Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C033902.285ON70170136620.0
CAGL0J03454g2.285ON69366826700.0
Skud_14.3082.285ON70666826240.0
Smik_14.3102.285ON70666826230.0
Suva_14.3262.285ON70666826180.0
YNL021W (HDA1)2.285ON70666826150.0
NCAS0G038002.285ON72669126050.0
NDAI0G006502.285ON68966725970.0
ZYRO0A01870g2.285ON70770025860.0
TDEL0G021602.285ON71469425720.0
SAKL0E07700g2.285ON71266825470.0
KNAG0H020102.285ON69367025330.0
KAFR0H033202.285ON70267725280.0
KLTH0G10340g2.285ON70870225190.0
Kwal_27.115372.285ON70870924920.0
Kpol_1039.322.285ON65965524680.0
Ecym_33242.285ON70670924660.0
KLLA0E08383g2.285ON70470124600.0
ADL216C2.285ON70570624000.0
TBLA0B069502.285ON79543718670.0
Kpol_1003.372.285ON57830013441e-178
Kpol_246.58.153ON4533603632e-36
NCAS0B054808.153ON4513723623e-36
TPHA0H003208.153ON4503563604e-36
SAKL0H25124g8.153ON4483653596e-36
Ecym_23468.153ON4853643616e-36
KLLA0F09119g8.153ON4523593534e-35
KLTH0E06446g8.153ON4493533526e-35
AFR172C8.153ON4493573526e-35
TDEL0B045808.153ON4463573517e-35
KAFR0C029208.153ON4533563491e-34
Kwal_55.207908.153ON4493533491e-34
TBLA0D021408.153ON4563693473e-34
NDAI0B027108.153ON4533573447e-34
YGL194C (HOS2)8.153ON4523583402e-33
ZYRO0G19316g8.153ON4483643393e-33
Skud_7.798.153ON4523533393e-33
Suva_7.718.153ON4523523367e-33
Smik_7.798.153ON4523573332e-32
CAGL0A03322g8.153ON4503643261e-31
KNAG0G013508.153ON4513353217e-31
Suva_14.113.8ON4333293092e-29
Skud_14.113.8ON4333293048e-29
NDAI0G037403.8ON4333273022e-28
Kpol_1038.113.8ON4333283022e-28
KAFR0A086303.8ON4333282984e-28
KLTH0F19668g3.8ON4323272984e-28
KNAG0A011603.8ON4333272985e-28
CAGL0B01441g3.8ON4333272985e-28
Kwal_55.221423.8ON4323272985e-28
Smik_14.23.8ON4333292985e-28
YNL330C (RPD3)3.8ON4333292976e-28
AGR395W3.8ON4333492976e-28
TBLA0I005603.8ON4333282977e-28
NCAS0C043203.8ON4343272968e-28
Ecym_20103.8ON4333492968e-28
ZYRO0C03498g3.8ON4333282969e-28
TPHA0A003003.8ON4333282969e-28
SAKL0C13706g3.8ON4333282969e-28
KLLA0E01981g3.8ON4323272951e-27
TDEL0A002703.8ON4333272914e-27
TDEL0C050403.362ON4541812011e-15
Skud_16.3533.362ON4712141931e-14
Suva_16.3963.362ON4771771893e-14
Ecym_82908.607ON7093341904e-14
YPR068C (HOS1)3.362ON4701771868e-14
CAGL0D01430g3.362ON4452551832e-13
ZYRO0C16390g3.362ON4361801822e-13
NDAI0A051203.362ON5082421823e-13
KLTH0F10582g3.362ON4742221805e-13
NCAS0A111803.362ON4902021796e-13
SAKL0B07854g3.362ON4892301796e-13
ADL339W3.362ON4372601786e-13
Kwal_23.37243.362ON4732031787e-13
Smik_16.3093.362ON4701771787e-13
KAFR0H008903.362ON4742101788e-13
TBLA0B023903.362ON5791781798e-13
Kpol_376.153.362ON5182041691e-11
TDEL0A055208.607ON6743311691e-11
YPL116W (HOS3)8.607ON6973321691e-11
KLTH0D09592g8.607ON7053311682e-11
NCAS0C017608.607ON7003521664e-11
KNAG0H006303.362ON4562341644e-11
Smik_6.3158.607ON6973321655e-11
KNAG0J013008.607ON6773491636e-11
ADL265W8.607ON6942941637e-11
KLLA0B09394g3.362ON4411771618e-11
SAKL0H08338g8.607ON6903791628e-11
Suva_16.1948.607ON6993321602e-10
TBLA0E040808.607ON6942941602e-10
TPHA0M015903.362ON4942931563e-10
Ecym_34653.362ON4451831564e-10
KAFR0H027908.607ON7171351557e-10
ZYRO0F10780g8.607ON6683411521e-09
Skud_16.1648.607ON6973501522e-09
KLLA0F00858g8.607ON7153071512e-09
TPHA0A011208.607ON6982961502e-09
Kpol_479.68.607ON6883471493e-09
Kwal_26.85058.607ON7082931484e-09
CAGL0J06974g8.607ON6783681422e-08
NDAI0E024808.607ON6843301413e-08
KNAG0B059804.234ON43190715.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C03390
         (701 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...  1415   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1033   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1015   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1014   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1013   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1011   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1008   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1004   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1000   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...   995   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...   985   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...   980   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...   978   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...   974   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...   964   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...   955   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...   954   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...   952   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...   929   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   723   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   522   e-178
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   144   2e-36
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   144   3e-36
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   143   4e-36
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   142   6e-36
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   143   6e-36
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   140   4e-35
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   140   6e-35
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   140   6e-35
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   139   7e-35
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   139   1e-34
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   139   1e-34
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   138   3e-34
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    137   7e-34
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   135   2e-33
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   135   3e-33
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   135   3e-33
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   134   7e-33
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   132   2e-32
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   130   1e-31
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   128   7e-31
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   123   2e-29
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   121   8e-29
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   120   2e-28
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   120   2e-28
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   119   4e-28
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   119   4e-28
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   119   5e-28
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   119   5e-28
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   119   5e-28
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   119   5e-28
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   119   6e-28
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   119   6e-28
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   119   7e-28
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      118   8e-28
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   118   8e-28
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   118   9e-28
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   118   9e-28
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   118   9e-28
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   118   1e-27
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   116   4e-27
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    82   1e-15
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    79   1e-14
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    77   3e-14
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    78   4e-14
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    76   8e-14
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    75   2e-13
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    75   2e-13
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    75   3e-13
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    74   5e-13
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    74   6e-13
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    74   6e-13
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    73   6e-13
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    73   7e-13
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    73   7e-13
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    73   8e-13
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    74   8e-13
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    70   1e-11
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    70   1e-11
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    70   1e-11
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    69   2e-11
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    69   4e-11
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    68   4e-11
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    68   5e-11
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    67   6e-11
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    67   7e-11
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    67   8e-11
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    67   8e-11
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    66   2e-10
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    66   2e-10
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    65   3e-10
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    65   4e-10
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    64   7e-10
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    63   1e-09
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    63   2e-09
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    63   2e-09
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    62   2e-09
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    62   3e-09
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    62   4e-09
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    59   2e-08
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    59   3e-08
KNAG0B05980 Chr2 (1171306..1172601) [1296 bp, 431 aa] {ON} Anc_4...    32   5.9  

