/210 (45%), Gaps = 5/210 (2%)
 Frame = +1

Query: 508  RLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYP 684
            +++ G  +   K +V       + I    G HHA  + A GFC  +++ +  + + K   
Sbjct: 188  QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 685  ESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGK 864
               +KI  +D+D+HHG+G +KAF    ++  ISLH FE G F+PG         G    K
Sbjct: 246  -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPG--------TGGLSNK 295

Query: 865  GFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTP 1041
            G    I  P+  G+ D       +QI+IP       + +++  G D   GD   +  +T 
Sbjct: 296  GSRDLIDIPLSHGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLT- 354

Query: 1042 NCYGYMTHMLKSLARGNLCVVL---EGGYN 1122
               G    ++  + + + C ++    GGYN
Sbjct: 355  -IKGLTQCIIDVIGKFSDCQIVLLGGGGYN 383

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] {ON}
            Anc_3.362 YPR068C
          Length = 490

 Score = 70.9 bits (172), Expect = 5e-12
 Identities = 49/176 (27%), Positives = 84/176 (47%), Gaps = 1/176 (0%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 777
            HHA    A GFC  +++ +  + I K      + I  VD+D+HHG+G QKAF    NV  
Sbjct: 215  HHAFKNKASGFCYVNDIVLLIQKIRKN---GFKNISYVDFDLHHGDGVQKAFQFSKNVQT 271

Query: 778  ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAR 957
            +SLH FE G F+P         + + K      NI   + G+         + I+IP+  
Sbjct: 272  VSLHMFEPG-FFP-----CTGSLQEAKAGSSIVNIPL-LHGLDGTFLKQLTKDIIIPVVE 324

Query: 958  EFRPDLVIVSSGFDAAHGDTIGQCHVT-PNCYGYMTHMLKSLARGNLCVVLEGGYN 1122
            +  P+++++  G D   GD   +  +T  +  G +  ++ +    ++ ++  GGYN
Sbjct: 325  QHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSGAIMKLINTFPSCSVVLLGGGGYN 380

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
            complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 70.1 bits (170), Expect = 9e-12
 Identities = 44/177 (24%), Positives = 88/177 (49%), Gaps = 2/177 (1%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 777
            HHA    A GFC  +++ +  + + K   + + K+  +D+D+HHG+G +KAF    N+  
Sbjct: 223  HHAIKNKASGFCYINDIVILIQKLRK---KGISKVSYIDFDLHHGDGVEKAFRYSSNIQT 279

Query: 778  ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPV-KGVGDVEYIWAFEQIVIPMA 954
            IS+H +E G F+P    G+ +   +GK       +  P+  GV D        +++ P+ 
Sbjct: 280  ISMHMYEPG-FFP--CTGSLEDTLNGKN-----IVNVPLYHGVDDNYMTEIVNELIKPLI 331

Query: 955  REFRPDLVIVSSGFDAAHGDTIGQCHVT-PNCYGYMTHMLKSLARGNLCVVLEGGYN 1122
                P+++++  G D   GD   +  +T       + ++++   + ++ ++  GGYN
Sbjct: 332  ERHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTRNIQNLIEWFPKSDIILLGGGGYN 388

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
            HOS3Trichostatin A-insensitive homodimeric histone
            deacetylase (HDAC) with specificity in vitro for histones
            H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p, Hos1p, and
            Hos2p; deletion results in increased histone acetylation
            at rDNA repeats
          Length = 697

 Score = 70.1 bits (170), Expect = 1e-11
 Identities = 91/367 (24%), Positives = 147/367 (40%), Gaps = 63/367 (17%)
 Frame = +1

Query: 376  ILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARL--SCGGAIEACKAV 549
            +L VH       L    +M   +LL    +    + + D Y+S++   +  G I A +  
Sbjct: 110  VLKVHGSSWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 550  VEGRVKN---------ALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 702
            V+   K          A   +RPPGHH       GFCL +N  VA +    TY  +V  +
Sbjct: 170  VDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NVTHV 227

Query: 703  LIVDWDIHHGNGTQ------------------------KAFYEDDNVLYISLHRFELGKF 810
            +++D+D+HHG+GTQ                        K F E   V Y S+H       
Sbjct: 228  VVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSMHDINSFPT 287

Query: 811  YPGF-PEGNYDKVGDGKGKGFNCNI------TWPVKGVGDVEY------IWA-----FEQ 936
              GF  + N            + NI       W  +   +V Y      ++A     F  
Sbjct: 288  ESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADEFFRS 347

Query: 937  IVIPMAREFRP--DLVIVSSGFDAAHGD-TIGQCH---VTPNCYGYMTHMLKSLAR---- 1086
              + M ++ RP   LV++S+GFDA+  + T  Q H   V  + Y   T     LA+    
Sbjct: 348  AKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHCH 407

Query: 1087 GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKY 1266
            G +  ++EGGY+  +I +   A    LIG     +   D   + G  +++ +++R     
Sbjct: 408  GKVLSLMEGGYSDKAICSGVFA---HLIG-----LQNQDWVKEWGSEQVVKEIVRGCKPA 459

Query: 1267 WKCFRRK 1287
            WK ++ K
Sbjct: 460  WKPYKTK 466

>Kwal_27.11541 s27 complement(841066..841374) [309 bp, 102 aa] {OFF}
            [contig 27] FULL
          Length = 102

 Score = 63.5 bits (153), Expect = 1e-11
 Identities = 42/75 (56%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = -2

Query: 2066 KIKSVASSNLSSIILCIPSVSHLRTLPYFLRGFL----SFSDQQPWK*SVKTNEFLKYQS 1899
            ++KSVASSNLSS IL  PS  H RTLP F  GFL    SF  QQ       T+EFLKYQS
Sbjct: 29   RMKSVASSNLSSSILFNPSELHFRTLPNFFLGFLFSAPSF-PQQVCPALANTSEFLKYQS 87

Query: 1898 PRDSSNDGTIGFKEL 1854
             +DSS  GT G   L
Sbjct: 88   AKDSSTRGTNGLNGL 102

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
            Anc_8.607 YPL116W
          Length = 674

 Score = 69.7 bits (169), Expect = 1e-11
 Identities = 82/347 (23%), Positives = 143/347 (41%), Gaps = 59/347 (17%)
 Frame = +1

Query: 424  EKMTREEL-LSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEG----RVKN-ALAIV 585
            EK+ + E+ +  +     +YL++ +  + + S G       ++ EG     V N A  ++
Sbjct: 129  EKLAKGEIEVPDSWNSGDIYLSSKTIEALQGSIGALETGVDSIFEGPSPEHVSNRAFVVI 188

Query: 586  RPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ------- 744
            RPPGHH       GFCL +N  V+ +    TY   +   +++D+D+HHG+GTQ       
Sbjct: 189  RPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--GITHAVVLDFDLHHGDGTQDICWKRA 246

Query: 745  ------------------KAFYEDDNVLYISLHRFELGKFYPGF-PEGNYDKVGDGKGKG 867
                              K F E   V Y S+H         G+  + N          G
Sbjct: 247  GFRPDEQDENTGGYDEFGKKFAEFPRVGYFSMHDINSFPTESGYATKDNIKSASTCIMNG 306

Query: 868  FNCNI------TWPVKGVGDVEY------IWA-----FEQIVIPMAREFR--PDLVIVSS 990
             + NI       W  +   +  Y      ++A     F+   I M+ + +    LV++S+
Sbjct: 307  HDLNIWNVHLSAWETEEDFNKLYQSKYRTLFAKADEFFKNAKIEMSAKGKKFKGLVVISA 366

Query: 991  GFDAAHGDTIGQ----CHVTPNCYGYMTHMLKSLAR----GNLCVVLEGGYNLDSISNSA 1146
            GFDA+  + +       +V  N Y   T     LA+    G +  VLEGGY+  +I++  
Sbjct: 367  GFDASEFEQVSMQRHGVNVPTNFYTMFTKDALKLAQMHSEGKVLSVLEGGYSDKAITSGV 426

Query: 1147 LAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 1287
             A    LIG     +   +   + G  +++ +++R     WK ++ K
Sbjct: 427  FA---HLIG-----LQNQNWIKEWGSEQVVKEIVRGCKPNWKPYKSK 465

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
            similar to uniprot|Q02959 Saccharomyces cerevisiae
            YPL116W HOS3 Trichostatin A-insensitive homodimeric
            histone deacetylase (HDAC)
          Length = 705

 Score = 69.3 bits (168), Expect = 2e-11
 Identities = 87/372 (23%), Positives = 148/372 (39%), Gaps = 66/372 (17%)
 Frame = +1

Query: 370  EEILDVH----TEEHMQFLESTEKMTRE---ELLSKTEKGDSVYLNNDSYISARLSCGGA 528
            + +L VH     +E ++  ++++K   +   E+      GD +YL+  +  +   S G  
Sbjct: 107  DHVLKVHGSDWPQELLKLCKNSQKALDQCQVEVPESWNVGD-IYLSRQTISALEGSIGAL 165

Query: 529  IEACKAV-----VEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESV 693
                 ++     VE     A   +RPPGHH+      GFCL +N  +A +    TY   V
Sbjct: 166  ETGVDSIFHGPSVEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GV 223

Query: 694  RKILIVDWDIHHGNGTQ-----KAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGD-- 852
               +++D+D+HHG+GTQ     +A ++ D          E GK +  FP+  Y  + D  
Sbjct: 224  THAVVLDFDLHHGDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDIN 283

Query: 853  ------GKGKGFNC-NITWPVKGVGDV--------------------------------E 915
                  G     N  N    +    DV                                E
Sbjct: 284  SFPTELGYATKENVRNAATCIMDAHDVNIWNVHLQSYDSDEAFTKLYQTKYRTLFAKADE 343

Query: 916  YIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQ----CHVTPNCYGYMTHMLKSLA 1083
            Y    +Q +  + + F+  LV++S+GFDA+  +         +V    Y   T     LA
Sbjct: 344  YFRTAKQNMRALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKLA 402

Query: 1084 R----GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIR 1251
            +    G L  VLEGGY+  +IS+   A    LIG     +   +   + G  +++ +++R
Sbjct: 403  QMHSHGKLLSVLEGGYSDGAISSGVFA---HLIG-----LQNQNWINEWGSAQVVKEIVR 454

Query: 1252 VQSKYWKCFRRK 1287
                 WK ++ K
Sbjct: 455  GCKPQWKPYKTK 466

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar to
            uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
            Putative class I histone deacetylase (HDAC) with sequence
            similarity to Hda1p, Rpd3p, Hos2p, and Hos3p; deletion
            results in increased histone acetylation at rDNA repeats;
            interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 67.4 bits (163), Expect = 5e-11
 Identities = 44/177 (24%), Positives = 85/177 (48%), Gaps = 2/177 (1%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 777
            HHA    A GFC  +++ +  +S+ +   +  +++  +D+D+H+G+G  KAF   +NV  
Sbjct: 193  HHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAKAFRFSENVQT 249

Query: 778  ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPV-KGVGDVEYIWAFEQIVIPMA 954
            IS+H +E G F+PG   G+ ++  + K       +  PV  G+ D   +     ++ P+ 
Sbjct: 250  ISVHLYEPG-FFPG--TGSLEETRNSKQM-----VNLPVLHGMDDKYLLELISSVITPLI 301

Query: 955  REFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVL-EGGYN 1122
              F  + +++  G D   GD   +  ++     +    +  + R     +L  GGYN
Sbjct: 302  ETFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLLGGGGYN 358

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
            Anc_3.362 YPR068C
          Length = 494

 Score = 67.4 bits (163), Expect = 6e-11
 Identities = 78/292 (26%), Positives = 121/292 (41%), Gaps = 28/292 (9%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPES--VRKILIVDWDIHHGNGTQKAFYEDDNV 771
            HHA    A GFC  +++      + KT  +    RK+  +D D+HHG+G + AF    ++
Sbjct: 206  HHAMKSRANGFCYINDIVSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKDI 265

Query: 772  LYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIP 948
              IS+H FE G FYP      +     GK K  N  I  PVK G+ +         I+IP
Sbjct: 266  QIISIHLFEPG-FYPCTGGLKF-----GKPKSNNI-INLPVKHGLSNSNMFELVTNIIIP 318

Query: 949  MAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLAR----------GNLC 1098
            +    + D +++  G D  + D   +  +T    G    ++K +A            N+ 
Sbjct: 319  LIELHQSDDIVILCGGDGLNNDYYNEWQLT--IIGLTRCIIKIIAAFVGPHQPGSCKNVV 376

Query: 1099 VVLEGGYN--LDSISNSALAVAKI-LIGEPPD-------EIPESDRDPKPGVL-----EM 1233
            ++  GGYN  L S   + L    + L G  P        E+P    D K   L     E 
Sbjct: 377  LLGGGGYNELLASRFYTYLTYKVLQLAGRIPPAATTLAAEVPHGTIDDKDKELLIKDHEH 436

Query: 1234 INKVIRVQSKYWKCFRRKFGNFGGEYENAIESQIPKMFPLQDAIRNAQLSHY 1389
            I++  +   KYW C+  + G  G  ++  I     K  P    I   + +HY
Sbjct: 437  IDEYEKEYYKYW-CYEIENGLDGLSFKRQINYNDTKQKPFTKYIAELR-AHY 486