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score = 1415 bits (3662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 685/701 (97%), Positives = 685/701 (97%)

Query: 1   MSEQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVR 60
           MSEQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVR
Sbjct: 1   MSEQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVR 60

Query: 61  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVRE 120
           MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVRE
Sbjct: 61  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVRE 120

Query: 121 ATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEAC 180
           ATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEAC
Sbjct: 121 ATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEAC 180

Query: 181 KAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWD 240
           KAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWD
Sbjct: 181 KAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWD 240

Query: 241 IHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKG 300
           IHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKG
Sbjct: 241 IHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKG 300

Query: 301 VGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSL 360
           VGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSL
Sbjct: 301 VGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSL 360

Query: 361 ARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQS 420
           ARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQS
Sbjct: 361 ARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQS 420

Query: 421 KYWKCFRRKFGNFGGEYENAIESQIPKMFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXX 480
           KYWKCFRRKFGNFGGEYENAIESQIPKMFPLQDAIRNAQLSHYYDDFGM           
Sbjct: 421 KYWKCFRRKFGNFGGEYENAIESQIPKMFPLQDAIRNAQLSHYYDDFGMISLSLPNLNLP 480

Query: 481 XXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERET 540
                CSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERET
Sbjct: 481 KNSIICSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERET 540

Query: 541 AVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLL 600
           AVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLL
Sbjct: 541 AVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLL 600

Query: 601 GKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSENDKKPRK 660
           GKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSENDKKPRK
Sbjct: 601 GKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSENDKKPRK 660

Query: 661 KYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTEDE 701
           KYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTEDE
Sbjct: 661 KYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTEDE 701

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1033 bits (2670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/668 (70%), Positives = 569/668 (85%), Gaps = 2/668 (0%)

Query: 34  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 93
           KRPVIVPT+K  +HYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 26  KRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 85

Query: 94  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 153
           ENGLINDP+L+GV+DIGDLMLKIP+R AT EEIL+VH++EH++F+E TEKM REELL +T
Sbjct: 86  ENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKET 145

Query: 154 EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 213
           EKGDSVY NNDSY ++RL CGGAIEACKAVVEGRVKN+LA+VRPPGHHAEP+AAGGFCLF
Sbjct: 146 EKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLF 205

Query: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 273
           SNV+VAAK+ILK YPESVR+ILI+DWD+HHGNGTQKAFY+DD VLYISLHRFELGK+YPG
Sbjct: 206 SNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 265

Query: 274 FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 333
             +G YD++G+GKGKGFNCNITWPV GVGD EY+WAFEQ+V+PM REF+PDLVI+SSGFD
Sbjct: 266 TIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFD 325

Query: 334 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 393
           AA GDTIGQCHVTP+CYG+MTHMLKSLARGNLCVVLEGGYNLD+I+ SAL+VAKILIGEP
Sbjct: 326 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKILIGEP 385

Query: 394 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAIES-QIPKMFPLQ 452
           PDE+P+  R+PK   LE+I+KVI +QSKYWKCF +++GN G   EN +++  + K FPLQ
Sbjct: 386 PDELPDPLREPKAEALEIIDKVISLQSKYWKCFGKRYGNLGLPSENVVKALMMSKSFPLQ 445

Query: 453 DAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDI 512
            AIR  Q     +DFG                 CS N F   ++ V++HDTPE+W  R++
Sbjct: 446 TAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEIWAKRNV 505

Query: 513 ITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWD 572
           ITG IDPSTS++ DS  +FI W +ER+  ++DINIP+S FE +NY++ L SQ+++I +WD
Sbjct: 506 ITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEILIYIWD 565

Query: 573 NHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESL 632
           N+ K+  SL K+ FIGIG+A++GIVHLLG RDTR+V K+ ++F+G  SLKP+VP ++ESL
Sbjct: 566 NYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESL 625

Query: 633 GDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDA 691
           GDWYFKNSLVFTDH H CW +N+ +KPRKK+GRVLRCD +G++NIIEER EE+TDFILD+
Sbjct: 626 GDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDS 685

Query: 692 FDEWSDTE 699
           F+EWSD+E
Sbjct: 686 FEEWSDSE 693

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1015 bits (2624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/668 (69%), Positives = 561/668 (83%), Gaps = 2/668 (0%)

Query: 34  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 93
           KR VIVP   P +HY+PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 39  KRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 94  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 153
           ENGLINDP+L+GV DIGDLMLKIPVR AT EEIL+VHT+EH++F+ESTEKM+RE+LL +T
Sbjct: 99  ENGLINDPTLSGVDDIGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158

Query: 154 EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 213
           EKGDSVY NNDSY SARL CGGAIEACKAVVEGRVKN+LA+VRPPGHHAEPQAAGGFCLF
Sbjct: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 273
           SNV+VAAK+ILK YPESVR+I+I+DWDIHHGNGTQK+FY+DD VLY+SLHRFE+GK+YPG
Sbjct: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPG 278

Query: 274 FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 333
             +G YD+ G+GKG+GFNCNITWPV GVGD EY+WAFEQ+V+PM REF+PDLVI+SSGFD
Sbjct: 279 TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338

Query: 334 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 393
           AA GDTIGQCHV+P+CYG+MTHMLKSLARGNLCVVLEGGYNLD+I+ SAL+VAK+LIGEP
Sbjct: 339 AADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 398

Query: 394 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQ 452
           PDE+P+S  DPKP V+EMI+KVIR+QSKYW CFRR+  N G  +   I +S I K FPLQ
Sbjct: 399 PDELPDSLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQ 458

Query: 453 DAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDI 512
            AIR  QL +  ++F                  C+ N F++ +L V++HDT +VW  R++
Sbjct: 459 KAIRQQQLQYLSNEFSFVTLPLINMGLPDNTALCTPNVFESNALLVVVHDTSDVWAKRNV 518

Query: 513 ITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWD 572
           I+G ID S+S+I D+ + FI W ++R+  +ID+NIP + FEADNYS  + SQ+V+I LWD
Sbjct: 519 ISGTIDLSSSVIIDNCIDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWD 578

Query: 573 NHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESL 632
           N+ KY  ++ K+ FIGIG++ SGIVHLLG RDTR VTK  INF+G   LKP+VP +DE+L
Sbjct: 579 NYIKYFPNVAKIAFIGIGDSHSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL 638

Query: 633 GDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDA 691
            +WYFKNSL+F+++ H CW EN+ +KPRKK+GRVLRCDTDG+ N IEERFEEATDFILD+
Sbjct: 639 SEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTDGLSNTIEERFEEATDFILDS 698

Query: 692 FDEWSDTE 699
           F+EWSD E
Sbjct: 699 FEEWSDDE 706

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1014 bits (2623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/668 (69%), Positives = 561/668 (83%), Gaps = 2/668 (0%)

Query: 34  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 93
           KR VIVP   P +HY+PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 39  KRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 94  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 153
           ENGLINDP+L+GV D+GDLMLKIPVR AT EEIL+VHT+EH++F+ESTEKM+RE+LL +T
Sbjct: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158

Query: 154 EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 213
           EKGDSVY NNDSY SARL CGGAIEACKAVVEGRVKN+LA+VRPPGHHAEPQAAGGFCLF
Sbjct: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 273
           SNV+VAAK+ILK YPESVR+I+I+DWDIHHGNGTQK+FY+DD VLY+SLHRFE+GK+YPG
Sbjct: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPG 278

Query: 274 FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 333
             +G YD+ G+GKG+GFNCNITWPV GVGD EY+WAFEQ+V+PM REF+PDLVI+SSGFD
Sbjct: 279 TIQGQYDQAGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338

Query: 334 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 393
           AA GDTIGQCHVTP+CYG+MTHMLKSLARGNLCVVLEGGYNLD+I+ SAL+VAK+LIGEP
Sbjct: 339 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 398

Query: 394 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQ 452
           PDE+P+S  DPKP V+EMI+KVIR+QSKYW CFRR+  N G  +   I +S + K FPLQ
Sbjct: 399 PDELPDSSSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQ 458

Query: 453 DAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDI 512
            AIR  Q  +  D+F +                C+ N +++ +L V++HDT ++W  R++
Sbjct: 459 KAIRQQQQHYLSDEFNLVTLPLINMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNV 518

Query: 513 ITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWD 572
           I+G ID S+S+I D+ L FI W ++R+  +ID+NIP S FE DNYS  + SQ+V+I LWD
Sbjct: 519 ISGTIDLSSSVIIDNCLDFIKWGLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWD 578

Query: 573 NHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESL 632
           N+ KY  ++ K+ F+GIG++ SGIVHLLG RDTR VTK  INF+G   LKP+VP +DE+L
Sbjct: 579 NYIKYFPAVAKIAFVGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL 638

Query: 633 GDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDA 691
            +WYFKNSL+F+++ H CW EN+ +KPRKK+GRVLRCDTDG++N IEERFEEATDFILD+
Sbjct: 639 SEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDS 698

Query: 692 FDEWSDTE 699
           F+EWSD E
Sbjct: 699 FEEWSDEE 706

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1013 bits (2618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/668 (69%), Positives = 559/668 (83%), Gaps = 2/668 (0%)

Query: 34  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 93
           KR VIVP   P LHYTPL+TG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 39  KRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 94  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 153
           ENGLINDP+L+GV D+GDLMLKIPVR AT EEIL+VHT+EH++F+ESTEKM+RE+LL +T
Sbjct: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKET 158

Query: 154 EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 213
           EKGDSVY NNDSY SARL CGGAIEACKAVVEGRVKN+LA+VRPPGHHAEPQAAGGFCLF
Sbjct: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 273
           SNV+VAAK+ILK YPESVR+I+I+DWDIHHGNGTQK+FY+DD VLYISLHRFE+GK+YPG
Sbjct: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPG 278

Query: 274 FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 333
             +G YD+ G+GKG+GFNCNITWPV GVGD EY+WAFEQ+V+PM REF+PDLVI+SSGFD
Sbjct: 279 TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338

Query: 334 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 393
           AA GDTIGQCHVTP+CYG+MTHMLKSLARGNLCVVLEGGYNLD+I+ SAL+VAK+LIGEP
Sbjct: 339 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGEP 398

Query: 394 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQ 452
           PDE+P+   DPKP V+EMI+KV+R+QSKYW CFRR+  N G  +   I +S I K FPLQ
Sbjct: 399 PDELPDPLSDPKPEVIEMIDKVVRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQ 458

Query: 453 DAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDI 512
            AIR  QL +  D+F                  C+ N  ++ +L V++HDT +VW  R++
Sbjct: 459 KAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNV 518

Query: 513 ITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWD 572
           I+G ID S+S++ D+ L FI W ++R+  +ID+NIP + FEADNYS  + SQ+V+I LWD
Sbjct: 519 ISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWD 578

Query: 573 NHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESL 632
           N+ KY  ++ K+ +IGIG++ SGIVHLLG RDTR VTK  INF+G   LKP+VP +DE+L
Sbjct: 579 NYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL 638

Query: 633 GDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDA 691
            +WYFKNSLVFT++ H CW EN+ +KPRKK+GRVLRCDTDG+ N +EERFEEATDFILD+
Sbjct: 639 TEWYFKNSLVFTNNSHQCWKENESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDS 698

Query: 692 FDEWSDTE 699
           F+EWSD E
Sbjct: 699 FEEWSDEE 706

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1011 bits (2615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/668 (69%), Positives = 560/668 (83%), Gaps = 2/668 (0%)

Query: 34  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 93
           KR VIVP   P +HY+PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 39  KRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 94  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 153
           ENGLINDP+L+GV D+GDLMLKIPVR AT EEIL+VHT+EH++F+ESTEKM+REELL +T
Sbjct: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREELLKET 158

Query: 154 EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 213
           EKGDSVY NNDSY SARL CGGAIEACKAVVEGRVKN+LA+VRPPGHHAEPQAAGGFCLF
Sbjct: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 273
           SNV+VAAK+ILK YPESVR+I+I+DWDIHHGNGTQK+FY+DD VLY+SLHRFE+GK+YPG
Sbjct: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPG 278

Query: 274 FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 333
             +G YD+ G+GKG+GFNCNITWPV GVGD EY+WAFEQ+V+PM REF+PDLVI+SSGFD
Sbjct: 279 TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338

Query: 334 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 393
           AA GDTIGQCHVTP+CYG+MTHMLKSLARGNLCVVLEGGYNLD+I+ SAL+VAK+LIGEP
Sbjct: 339 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 398