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
            YPR068C
          Length = 456

 Score = 67.0 bits (162), Expect = 7e-11
 Identities = 55/231 (23%), Positives = 108/231 (46%), Gaps = 4/231 (1%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 777
            HHA    A GFC  +++ +  + + K   +   K+  +D+D+HHG+G ++AF     V  
Sbjct: 206  HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 778  ISLHRFELGKFYP--GFPEGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIP 948
            ISLH +E G F+P  G  EG+          GF+  +  P++ G+ D       +Q+V P
Sbjct: 263  ISLHLYEPG-FFPCTGSLEGS---------SGFD-TVNLPLQHGLTDSFLQGLVDQVVNP 311

Query: 949  MAREFRPDLVIVSSGFDAAHGDTIGQCHVT-PNCYGYMTHMLKSLARGNLCVVLEGGYNL 1125
            + +   P+++++  G D   GDT  +  ++       +  ++    + ++ ++  GGYN 
Sbjct: 312  LIQRHGPEVIVIQCGGDGLLGDTFHEWQLSIRGLTKCILDVMSHSTQAHVILLGGGGYNP 371

Query: 1126 DSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCF 1278
              +S     +   ++ +        + DP PG+     + +    KY +C+
Sbjct: 372  TLMSRFYTYLTGRILHQ------FKNTDPFPGMNGAQEESLIRDHKYIECY 416

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
            YPL116W
          Length = 700

 Score = 67.4 bits (163), Expect = 8e-11
 Identities = 84/352 (23%), Positives = 145/352 (41%), Gaps = 61/352 (17%)
 Frame = +1

Query: 415  ESTEKMTREEL-LSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEG----RVKN-AL 576
            E+ EK+ + E+ + ++     +YL++ +  + + + G       ++ +G     + N A 
Sbjct: 126  EADEKLAKGEIEVPESWNAGDIYLSSKTIQALQGTIGALETGVDSIFKGPSADHISNRAF 185

Query: 577  AIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ---- 744
              +RPPGHH       GFCL +N  VA +    TY   V  + ++D+D+HHG+GTQ    
Sbjct: 186  VAIRPPGHHCHFATPSGFCLLNNAHVAIEYAADTY--GVTHVAVLDFDLHHGDGTQDLCW 243

Query: 745  --KAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG----KGFNC-----NITWP 891
                F  D+++        + GK +  FP+  Y  + D        GF       N +  
Sbjct: 244  KRAGFKPDEDINPKEGEYDDFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTC 303

Query: 892  VKGVGDVEYIW------------------------------AFEQIVIPMAREFRP--DL 975
            +    D+  IW                               F+   + MA   RP   +
Sbjct: 304  LMNSHDLN-IWNIHMSNWNNEEEFVKLYRSKYRVLFAKADEYFKTAKLEMAALGRPFKGM 362

Query: 976  VIVSSGFDAAHGD-TIGQCH---VTPNCYGYMTHMLKSLA----RGNLCVVLEGGYNLDS 1131
            V++S+GFDA+  + T  Q H   V    Y   T     LA    +G +  ++EGGY+  +
Sbjct: 363  VLISAGFDASEFEQTTMQRHGSNVPTEFYTMFTKDALKLAQMHCQGKVLSLMEGGYSDKA 422

Query: 1132 ISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 1287
            I++   A    LIG     +   D   + G   +I +++R     WK ++ K
Sbjct: 423  ITSGVFA---HLIG-----LQNQDWIKEWGSEHVIKEIVRGCKPAWKPYKTK 466

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
            Ashbya gossypii ADL339W
          Length = 445

 Score = 66.6 bits (161), Expect = 9e-11
 Identities = 50/183 (27%), Positives = 82/183 (44%), Gaps = 8/183 (4%)
 Frame = +1

Query: 598  HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 777
            HHA    A GFC  +++ +  + + K       ++  VD+D+HHG+  + AF    NV  
Sbjct: 195  HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 778  ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVK-----GVGDVEYIWAFEQIV 942
             SLH FE G F+P            G G   NC  T  V      G+ D       + I+
Sbjct: 252  CSLHLFEAG-FFP------------GTGSFKNCRETNVVNIPLFHGLDDESLDEIVDNIL 298

Query: 943  IPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSL---ARGNLCVVLEG 1113
            IP   +  P+++++  G D   GD   +  +T   +G   ++LK +   +   + ++  G
Sbjct: 299  IPCVNKHDPEVLVIQCGADGLSGDKYKEWQLT--IHGLTRNILKLVDIHSYKKVVLLGGG 356

Query: 1114 GYN 1122
            GYN
Sbjct: 357  GYN 359

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
            YPL116W (REAL)
          Length = 697

 Score = 66.6 bits (161), Expect = 1e-10
 Identities = 88/367 (23%), Positives = 143/367 (38%), Gaps = 63/367 (17%)
 Frame = +1

Query: 376  ILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG-----GAIEA- 537
            +L VH       L    +M   +LL    +    + + D Y+S++         GAIE  
Sbjct: 110  VLKVHGSHWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 538  CKAVVEG----RVKN-ALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 702
              ++ EG     + N A   +RPPGHH       GFCL +N  VA +    TY  +V  +
Sbjct: 170  VDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NVTHV 227

Query: 703  LIVDWDIHHGNGTQ------------------------KAFYEDDNVLYISLHRFELGKF 810
            +++D+D+HHG+GTQ                        K F E   V Y S+H       
Sbjct: 228  VVLDFDLHHGDGTQDICWKRAGFKPEEEPENSSYDEFDKKFAEFPKVGYFSMHDINSFPT 287

Query: 811  YPGF-PEGNYDKVGDGKGKGFNCNI------TWPVKGVGDVEYIWAFEQIVIPMAREFR- 966
              GF  + N            + NI       W  +   ++ Y   +  +       FR 
Sbjct: 288  ESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADEFFRS 347

Query: 967  ------------PDLVIVSSGFDAAHGD-TIGQCH---VTPNCYGYMTHMLKSLAR---- 1086
                          LV++S+GFDA+  + T  Q H   V  + Y   T     LA+    
Sbjct: 348  AKQEMNQNEKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHCH 407

Query: 1087 GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKY 1266
            G +  ++EGGY+  +I +   A    LIG     +   D   + G  +++ +++R     
Sbjct: 408  GKVLSLMEGGYSDKAICSGVFA---HLIG-----LQNQDWVKEWGSEQVVKEIVRGCKPA 459

Query: 1267 WKCFRRK 1287
            WK ++ +
Sbjct: 460  WKPYKTR 466

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 75/294 (25%), Positives = 120/294 (40%), Gaps = 55/294 (18%)
 Frame = +1