Query: 394 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQ 452
           PDE+P+   DPKP V+EMI+KVIR+QSKYW CFRR+  N G  +   I +S I K FPLQ
Sbjct: 399 PDELPDPLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQ 458

Query: 453 DAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDI 512
            AIR  Q  +  D+F                  C+ N  ++ ++ +++HDT ++W  R++
Sbjct: 459 KAIRQQQQHYLSDEFNFVTLPLVSMDLPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNV 518

Query: 513 ITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWD 572
           I+G ID S+S+I D+SL FI W ++R+  +ID+NIP + FE DNYS  + SQ+V+I LWD
Sbjct: 519 ISGTIDLSSSVIIDNSLDFIKWGLDRKYGIIDVNIPLTLFEPDNYSGMITSQEVLIYLWD 578

Query: 573 NHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESL 632
           N+ KY  S+ K+ FIGIG++ SGIVHLLG RDTR VTK  INF+G   LKP+VP +DE+L
Sbjct: 579 NYIKYFPSVAKIAFIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETL 638

Query: 633 GDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDA 691
            +WYFKNSL+F+++ H CW EN+ +KPRKK+GRVLRCDTDG++NIIEERFEEATDFILD+
Sbjct: 639 SEWYFKNSLIFSNNSHQCWKENESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDFILDS 698

Query: 692 FDEWSDTE 699
           F+EWSD E
Sbjct: 699 FEEWSDEE 706

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/691 (68%), Positives = 566/691 (81%), Gaps = 9/691 (1%)

Query: 11  LKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTS 70
           +K+E E     I D       + +RPVIVP +   L YTPLKTG+CYDVRMRYHAKIFTS
Sbjct: 43  VKEEPELKKQKITD-------VSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAKIFTS 95

Query: 71  YFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVH 130
           YFEYIDPHPEDPRRIYRIYKILAENGLI DP+L+G+ DIGDLMLKIPVR+AT+EEIL+VH
Sbjct: 96  YFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEILEVH 155

Query: 131 TEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKN 190
           ++EH  F+E T  M REELL  TEKGDSVY NNDS+ SA+L  GG+IEACKAVVEGRVKN
Sbjct: 156 SKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEGRVKN 215

Query: 191 ALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKA 250
           +LA+VRPPGHHAEPQAAGGFCLFSNV++AAK+ILK YPESVR+I+I+DWDIHHGNGTQKA
Sbjct: 216 SLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNGTQKA 275

Query: 251 FYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAF 310
           FY+DD VLYISLHRFELGK+YPG   G YD+ G+GKG+GFNCNITWPV GVGD EYIWAF
Sbjct: 276 FYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEYIWAF 335

Query: 311 EQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLE 370
           EQ+V+PMAREF+PDLVI+SSGFDAA GD+IGQCHVTP+CYG+MTHMLKSLA+GNLCVVLE
Sbjct: 336 EQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLCVVLE 395

Query: 371 GGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKF 430
           GGYNLD+I+ SAL+VAKILIGEPPDE+P+  RDPKP  +E+I+KVIR+QSKYWKCF+R++
Sbjct: 396 GGYNLDAIARSALSVAKILIGEPPDELPDPLRDPKPEAIEIIDKVIRLQSKYWKCFKRRY 455

Query: 431 GNFGGEYENAI-ESQIPKMFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSN 489
           GN G  +++ I ES I K FPLQ AIR  QL+    DF                  CS N
Sbjct: 456 GNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVLCSPN 515

Query: 490 FFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPR 549
            +++K++ +  HDTPE+W  RD+I G IDPS+SII DS+L FI WA E++  VIDINIP+
Sbjct: 516 VYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDINIPQ 575

Query: 550 SAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVT 609
           + FE +NYS+ + SQ+V+  +WDN+ KY  ++EK+ FIGIG+A SGIVHLLG RDTR+V 
Sbjct: 576 NLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDTRSVV 635

Query: 610 KAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRC 668
           K+ INF+    L+ +VP +DESL DWYFKNSLVF+D  H  W + + KKPRKKYGR+LRC
Sbjct: 636 KSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKKPRKKYGRLLRC 695

Query: 669 DTDGIHNIIEERFEEATDFILDAFDEWSDTE 699
           +TDGI+NI+EERFEEATDFILD+F+EWSD+E
Sbjct: 696 ETDGINNIVEERFEEATDFILDSFEEWSDSE 726

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/667 (69%), Positives = 556/667 (83%), Gaps = 2/667 (0%)

Query: 35  RPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 94
           R +IVP +   +HYTPLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE
Sbjct: 23  RQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAE 82

Query: 95  NGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTE 154
           NGLI DP+L+G+ DIGDLMLKIPVREAT EEIL+VH++EH+ F+EST KM RE+LL  TE
Sbjct: 83  NGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATE 142

Query: 155 KGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFS 214
            GDSVY N+DSY SA+L  GGAIEACKAVVEGRVKNALA+VRPPGHHAEP+AAGGFCLFS
Sbjct: 143 SGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFS 202

Query: 215 NVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGF 274
           NV++AAK+ILK YPESVRKILI+DWDIHHGNGTQKAFY+DD +LY+SLHRF++GK+YPG 
Sbjct: 203 NVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGT 262

Query: 275 PEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDA 334
             G YD+ G+GKG+GFNCNITWPV GVGD EY+WAFEQIV+PM REF+PDLVI+S+GFDA
Sbjct: 263 IHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDA 322

Query: 335 AHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPP 394
           A GDTIGQCHVTP+CYG+MTHMLKSLARGN+ VVLEGGYNLDSI+ SAL+VAKILIGEPP
Sbjct: 323 ADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPP 382

Query: 395 DEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAIESQIP-KMFPLQD 453
           DE+P+  RDPKP V+EMI+KV+R+QSKYWKCF+ KFGN G +++  I + I  K FPLQ 
Sbjct: 383 DELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINNSIATKNFPLQS 442

Query: 454 AIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDII 513
           AIR  Q+ +   +F                  CSSN +++ ++ + +HDTPE+W  RD I
Sbjct: 443 AIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAI 502

Query: 514 TGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDN 573
            G IDPS+SII DSSL  I WAIER+  VIDINIP++  E +NY S + +Q+V+I+LWDN
Sbjct: 503 QGTIDPSSSIIVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDN 562

Query: 574 HFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLG 633
           + KY  ++ K+ F+GIG+A SGIVHLLG RDTR+V KA INFVG   LKP+VP +DESLG
Sbjct: 563 YLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLG 622

Query: 634 DWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAF 692
           +WYFKNSLVF++  H  W + + KKPRKKYGRVLRCDTDGI NI+EERFEEATDFILD+F
Sbjct: 623 EWYFKNSLVFSNKNHIYWGDKENKKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSF 682

Query: 693 DEWSDTE 699
           +EWSD+E
Sbjct: 683 EEWSDSE 689

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1000 bits (2586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/700 (67%), Positives = 564/700 (80%), Gaps = 3/700 (0%)

Query: 2   SEQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRM 61
            E  G KRKL++    P     +   V     KR +IVP  +P +HYTPLKTG+CYDVRM
Sbjct: 9   QEDEGSKRKLEESPNGPVEKKPNVASVSNGRQKRQIIVPACEPKIHYTPLKTGLCYDVRM 68

Query: 62  RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREA 121
           RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDP+L+G  DIG+LMLKIPVREA
Sbjct: 69  RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGEDDIGELMLKIPVREA 128

Query: 122 TKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACK 181
           T EE+L VHT+EH++F+E T +M REELL +TE GDSVY N+DSY +A+L CGGAIEACK
Sbjct: 129 TVEELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDSYSAAKLPCGGAIEACK 188

Query: 182 AVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDI 241
           AVVEGRVKNALA++RPPGHHAEP+ AGGFCLFSNV+VAA++ILK YPESVR+ILI+DWDI
Sbjct: 189 AVVEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILKNYPESVRRILILDWDI 248

Query: 242 HHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGV 301
           HHGNGTQKAFY DD VLYISLHRFELGK+YPG   G YD+ G+GKG+GFNCNITWPV GV
Sbjct: 249 HHGNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEGKGEGFNCNITWPVGGV 308

Query: 302 GDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLA 361
           GD EY+ AFEQIV+PMARE+RPDLVI+SSGFDAA GDTIGQCHV+P+CYG+MTHMLKSLA
Sbjct: 309 GDAEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLA 368

Query: 362 RGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSK 421
           RGNLCV LEGGYNLD+I+ SAL+VAKILIGEPP+E+P+  ++PK   +EMI+KVI VQSK
Sbjct: 369 RGNLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPKLEAIEMIDKVIHVQSK 428

Query: 422 YWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXX 480
           YWKCFRR  GN G  ++  + ES I K FPLQ AIR  Q      ++G            
Sbjct: 429 YWKCFRR-LGNSGCNFKEPVTESLITKNFPLQKAIRQEQFHQLEKEYGFVTLPVPKLELP 487

Query: 481 XXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERET 540
                CS + F+  ++ + +HDTPE+W  RD+ITG+IDPSTSI  DS L FI W++ R+ 
Sbjct: 488 EDTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSLARKY 547

Query: 541 AVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLL 600
            VID+NIP+S FE DNYS+ + SQ+V+I LWDN  KY  SL K+ F+G+G+A SGIVHLL
Sbjct: 548 GVIDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDAYSGIVHLL 607

Query: 601 GKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPR 659
           G RDTR+V KA INFVG   LKP+VP +DESLGDWYFKNSLVF+D  + CW +N+ KKPR
Sbjct: 608 GHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWVDNENKKPR 667

Query: 660 KKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699
           +K+GRVLRC++DGI+N +EERF+EATDFILD+F+EWSD+E
Sbjct: 668 RKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score =  995 bits (2572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/694 (66%), Positives = 558/694 (80%), Gaps = 2/694 (0%)

Query: 8   KRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKI 67
           KRK++++++          +       + VIVP   PNLHYTPLKT +CYDVRMRYHAKI
Sbjct: 21  KRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHAKI 80

Query: 68  FTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREATKEEIL 127
           FTSYFEYIDPHPEDPRRIYR+YKILAENGLINDP+L+G+ +IGDLMLKIPVREAT EEIL
Sbjct: 81  FTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEEIL 140

Query: 128 DVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGR 187
           +VH++E+++F+E + +M REELL +TEKGDSVY NNDSY+SA+LSCGG I+ACKAVVEGR
Sbjct: 141 EVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVEGR 200

Query: 188 VKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGT 247
           VKNALA+VRPPGHHAEP+A GGFCLFSNV+VAA++ILK YPESVR+ILI+DWDIHHGNGT
Sbjct: 201 VKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGNGT 260

Query: 248 QKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYI 307
           QKAFY D  VLYISLHRFE+GK+YPG   G YD+ G+GKG+GFNCNITWPV GVGD EY+
Sbjct: 261 QKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAEYM 320

Query: 308 WAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCV 367
            AFEQIV+PMAREF+PDLVI+SSGFDAA GDTIGQCHVTP+CYG MTHMLKSLARGNLCV
Sbjct: 321 LAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNLCV 380

Query: 368 VLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFR 427
            LEGGYNLD+I+ SAL+VAK+LIGEPPDE+P+  +DPK   +EMI+ VI  QSKYWKCF+
Sbjct: 381 ALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWKCFQ 440

Query: 428 RKFGNFGGEY-ENAIESQIPKMFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXC 486
           RKFGN G  + E   E+ I K FPLQ AIR  Q      ++G                 C
Sbjct: 441 RKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDSVLC 500

Query: 487 SSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDIN 546
           S   F+  ++ +++HDTPE+W  RD+ITG+IDPSTSII DS L F  W + R+  VID+N
Sbjct: 501 SPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVIDVN 560

Query: 547 IPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTR 606
           IP+S FE DNYS+ + SQ+V++ +WDN+ KY  SL K+ F+G G+A +GIVHLLG RDTR
Sbjct: 561 IPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHRDTR 620

Query: 607 TVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRV 665
              KA ++F+G   LKP+VP +DESL DWYFKNSL+FTD  H CW++N+ KKPRKK+GRV
Sbjct: 621 ATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKKPRKKFGRV 680

Query: 666 LRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699
           LRCDTDG+++ +EERFEEATDFILD F+EWSD+E
Sbjct: 681 LRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score =  985 bits (2547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/668 (67%), Positives = 544/668 (81%), Gaps = 4/668 (0%)

Query: 36  PVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAEN 95
           PVIVP   P +HYT LKTG+CYDVRMRYHAKI+TSYFEYIDPHPEDPRRIYRIYKILAEN
Sbjct: 45  PVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAEN 104

Query: 96  GLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEK 155
           GLI DP+L+GV +IG+LMLKIPVREAT EEIL VHT+EH+ FLE T KMTRE+LL +TE 
Sbjct: 105 GLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETET 164

Query: 156 GDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSN 215
           GDSVY NNDS +SA+LSCGGAIEACKAVVEGRVKNALA++RPPGHHAEP+ AGGFCLFSN
Sbjct: 165 GDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSN 224