Query: 571  ALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-- 744
            A   +RPPGHH+      GFCL +N  +A +     Y   V    I+D+D+HHG+GTQ  
Sbjct: 184  AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQDI 241

Query: 745  ---KAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGD------GKGKGFNCNITWPVK 897
               +A ++ D+    +    + GK +  FP+  Y  + D       +G     +I     
Sbjct: 242  CWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDINSFPTEQGYAHKTSIKDASV 301

Query: 898  GVGDVE-------YIWAFE-------------QIVIPMAREF--------------RPDL 975
             + D         ++ A+E             + +   A EF                 L
Sbjct: 302  CIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKADEFLRVSQKRMASEGKNYKGL 361

Query: 976  VIVSSGFDAAHGDTIGQ----CHVTPNCYGYMTHMLKSLA----RGNLCVVLEGGYNLDS 1131
            +I+S+GFDA+  + +       HV  + Y   T     LA    +G L  +LEGGY    
Sbjct: 362  IIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKLAQMHTQGKLLSLLEGGY---- 417

Query: 1132 ISNSAL--AVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 1287
             S++AL   V   LIG     +   +  P+ G  ++I +V R     WK ++ K
Sbjct: 418  -SDAALVSGVFSHLIG-----MQNQNWIPEWGSAQVIKEVCRGCRPNWKAYKTK 465

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
            (REAL)
          Length = 699

 Score = 65.9 bits (159), Expect = 2e-10
 Identities = 85/367 (23%), Positives = 140/367 (38%), Gaps = 63/367 (17%)
 Frame = +1

Query: 376  ILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARL--SCGGAIEACKAV 549
            +L VH       L    +M   +LL    +    + + D Y+S++   +  G I A +  
Sbjct: 110  VLKVHGSHWPTELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIQALQGTIGAIETG 169

Query: 550  VEGRVKN---------ALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 702
            V+   K          A   +RPPGHH       GFCL +N  VA +    TY   V  +
Sbjct: 170  VDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DVTHV 227

Query: 703  LIVDWDIHHGNGTQ------------------------KAFYEDDNVLYISLHRFELGKF 810
            +++D+D+HHG+GTQ                        K F E   V Y S+H       
Sbjct: 228  VVLDFDLHHGDGTQDICWKRAGFKPEEESENSSYDNFGKKFAEFPKVGYFSMHDINSFPT 287

Query: 811  YPGF-PEGNYDKVGDGKGKGFNCNI------TWPVKGVGDVEYIWAFEQIVIPMAREFR- 966
              GF  + N            + NI       W  +   ++ Y   +  +       F+ 
Sbjct: 288  ESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEDFNILYRTKYRTLFAKADEFFKT 347

Query: 967  ------------PDLVIVSSGFDAAHGD-TIGQCH---VTPNCYGYMTHMLKSLAR---- 1086
                          LV++S+GFDA+  + T  Q H   V  + Y   T     LA+    
Sbjct: 348  AKLEMNQQEKTFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMHCH 407

Query: 1087 GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKY 1266
            G +  ++EGGY+  +I +   A    LIG     +   D   + G  +++ +++R     
Sbjct: 408  GKVLSLMEGGYSDKAICSGVFA---HLIG-----LQNQDWVKEWGSEQVVKEIVRGCKST 459

Query: 1267 WKCFRRK 1287
            WK ++ +
Sbjct: 460  WKPYKTR 466

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
            YPL116W
          Length = 677

 Score = 65.1 bits (157), Expect = 4e-10
 Identities = 84/349 (24%), Positives = 142/349 (40%), Gaps = 61/349 (17%)
 Frame = +1

Query: 424  EKMTREEL-LSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEG----RVKNAL-AIV 585
            EK+ R E+ + K      +YL++ +  + R + G        +  G     + N +  +V
Sbjct: 128  EKLARGEIEVPKEWNAGDIYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVVV 187

Query: 586  RPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-----KA 750
            RPPGHH       GFCL +N  ++ +    TY   V    I+D+D+HHG+GTQ     +A
Sbjct: 188  RPPGHHCHVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQDICWKRA 245

Query: 751  FYEDDNVLYISLHR--FELGKFYPGFPEGNYDKVGD------GKGKGFNCNITWPVKGVG 906
             ++ D            + GK    FP+  Y  + D        G   + NI      + 
Sbjct: 246  GFKPDGATREENEEPYDDFGKRTAAFPKVGYFSMHDINSFPTESGYATSENIRNASTCIM 305

Query: 907  DVEYI---------WAFEQIVIPMAR-EFR------------------------PDLVIV 984
            D   +         WA E+  + + R ++R                          LV++
Sbjct: 306  DSHDLNIWNVHLAPWATEEDFMKLYRSKYRTLFAKADEYFKTARLEMQKQGTPFKGLVVI 365

Query: 985  SSGFDAAHGD-TIGQCH---VTPNCYGYMTHMLKSLA----RGNLCVVLEGGYNLDSISN 1140
            S+GFDA+  + T  Q H   V    Y   T  +  LA    +G +  V+EGGY+  +I++
Sbjct: 366  SAGFDASEFEQTSMQRHSVNVPTEFYTLFTKDVLKLAQMHTQGKVLSVMEGGYSDKAITS 425

Query: 1141 SALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 1287
               A    LIG     +   D   + G  +++ +++R     WK ++ K
Sbjct: 426  GVFA---HLIG-----LQNQDWIREWGSEQVVKEIVRGCKPNWKPYKTK 466

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 65.1 bits (157), Expect = 4e-10
 Identities = 45/162 (27%), Positives = 75/162 (46%), Gaps = 16/162 (9%)
 Frame = +1

Query: 415 ESTEKMTRE--ELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGR-----VKNA 573
           +S+EK+  +  E+      GD +YL+  +  +   S G       ++ +G         A
Sbjct: 127 QSSEKLAHKQVEVPDDWNVGD-IYLSQQTIAALEGSIGALETGIDSIFQGSSQEDIANRA 185

Query: 574 LAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAF 753
              VRPPGHH+      GFCL +N  +A +    T+  +V   +++D+D+HHG+GTQ   
Sbjct: 186 FVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADTF--NVTHAVVLDFDLHHGDGTQDIC 243

Query: 754 Y---------EDDNVLYISLHRFELGKFYPGFPEGNYDKVGD 852
           +         +DD+  Y      E GK +  FP+  Y  + D
Sbjct: 244 WKRAGFNPDEQDDDPAY-----DEFGKKFAEFPKVGYFSMHD 280