Query: 216 VSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFP 275
           V+VAA++ILK YPESVR+I+I+DWDIHHGNGTQKAFY D+ VLY+SLHR+ELGK+YPG  
Sbjct: 225 VAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTV 284

Query: 276 EGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAA 335
            GNY++ G+GKG+GFNCNI WP  G+GD EY+WAF+Q+V+PM REF+PDLVI+SSGFDAA
Sbjct: 285 HGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAA 344

Query: 336 HGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPD 395
            GDTIGQCHV+P+CYG+MTHMLKSLARGNLCVVLEGGYNLDSI+ SAL VAKILIGEPPD
Sbjct: 345 DGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPD 404

Query: 396 EIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEY-ENAIESQIPKMFPLQDA 454
           E+P   + PKP  +E I  VIR QSKYW CF+    N G  + E   ES I K FPLQ A
Sbjct: 405 ELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPLQQA 464

Query: 455 IRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIIT 514
           IR  QL    + FG                 CS N + A+++ V +HDTPE+W  R+ IT
Sbjct: 465 IRQEQLQQLSEKFGFVTLPLLNMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPIT 524

Query: 515 GIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNH 574
           G IDPSTSII D++L  I W+++R+ +VID+NIP+S FE DNYS+ + SQ+V++ +WDN+
Sbjct: 525 GTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNY 584

Query: 575 FKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGD 634
            KY  SL K+ FIG+G+A SGIVHLLG RDTR+V KAA++FV +  LK +VP +DESLG+
Sbjct: 585 LKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGN 644

Query: 635 WYFKNSLVFTDHFHGCWSEN---DKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDA 691
           WYFKNSLVFT   H CW  +   +KKPRK++GRVL+CDT G++NI+EERF+EATDFILD+
Sbjct: 645 WYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDS 704

Query: 692 FDEWSDTE 699
           F+EWSD+E
Sbjct: 705 FEEWSDSE 712

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/670 (66%), Positives = 549/670 (81%), Gaps = 4/670 (0%)

Query: 34  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 93
           KR +IV    P L YTPLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 24  KRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 83

Query: 94  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 153
           ENGLI DP L+G+ DIGDLMLKIPVREAT +E+L+VH++EH++F+ES  KM+ +ELL  T
Sbjct: 84  ENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST 143

Query: 154 EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 213
           E GDSVY NNDS  SA+LSCGGAIEACKAVVEGRVKNA A+VRPPGHH+EP++AGGFCLF
Sbjct: 144 ETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLF 203

Query: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 273
           SNV+VA+K+IL+ YPESVR+I+I+DWDIHHGNGTQKAFY+DD VLYISLHRFELGK+YPG
Sbjct: 204 SNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 263

Query: 274 FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 333
             +G+YDK G+GKG+GFNCNITWPV GVGD EY+WAFEQ+V+PM+REFRPDLVI+S+GFD
Sbjct: 264 TAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFD 323

Query: 334 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 393
           AA GDTIGQCHV+P+CYG+MTHMLKSLA GNLCVVLEGGYNLD+I+ SAL+VAK+LIGEP
Sbjct: 324 AADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 383

Query: 394 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQ 452
           P+E+ +  +DPKP  +E+INKVIR+QSKYWKCF+R+ GN G  +E  + ES     FPLQ
Sbjct: 384 PEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTDNFPLQ 443

Query: 453 DAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDI 512
            AIR  Q S    +FG                 CS   +   ++ +L+ DTPE+W  RD+
Sbjct: 444 SAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDV 503

Query: 513 ITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWD 572
           I G IDPS SII D++L FI WA+ER   VID+NIP+S FE DNYS+ + +Q+VM  +WD
Sbjct: 504 IQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWD 563

Query: 573 NHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESL 632
           N+ ++  S  K+ F+G+G+A SGIVHLLG RDTR+  K+ INF+   +LKP++P +DE+L
Sbjct: 564 NYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETL 623

Query: 633 GDWYFKNSLVFTDHFHGCWSEND---KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFIL 689
           GDWYFKNSLVF+D  H CW +N+   KKPRKK+GRVLRC++DG+ NIIEERFEEATDF+L
Sbjct: 624 GDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEATDFML 683

Query: 690 DAFDEWSDTE 699
           D+F+EWS+++
Sbjct: 684 DSFEEWSESD 693

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/677 (66%), Positives = 553/677 (81%), Gaps = 6/677 (0%)

Query: 29  IQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 88
           + V+PKR VIVPT+KP +HY PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
Sbjct: 26  LNVVPKRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 85

Query: 89  YKILAENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREE 148
           YKILAENGLIND  L+GV DIGD+MLKIPVREAT +EIL+VH+ EH++FLEST  M RE 
Sbjct: 86  YKILAENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREV 145

Query: 149 LLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAG 208
           LL +TEKGDSVY NNDSY+SA+LSCGGAIEACKAVVEG+VKNALA+VRPPGHH+EP+++G
Sbjct: 146 LLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSG 205

Query: 209 GFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELG 268
           GFCLFSNV+VAAK+ILK YPESVRKI+I+DWDIHHGNGTQKAFY+D+ VLY+SLHRFE G
Sbjct: 206 GFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAG 265

Query: 269 KFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIV 328
           K+YPG  +G YD+ G+GKG+GFNCNITWP  GVGD EY+WAFEQIV+PM REF+PDLVI+
Sbjct: 266 KYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVII 325

Query: 329 SSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKI 388
           SSGFDAA GD IGQCHVTP+CYG+MTHMLKSLARGNL VVLEGGYNLDSI+ SAL+VAK 
Sbjct: 326 SSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKT 385

Query: 389 LIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEY-ENAIESQIPK 447
           LIGEPPDE+P+  +DPKP  LEMI KVI++QSKYWKCF+R+ GN+   + E A ++   K
Sbjct: 386 LIGEPPDELPDPLKDPKPEALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVASDTLATK 445

Query: 448 MFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVW 507
            FPLQ AIR  Q  + + ++                  CS N   A+++ +++HDTP++W
Sbjct: 446 TFPLQTAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIW 505

Query: 508 GNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDINIPRSAF----EADNYSSNLLS 563
             +DII+  +DP +SII DS+L F+ WA  R+  +ID+NIP+S        DNYSS + +
Sbjct: 506 LEKDIISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINA 565

Query: 564 QDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKP 623
           Q++++ LWDNH K++  + K+ FIG+G++ SG+VHLLG RDT+   KA INF+    LKP
Sbjct: 566 QEILLFLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKP 625

Query: 624 IVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFE 682
           +VP +DESL DWYFKNSLVF++  H CW + + KKPRKKYGRVLRCDTDG+++ IEERF+
Sbjct: 626 LVPLVDESLSDWYFKNSLVFSNRTHPCWGDKENKKPRKKYGRVLRCDTDGLNSTIEERFD 685

Query: 683 EATDFILDAFDEWSDTE 699
           EATDFILD+F+EWSD+E
Sbjct: 686 EATDFILDSFEEWSDSE 702

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/702 (65%), Positives = 555/702 (79%), Gaps = 10/702 (1%)

Query: 2   SEQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVRM 61
           SEQI     LK + E  S ++ D       + KRP IVP  +P LHYTPLKTG+CYDVRM
Sbjct: 13  SEQING---LKRDHE--SATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTGLCYDVRM 67

Query: 62  RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREA 121
           RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DP+L+GV  IGDLMLKIPVREA
Sbjct: 68  RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVREA 127

Query: 122 TKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACK 181
           T EEIL VHT+EH++F+  T  MTR++LL +TEKGDSVY NNDSY+SA+LSCGGAIEACK
Sbjct: 128 TDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACK 187

Query: 182 AVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDI 241
           AVVEGRVKNALA+VRPPGHHAEP+ AGGFCLFSNV+VAA++ILK YPESVRKI+++DWD+
Sbjct: 188 AVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDV 247

Query: 242 HHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGV 301
           HHGNGTQKAFY+DD VLYISLHR ELGK+YPG   GN D+VG+GKG+GFNCNI WP KGV
Sbjct: 248 HHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGV 307

Query: 302 GDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLA 361
           GD EY+WAFEQ+++PM REFRPDLVI+SSGFDAA GDT+GQCHVTP+CYG+MTHMLKSLA
Sbjct: 308 GDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLA 367

Query: 362 RGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSK 421
           RGNLC VLEGGY+LDSI+ SALAVAK+LIGEPPDE+P   + PK   +E+I+ VI+ QSK
Sbjct: 368 RGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVV-KQPKLEAVEVIDSVIKTQSK 426

Query: 422 YWKCFRRKFGNFGGEY-ENAIESQIPKMFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXX 480
           YWKCF+   GN G  + E A ++ I K FPLQ+AIR  Q+    ++F             
Sbjct: 427 YWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPLFKKELP 486

Query: 481 XXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERET 540
                CS N + A ++ V +HDTP +W  R   TG IDPSTSII D++L  I WA  R  
Sbjct: 487 DDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASSRNY 546

Query: 541 AVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLL 600
            VIDINIP+S  E DNYS+ + +Q+V++ +WDN+ KY  SL ++ F+ IG+A SG+VHLL
Sbjct: 547 GVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGVVHLL 606

Query: 601 GKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEN---DKK 657
           G RDTR+V K+A++FV    L+P++P +DE+L DWYFKNSLVF    H CW  +   +KK
Sbjct: 607 GHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGNENKK 666

Query: 658 PRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699
           PRKK+GRVL+CD+DGI+NI+EERFEEATDFILD F+EWSD+E
Sbjct: 667 PRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score =  964 bits (2492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/709 (64%), Positives = 556/709 (78%), Gaps = 11/709 (1%)

Query: 1   MSEQIGDKRK--LKDESEFP----SVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTG 54
           M+E +G K++  LK E+ F     +  + +E    +   KRPVIVP  +  LHYTPLKTG
Sbjct: 1   MTEAVGIKQEDSLKQENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTG 60

Query: 55  ICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLML 114
           +CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DP+L+GV DIGDLML
Sbjct: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLML 120

Query: 115 KIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 174
           KIP REAT EEIL VHT EH++FL  T  MTRE+LL +TEKGDSVY NNDSY+SA+LSCG
Sbjct: 121 KIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCG 180

Query: 175 GAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 234
           GAIEAC+AVVEGRVKNALA+VRPPGHHAEP  AGGFCLFSNV+VAA++ILK YPESV+KI
Sbjct: 181 GAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKI 240

Query: 235 LIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNI 294
           +I+DWD+HHGNGTQKAFY DD VLY+SLHR ELGK+YPG   GN D+VG+GKG+GFNCNI
Sbjct: 241 MILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNI 300

Query: 295 TWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMT 354
            WP KGVGD EYIWAFEQ+V+PM REF+PDLVI+SSGFDAA GDT+GQCHVTP+CYG+MT
Sbjct: 301 PWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT 360

Query: 355 HMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINK 414
           HMLKSLARGN+C VLEGGY+LDSI+ SAL VAK+LIGEPPDE+P   + PKP  +E+I+ 
Sbjct: 361 HMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPVV-KQPKPEAVEVIDA 419

Query: 415 VIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQDAIRNAQLSHYYDDFGMXXXX 473
           VI++QS+YW+CF+    N G  ++  + E+ + + FPLQ AIR  Q+     ++      
Sbjct: 420 VIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLP 479

Query: 474 XXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFIN 533
                       CS N + ++S+ V +HDTPE+W  R   TG IDPSTSII D++L  I 
Sbjct: 480 LIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIK 539

Query: 534 WAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEAT 593
           WA +R   VIDINIP+S  E DNYS+ L +Q+V++ +WD++ KY  SL K+ F+ IG+A 
Sbjct: 540 WASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAY 599

Query: 594 SGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSE 653
           SG+VHLLG RDTR V KAAI+F+    L+P+VP +DESL DWYFKNSLVF    H CW  
Sbjct: 600 SGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGN 659

Query: 654 N---DKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699
           +   +KKPRKK+GRVL+C++DG++NI+EERFEEATDFILD F+EWSD+E
Sbjct: 660 DGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/655 (66%), Positives = 536/655 (81%), Gaps = 2/655 (0%)

Query: 45  NLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLT 104
           +L YTPLKTG+CYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP+L+
Sbjct: 4   SLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALS 63

Query: 105 GVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNND 164
           G+ DIGDLM KIPVREAT EEIL+VH +E +++LE T+ + R+ELLSKTE GDSVY NND
Sbjct: 64  GIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNND 123

Query: 165 SYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSIL 224
           SY SA+LSCGGAIEACKA+V+G+VKN+LAIVRPPGHH+EP+ AGGFCLFSNV+VA K+IL
Sbjct: 124 SYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNIL 183

Query: 225 KTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGD 284
           K YP+ V+K++IVDWDIHHGNGTQKAFY DD VLY+SLHRFELGK+YPG   G YD+VG+
Sbjct: 184 KNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGE 243

Query: 285 GKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCH 344
           GKG+GFNCNI W V G+GD EYIWAFEQIV+PM REFRPDLVIVSSGFDAA GDTIG+CH
Sbjct: 244 GKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCH 303