 Score = 32.7 bits (73), Expect = 4.2
 Identities = 32/118 (27%), Positives = 53/118 (44%), Gaps = 13/118 (11%)
 Frame = +1

Query: 973  LVIVSSGFDAA---------HGDTIGQCHVTPNCYGYMTHMLKSLAR----GNLCVVLEG 1113
            LV++S+GFDA+         HG  +  C      Y   T     LA+    G +  V+EG
Sbjct: 361  LVVISAGFDASEYEQPSMQRHGVNVPTCF-----YNMFTKDALKLAQMHTSGKVLSVMEG 415

Query: 1114 GYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 1287
            GY+  +IS+    V   LIG     +   +   + G  +++ ++IR     WK ++ K
Sbjct: 416  GYSDGAISS---GVFSHLIG-----LQNQNWINEWGSAQVVKEIIRGCKPQWKPYKTK 465

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 65.1 bits (157), Expect = 4e-10
 Identities = 43/163 (26%), Positives = 71/163 (43%), Gaps = 8/163 (4%)
 Frame = +1

Query: 397 EHMQFLESTEKMTREELLSKTEKGDS--VYLNNDSYISARLSCGGAIEACKAVVEGR--- 561
           E ++     +   RE  L   E  ++  +YLN+D+ ++ + S G       ++  G    
Sbjct: 120 EVIRLCHEADSKLREGKLEVPESWNAGDIYLNSDTIMALKGSIGAIETGVDSIFNGPSPE 179

Query: 562 --VKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGN 735
                A   +RPPGHH       GFCL +N ++  +    TY   V  ++++D+D+HHG+
Sbjct: 180 HICNRAFVAIRPPGHHCHVGMPSGFCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGD 237

Query: 736 GTQKAFYEDDNVLYISLHRFELGKFYPGF-PEGNYDKVGDGKG 861
           GTQ   ++                   GF P+GNY    D  G
Sbjct: 238 GTQDICWK-----------------RAGFKPDGNYIDEADSTG 263

 Score = 34.7 bits (78), Expect = 1.1
 Identities = 33/130 (25%), Positives = 60/130 (46%), Gaps = 10/130 (7%)
 Frame = +1

Query: 928  FEQIVIPMAREFRP--DLVIVSSGFDAAHGDTIG----QCHVTPNCYGYMTHMLKSLAR- 1086
            F+   + MA   +P   LV++SSGFDA+  + +       +V    Y   T     LA+ 
Sbjct: 348  FKAAKLEMASMGKPYKGLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKLAQM 407

Query: 1087 ---GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQ 1257
               G +  ++EGGY+  +I++   A    LIG     +   D   + G  +++ +++R  
Sbjct: 408  HCHGKVISIMEGGYSDKAITSGVFA---HLIG-----LQNQDWIKEWGSEQVVKEIVRGC 459

Query: 1258 SKYWKCFRRK 1287
               WK ++ K
Sbjct: 460  KPTWKPYKTK 469

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] {ON}
            Anc_8.607 YPL116W
          Length = 694

 Score = 64.3 bits (155), Expect = 7e-10
 Identities = 72/293 (24%), Positives = 122/293 (41%), Gaps = 54/293 (18%)
 Frame = +1

Query: 571  ALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-- 744
            A   +RPPGHH +     GFCL +N  ++ +     Y   +   +I+D+D+HHG+GTQ  
Sbjct: 187  AFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDI 244

Query: 745  ---KAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG------------------ 861
               +A +  ++    S    + GK +  FP+  Y  + D                     
Sbjct: 245  CWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFSMHDINSFPTETGYATKVNIRNAST 304

Query: 862  ---KGFNCNITW-----PVKGVGDVEYIWA-------------FEQIVIPMAREFRP--D 972
                G + NI W     P     D + ++              F      MA+E +P   
Sbjct: 305  CIMDGHDLNI-WNIHLSPWNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFKG 363

Query: 973  LVIVSSGFDAA-HGDTIGQCH---VTPNCYGYMTHMLKSLA----RGNLCVVLEGGYNLD 1128
            LV++S+GFDA+ +  T  Q H   V  N Y   T     LA    +G +  +LEGGY+  
Sbjct: 364  LVVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYSDK 423

Query: 1129 SISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 1287
            ++++   A    LIG         +   + G  +++ +++R    +WK ++ K
Sbjct: 424  ALTSGVFA---HLIG-----FQNQNWINEWGSEQVVKEIVRGCKPHWKPYKTK 468

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
            (REAL)
          Length = 697

 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 78/349 (22%), Positives = 137/349 (39%), Gaps = 58/349 (16%)
 Frame = +1

Query: 415  ESTEKMTREEL-LSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEG----RVKN-AL 576
            E+  K+ + E+ +  T     +YL++ +  + + + G       ++ +G     + N A 
Sbjct: 128  EADSKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETGVDSIFKGPSPEHISNRAF 187

Query: 577  AIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ---- 744
              +RPPGHH       GFCL +N  VA +     Y  +V  ++++D+D+HHG+GTQ    
Sbjct: 188  VAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NVTHVVVLDFDLHHGDGTQDICW 245

Query: 745  --------------------KAFYEDDNVLYISLHRFELGKFYPGF-PEGNYDKVGDGKG 861
                                K F E   V Y S+H         GF  + N         
Sbjct: 246  KRAGFKPEEEAKDTSYDDFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTCIM 305

Query: 862  KGFNCNI------TWPVKGVGDVEYIWAFEQIVIPMAREFR-------------PDLVIV 984
               + NI       W  +   ++ Y   +  +       F+               LV++
Sbjct: 306  NSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADEFFKSAKVEMKQQGKSFEGLVVI 365

Query: 985  SSGFDAAHGD-TIGQCH-VTPNCYGYMTHMLKSL------ARGNLCVVLEGGYNLDSISN 1140
            S+GFDA+  + T  Q H V    Y Y T    +L        G +  ++EGGY+  +I +
Sbjct: 366  SAGFDASEFEQTSMQRHSVNVPTYFYTTFTKDALKLAQMHCHGKVLSLMEGGYSDKAICS 425

Query: 1141 SALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 1287
               A    LIG     +   D   + G  +++ +++R     WK ++ +
Sbjct: 426  GVFA---HLIG-----LQNQDWVNEWGSEQVVKEIVRGCKPAWKPYKTR 466

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
            similar to uniprot|Q02959 Saccharomyces cerevisiae
            YPL116W HOS3 Trichostatin A-insensitive homodimeric
            histone deacetylase (HDAC)
          Length = 668

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 84/341 (24%), Positives = 136/341 (39%), Gaps = 59/341 (17%)
 Frame = +1

Query: 442  ELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEG----RVKN-ALAIVRPPGHHA 606
            E+ +    GD +YL++ +  + + S G    A  ++ +G     + N A   +RPPGHH 
Sbjct: 135  EVPASWNAGD-IYLSSKTVEALQGSIGALETAVDSIFDGPSPEHISNRAFVAIRPPGHHC 193

Query: 607  EPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-----KAFYEDDNV 771
                  GFCL +N  VA +     +   V    I+D+D+HHG+GTQ     +A +  D  
Sbjct: 194  HVATPSGFCLLNNAHVAIEYAKDRF--GVTHAAILDFDLHHGDGTQDICWKRAGFRPDEE 251

Query: 772  LYISLHRFELGKFYPGFPEGNYDKVGD--------GKGKGFNC-NITWPVKGVGDVEYIW 924
               S      GK +  +P   Y  + D        G     N  N +  +    DV  IW
Sbjct: 252  DEDSPGYDSFGKKFAEYPRVGYFSMHDINSFPTESGYATKENVKNASTCIMNAHDVN-IW 310

Query: 925  ------------------------------AFEQIVIPMAREFRP--DLVIVSSGFDAAH 1008
                                           F+Q  I MA + +P   LV++SSGFDA+ 
Sbjct: 311  NIHLSPWETEEDFAKLYHTKYRSLFVKADEFFKQGKIEMAAQNKPFKGLVVISSGFDASE 370

Query: 1009 GD-TIGQCHVTPNCYGYMTHMLKSLAR-------GNLCVVLEGGYNLDSISNSALAVAKI 1164
             + T  Q H T     + T   K   +       G +  ++EGGY+  +I +   A    
Sbjct: 371  FEQTSMQRHGTNVPTYFYTAFTKDALKLSQMHCHGKVLSIMEGGYSDKAIVSGVFA---H 427

Query: 1165 LIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 1287
            LIG     +   +   + G   ++ +++R     WK ++ K
Sbjct: 428  LIG-----LQNQNWIKEWGSEHVVKEIVRGCKSNWKPYKTK 463

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
            similar to uniprot|Q02959 Saccharomyces cerevisiae
            YPL116W HOS3 Trichostatin A-insensitive homodimeric
            histone deacetylase (HDAC)
          Length = 715

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 88/377 (23%), Positives = 151/377 (40%), Gaps = 73/377 (19%)
 Frame = +1

Query: 376  ILDVHTEEHMQFL-----ESTEKMTREELLSKTE--KGDSVYLNNDSYISARLSCGGAIE 534
            +L VH ++  + L     ES +K+  EE+    +   GD +YL+  +  +   S G    
Sbjct: 107  VLKVHGKDWPRELLKLCKESEKKIDNEEVEVPPDWNVGD-IYLSKHTIAALEGSIGALEI 165

Query: 535  ACKAVVEG-----RVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 699
               ++ +G         A   +RPPGHH+      GFCL +N  +A +   + Y   V  
Sbjct: 166  GVDSIFQGVSVEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTH 223

Query: 700  ILIVDWDIHHGNGTQ-----KAFYEDDNVLYISLHRF--------ELGKFYPGFPEGNYD 840
             +I+D+D+HHG+GTQ     +A +  D     + H          E GK +  FP+  Y 
Sbjct: 224  AVILDFDLHHGDGTQDICWKRAGFRPDEFSTDAEHGASEDDNKYDEFGKSFAEFPKVGYF 283

Query: 841  KVGD--------GKGKGFNC-NITWPVKGVGDV--------------EYIWAFE---QIV 942
             + D        G     N  N +  +    D+              E++  ++   + +
Sbjct: 284  SLHDINSFPTELGYATKENIRNASTCIMDAHDINIWNVHLQSYKDEEEFVKLYQTKYRSI 343

Query: 943  IPMAREFRPD--------------LVIVSSGFDAAHGDTIG----QCHVTPNCYGYMTHM 1068
               A EF  +              LV++S+GFDA+  +         +V  + Y   T  
Sbjct: 344  FAKADEFFKNAKLEMKQGGFRFKGLVVISAGFDASEYEQQSMQRHNVNVPTSFYNLFTKD 403

Query: 1069 LKSLAR----GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMI 1236
               LA+    G +  V+EGGY+  +I   A  V   LIG         +   + G  +++
Sbjct: 404  ALKLAQMHSNGKIISVMEGGYSDGAI---ASGVFSHLIG-----FQNQNWISEWGSEQVV 455

Query: 1237 NKVIRVQSKYWKCFRRK 1287
             ++IR     WK ++ K
Sbjct: 456  KEIIRGCKPRWKPYKTK 472

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
            complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 62.8 bits (151), Expect = 2e-09
 Identities = 78/350 (22%), Positives = 140/350 (40%), Gaps = 59/350 (16%)
 Frame = +1

Query: 415  ESTEKMTREEL-LSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEG----RVKN-AL 576
            ++ EK+ + E+ +  +     +YL++ +  + + S G       ++  G     + N A 
Sbjct: 127  KADEKLAKGEIEVPASWNAGDIYLSSRTIEALQGSIGALETGVDSIFSGPSPDHISNRAF 186

Query: 577  AIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ---- 744
              +RPPGHH       GFCL +N  +A +    TY   +   +I+D+D+HHG+GTQ    
Sbjct: 187  VAIRPPGHHCHVDTPSGFCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDICW 244

Query: 745  -KAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG-------------------- 861
             +A +  +     +    E GK +  FP+  Y  + D                       
Sbjct: 245  KRAGFRTEAEPETTEGYDEFGKKFAEFPKVGYFSMHDINSFPTESQYATKENIRNASTCV 304

Query: 862  -KGFNCNI------TWPVKGVGDVEYIWAFEQIVIPMAREFR-------------PDLVI 981
                + NI       W  +   D  Y   +  +       FR               LV+
Sbjct: 305  MNAHDVNIWNIHLSPWETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQGLVV 364

Query: 982  VSSGFDAAHGD-TIGQCH---VTPNCYGYMTHMLKSLAR----GNLCVVLEGGYNLDSIS 1137
            +S+GFDA+  + T  Q H   V  + Y   T     L++    G +  ++EGGY+  +I 
Sbjct: 365  ISAGFDASEFEQTSMQRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYSDKAI- 423

Query: 1138 NSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 1287
              A  V   LIG     +   +   + G  +++ +++R    +WK ++ K
Sbjct: 424  --ASGVFSHLIG-----LQNQNWIKEWGSEQVVKEIVRGCKPHWKPYKTK 466

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
            YPL116W
          Length = 698

 Score = 60.8 bits (146), Expect = 9e-09
 Identities = 88/344 (25%), Positives = 136/344 (39%), Gaps = 62/344 (18%)
 Frame = +1

Query: 442  ELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEG----RVKN-ALAIVRPPGHHA 606
            E+      GD +YL++++  +   S G       ++  G     + N A   +RPPGHH 
Sbjct: 139  EVPDSWNSGD-IYLSSETIKAIEGSIGALELGLDSIFHGPSAEHISNRAFVAIRPPGHHC 197

Query: 607  EPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ------KAFYEDDN 768
                  GFCL +N  +A +   + Y   V   +I+D+D+HHG+GTQ        F  DD 
Sbjct: 198  HVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQDICWKRAGFKPDDG 255

Query: 769  VLYISLHRFE---LGKFYPGFPEGNYDKVGD------GKGKGFNCNITWPVKGVGDVEYI 921
             +     + E    GK    FP+  Y  + D        G     NI      V D   +
Sbjct: 256  NVQDDEDKNEYDDFGKKMADFPKVGYFSMHDINSFPTESGYATKDNIKNASTCVMDAHDL 315

Query: 922  ---------WAFEQ-----------IVIPMAREF------------RP--DLVIVSSGFD 999
                     WA E+            +   A EF            +P   LV++S+GFD
Sbjct: 316  NIWNVHLQTWATEEDFNKLYQTKYRTLFAKADEFFKNAKNQMQEMNKPFKGLVVISAGFD 375

Query: 1000 AAHGD-TIGQCH---VTPNCYGYMTHMLKSLAR----GNLCVVLEGGYNLDSISNSALAV 1155
            A+  + T  Q H   V  + Y   T     LA+    G +  VLEGGY+  +I   A  V
Sbjct: 376  ASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSVLEGGYSDKAI---ASGV 432

Query: 1156 AKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 1287
               LIG     +   +   + G  ++I +++R     W  ++ K
Sbjct: 433  FSHLIG-----LQNQNWIKEWGSEQVIKEIVRGCKPSWTPYKTK 471

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
            YPL116W (HOS3) - sequence similar to the histone
            deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 60.8 bits (146), Expect = 9e-09
 Identities = 69/293 (23%), Positives = 121/293 (41%), Gaps = 54/293 (18%)
 Frame = +1

Query: 571  ALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-- 744
            A   +RPPGHH+      GFCL +N  +A +    TY  +V   +++D+D+HHG+GTQ  
Sbjct: 187  AFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NVTHAVVLDFDLHHGDGTQDI 244

Query: 745  ---KAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGD--------GKGKGFNC-NITW 888
               +A ++ D     S    E GK +  +P+  Y  V D        G     N  N   
Sbjct: 245  CWKRAGFKPDECA-DSGEFDEFGKKFAEYPKVGYFSVHDINSFPTELGYATKENIRNAAT 303

Query: 889  PVKGVGDV--------------------------------EYIWAFEQIVIPMAREFRPD 972
             +    DV                                E+    +Q +  + + F+  
Sbjct: 304  CIMDAHDVNIWNVHLQPYDSEEAFTKLYQTKYRTLFAKADEFFRISKQTMKALGKPFK-G 362

Query: 973  LVIVSSGFDAAHGD--TIGQCHVTPNCYGYMTHMLKSL------ARGNLCVVLEGGYNLD 1128
            LV++S+GFDA+  +  ++ +  V    + Y T    +L      + G +  V+EGGY+  
Sbjct: 363  LVVISAGFDASEYEQPSMQRHAVNVPTFFYNTFTKDALKLAQMHSHGKVLSVMEGGYSDG 422

Query: 1129 SISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 1287
            +I++   A    LIG     +       + G  +++ +++R     WK ++ K
Sbjct: 423  AITSGVFA---HLIG-----LQNQSWINEWGSAQVVKEIVRGCKPNWKPYKTK 467

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
            similar to uniprot|Q02959 Saccharomyces cerevisiae
            YPL116w HOS3
          Length = 678

 Score = 58.9 bits (141), Expect = 3e-08
 Identities = 87/368 (23%), Positives = 147/368 (39%), Gaps = 64/368 (17%)
 Frame = +1

Query: 376  ILDVHTEEHMQFL-----ESTEKMTREEL-LSKTEKGDSVYLNNDSYISARLSCGGAIEA 537
            +L VH  E  + L     +S  K+ R E+ +        +YL + +  + + + G     
Sbjct: 106  VLKVHGSEWPRTLLQLCKQSDSKLARGEVEVPDNWNAGDIYLTSRTIEALQGTIGAVETG 165

Query: 538  CKAVVEG----RVKNALAI-VRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 702
              ++  G     + N + + +RPPGHH       GFCL +N  +  +     Y   V   
Sbjct: 166  VDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--GVTHA 223

Query: 703  LIVDWDIHHGNGTQ------------------------KAFYEDDNVLYISLHRFELGKF 810
            +I+D+D+HHG+GTQ                        K F E   V Y S+H       
Sbjct: 224  VILDFDLHHGDGTQDLCWKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSMHDINSFPT 283

Query: 811  YPGF-PEGNYDKVGDGKGKGFNCNITWPV---KGVGDVEYIWAFE---QIVIPMAREF-- 963
              GF  + N            + NI W V   +   + E+   ++   + +   A EF  
Sbjct: 284  ESGFATKENIKNASTCIMNSHDLNI-WNVHLSRWSTEEEFAKIYKSKYRTLFAKADEFFK 342

Query: 964  ----------RP--DLVIVSSGFDAAHGD-TIGQCH---VTPNCYGYMTHMLKSLA---- 1083
                      +P   LV++S+GFDA+  + T  Q H   V  + Y   T     LA    
Sbjct: 343  NSKNEMNELGKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQMHC 402

Query: 1084 RGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSK 1263
            +G +  +LEGGY+  +I++    V   LIG     +   D   + G  +++ +++R    
Sbjct: 403  QGKVLSLLEGGYSDKAITS---GVFSHLIG-----LQNQDWINEWGSEQVVKEIVRGCKP 454

Query: 1264 YWKCFRRK 1287
             WK ++ K
Sbjct: 455  SWKPYKTK 462

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 58.2 bits (139), Expect = 6e-08
 Identities = 41/147 (27%), Positives = 68/147 (46%), Gaps = 10/147 (6%)
 Frame = +1

Query: 442 ELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEG----RVKN-ALAIVRPPGHHA 606
           E+      GD +YL++ +  + + S G    A  ++ +G     + N A   +RPPGHH 
Sbjct: 137 EVPDSWNSGD-IYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHC 195

Query: 607 EPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-----KAFYEDDNV 771
                 GFC+ +N  VA +    +Y   V  + ++D+D+HHG+GTQ     +A ++ D  
Sbjct: 196 HFATPSGFCVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQDICWKRAGFKPDEE 253

Query: 772 LYISLHRFELGKFYPGFPEGNYDKVGD 852
              +      GK    FP   Y  + D
Sbjct: 254 TKENEEYDGFGKKLAEFPRVGYFSMHD 280

>Kwal_27.11536 s27 complement(839030..839617) [588 bp, 195 aa] {OFF}
           [contig 27] FULL
          Length = 195

 Score = 53.9 bits (128), Expect = 2e-07
 Identities = 34/100 (34%), Positives = 46/100 (46%)
 Frame = -1

Query: 402 MFLCMNVKNFFFCCFPHWNL*H*ITNI*NTCQRRXXXXXXXXXXXXXXIYSSWIFWMWVN 223
           M   M +++FF   FP  NL H I NI  + Q                + S  + WM ++
Sbjct: 1   MLRSMYLQDFFIRGFPSRNLEHKIPNIVYSAQCWIDDKPILGEDLVNPVNSPGVLWMRID 60

Query: 222 VLKI*CEYFCMVSHPDIVANTGFQWSIV*VRFLSWNYHRS 103
           + +I  E   MV H DIVA + F+W IV  R   WN H S
Sbjct: 61  IFEIRSENLGMVPHSDIVAQSSFEWGIVQFRSTRWNNHWS 100

>Kwal_27.11540 s27 complement(840674..841009) [336 bp, 111 aa] {OFF}
            [contig 27] FULL
          Length = 111

 Score = 45.8 bits (107), Expect = 2e-05
 Identities = 29/98 (29%), Positives = 48/98 (48%)
 Frame = -1

Query: 1794 MHNPRCCLSNTNKAQFL*RFNVLEMIIPK*DHNILR**I**IIISFKCGSRNINIDNSRF 1615
            M +   C+S  N+  F     +L++ +P  + N LR     I++ F  G RNI+++N+  
Sbjct: 1    MDHSTVCVSYANERNFAEARKILQVAVPDVNQNFLRSQDCRIVVLFVQGLRNIDVNNTVI 60

Query: 1614 SLNCPVYKFQRGIKYY*SRRIDNTSYYVSISPHFRRVM 1501
               CP+Y  Q  I     R I+ +     +SP FR V+
Sbjct: 61   PFGCPLYYIQGCIYDNGGRGINRSCSTTPLSPDFRCVV 98

>KNAG0B05980 Chr2 (1171306..1172601) [1296 bp, 431 aa] {ON} Anc_4.234
            YLR380W
          Length = 431

 Score = 32.7 bits (73), Expect = 3.7
 Identities = 22/89 (24%), Positives = 49/89 (55%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1492 VLLHDTP----EVWGNRDIITGIIDP--STSIIFDSSLKFINWAIERETAVIDINIPRSA 1653
            +L+H  P     +W   +II   +DP  ++ I+F  ++K ++  I ++   + +    +A
Sbjct: 282  LLIHKAPWLFSPIW---NIIKTWLDPVVASKIVFTKNIKELSRYIGQQELPVYMEGKNNA 338

Query: 1654 FEADNYSSNLLSQDVMISLWDNHFKYIES 1740
             + D+YS    SQD ++++ D++FK + +
Sbjct: 339  LDLDHYSPPDGSQDKLLNVKDDNFKKLST 367

>KLLA0C07579g Chr3 complement(662466..664325) [1860 bp, 619 aa] {ON}
            similar to uniprot|P40053 Saccharomyces cerevisiae
            YER080W FMP29 The authentic non-tagged protein was
            localized to the mitochondria
          Length = 619

 Score = 32.7 bits (73), Expect = 4.1
 Identities = 20/94 (21%), Positives = 49/94 (52%), Gaps = 7/94 (7%)
 Frame = +1

Query: 1798 LGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSL-------VFTDHFHGCWS 1956
            +G R  R+V K+++    +   K  V S+ +   + + K S         F  +  G W 
Sbjct: 4    IGSRCVRSVPKSSLRVSSTKIGKLFVRSVSDKPEEVFTKLSDENDPQRDAFFKYSWGTWL 63

Query: 1957 ENDKKPRKKYGRVLRCDTDGIHNIIEERFEEATD 2058
            +NDK+ ++K  R+ +   +G++++I++ ++++ +
Sbjct: 64   KNDKQEKEK--RITKFSLEGLNSVIDDLYKQSIE 95

>TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.61
            YOR172W
          Length = 799

 Score = 32.3 bits (72), Expect = 5.6
 Identities = 30/104 (28%), Positives = 54/104 (51%), Gaps = 1/104 (0%)
 Frame = +1

Query: 1462 SNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSS-LKFINWAIERETAVIDIN 1638
            + F K+KSL  L H T  +   ++I+  I D      FD S + + + A+++   + D+ 
Sbjct: 197  ATFSKSKSL--LYHITLNLPPYKEIVESIND-----FFDKSDIYYHSMALDKNKILSDL- 248

Query: 1639 IPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIG 1770
              ++ F  DN++  ++ Q ++I+ + NHFK    LE LC    G
Sbjct: 249  --KACFILDNFNEKVI-QIILINKF-NHFKVAVILEILCITHFG 288

>NCAS0C03190 Chr3 complement(626407..629391) [2985 bp, 994 aa] {ON}
            Anc_8.341
          Length = 994

 Score = 31.6 bits (70), Expect = 9.9
 Identities = 38/155 (24%), Positives = 59/155 (38%), Gaps = 14/155 (9%)
 Frame = +1

Query: 394  EEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNA 573
            EE    + S E+  R+EL  + E+G   Y + +  I                 +G V N 
Sbjct: 625  EEFSSLMTSEEEERRQELRKREEEGHVAYQSGNQIIIENR-------------QGEVINE 671

Query: 574  LAIVRPPGHHAEPQAAG--GFCLFSNVSVAAKSILKTY------PESVRKILIVDWDIHH 729
              + RPP    E   A    F L S VS  + + L         PE +R+++    D H 
Sbjct: 672  ADLDRPPRDEEESVGADSHNFSLASTVSRESSNSLHNLKRILSPPEKLRQVISQGSDKH- 730

Query: 730  GNGTQKAFYEDDNVLYIS------LHRFELGKFYP 816
                +   Y+ DN L I       L R+++   +P
Sbjct: 731  ---MKYRAYKMDNHLIIENEDGEVLRRYKINPHHP 762

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 186,782,354
Number of extensions: 4162862
Number of successful extensions: 12482
Number of sequences better than 10.0: 108
Number of HSP's gapped: 12264
Number of HSP's successfully gapped: 116
Length of query: 702
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 585
Effective length of database: 40,065,477
Effective search space: 23438304045
Effective search space used: 23438304045
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)