Query: 345 VTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDP 404
           VTP+CYG+MTHMLKSLA G LCVVLEGGYNLD+I+ SALAVAK+LIGEPPDE+P  D+DP
Sbjct: 304 VTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDP 363

Query: 405 KPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQDAIRNAQLSHY 463
           KP  +EMI++VI ++SKYWKCF+R+  N   EY+  I ES   K FP+QDAIR  Q+ + 
Sbjct: 364 KPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYL 423

Query: 464 YDDFGMXXXXXXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSI 523
            +D+ M                CS++  ++    + +HDTPE+W  RD I G+ID S S+
Sbjct: 424 TNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASL 483

Query: 524 IFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEK 583
             D+SL+F +WA++R   +ID+NIP++ +E DNYS++L +Q+V+I LWDN+ KY  ++ K
Sbjct: 484 YMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNK 543

Query: 584 LCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVF 643
           + +IG+GEA SG+VHLLG RDTR+V K+ I FVG   LK +VP ++ESL DWYFK SL+F
Sbjct: 544 IAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLF 603

Query: 644 TDHFHGCWSEND-KKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSD 697
            D  H CW END KKPRK+YGRVLRCD+DGI ++IEERFEEATDFI+D+ DEW++
Sbjct: 604 ADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/709 (62%), Positives = 553/709 (77%), Gaps = 13/709 (1%)

Query: 1   MSEQIGDKRKLKDESEFPSVSIGDE------GKVIQVLPKRPVIVPTQKPNLHYTPLKTG 54
           M+++   KRKL+ +    + +IG E       K+     KRP+IVP  KP +HY PLKTG
Sbjct: 1   MNQESKQKRKLEIDG---NDTIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTG 57

Query: 55  ICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLML 114
           +CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DP+L+GV DIG+LML
Sbjct: 58  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLML 117

Query: 115 KIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 174
           KIP+REAT++EIL VH++EH++FL++T  M+RE+LL +TE GDSVY NNDS +SA+LSCG
Sbjct: 118 KIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCG 177

Query: 175 GAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 234
           GAIEACKAVVEGRVKNALA+VRPPGHHAEP+ AGGFCLFSNV+VAA++ILK YPESVRK+
Sbjct: 178 GAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKV 237

Query: 235 LIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNI 294
           +I+DWDIHHGNGTQ+AFY D+ VLY+SLHR+ELG++YPG   GNY++ G+GKG+GFNCNI
Sbjct: 238 MILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNI 297

Query: 295 TWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMT 354
            W   GVGD EY+WAFEQIVIPM REF+PDLVI+SSGFDAA GDTIGQCHV+P CYG+MT
Sbjct: 298 PWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMT 357

Query: 355 HMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINK 414
           HMLKSLA+GN+CVVLEGGYNLDSI+ SAL V K+LIGEPPDE+P+  + PKP  +  I  
Sbjct: 358 HMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIET 417

Query: 415 VIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQDAIRNAQLSHYYDDFGMXXXX 473
           VIR Q+KYW CF+ K GN G  ++  + ES   K FPLQ A+R  Q      ++      
Sbjct: 418 VIREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLP 477

Query: 474 XXXXXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFIN 533
                       CS N  +  +L + +HDTPEVW  R+ +TG IDPSTSII D++L   N
Sbjct: 478 LLDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITN 537

Query: 534 WAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEAT 593
           WA+ R   +IDINIP+S FE DNYS+ L SQ+V+  LWD++ K+   L ++ F+GIG+A 
Sbjct: 538 WALGRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAY 597

Query: 594 SGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCW-- 651
           SG VHLLG RDTR++ K AI+F     L+P+VP +DES+ DWYFKNSL+FT  +H CW  
Sbjct: 598 SGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGT 657

Query: 652 -SENDKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699
              + KKPRKK+GRVL+C++DG++NI+EERFEEATDFILD+F+EWSD+E
Sbjct: 658 EGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score =  952 bits (2460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/701 (63%), Positives = 547/701 (78%), Gaps = 9/701 (1%)

Query: 8   KRKLKDESEFPSVS-IGDEGKVIQVLPK----RPVIVPTQKPNLHYTPLKTGICYDVRMR 62
           K+  ++  E PS+  I +EG    +  K    RPVIVP  KP + Y+ LKTGICYDVRMR
Sbjct: 4   KKPAEEPLERPSIKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKTGICYDVRMR 63

Query: 63  YHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVREAT 122
           YHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DP+L+G   IGDLM+K+PVREA 
Sbjct: 64  YHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVREAE 123

Query: 123 KEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKA 182
           +EEIL VH+ +H+ F+  TE++ RE LL +TE GDSVY NNDSY+SA+LSCGGAIEACKA
Sbjct: 124 EEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEACKA 183

Query: 183 VVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIH 242
           VVEGRVKN++A+VRPPGHHAEP+ AGGFCLFSNV+VAA ++LK+YPESVRKI+IVDWDIH
Sbjct: 184 VVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWDIH 243

Query: 243 HGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVG 302
           HGNGTQKAFY+DD VLY+SLHR++LGK+YPG   GNYD+ G+GKG+GFNCNITWP  GVG
Sbjct: 244 HGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGGVG 303

Query: 303 DVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLAR 362
           D EY+WAFEQ+++PM REF PDLV++SSGFDAA GDTIGQCHVTP CYG+MTHML SLA+
Sbjct: 304 DAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSLAK 363

Query: 363 GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKY 422
           GNLCVVLEGGYNLDSI+ SAL V K+L+GEPPDE+P   + P P   +MI  VIR QSKY
Sbjct: 364 GNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQSKY 423

Query: 423 WKCFRRKFGNFGGEYENAIESQI-PKMFPLQDAIRNAQLSHYYDDFGMXXXXXXXXXXXX 481
           W CF+ + GN G  +++AI S +  + FPLQ+AIR  Q+S     F              
Sbjct: 424 WSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQLPILDLNLPA 483

Query: 482 XXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETA 541
               C+S    +++L V++HDTPE+W  RD  TGIIDPS+SII D++LK INWA++R   
Sbjct: 484 NTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDRRYG 543

Query: 542 VIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLG 601
           +IDINIP++ FE  NY     SQ+++I LWDN+ K+ ++L+K+ FIGIG+A  GIVHLLG
Sbjct: 544 IIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHLLG 603

Query: 602 KRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCW---SENDKKP 658
            RDTR+V K AI+F+    LK +VP +DE+LGDWYFKNSLVFT   H CW   +  +KK 
Sbjct: 604 HRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANENKKL 663

Query: 659 RKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699
           RKKYGRVL+ D DG+ NI +ERFEEATDFILD+F+EWS++E
Sbjct: 664 RKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/706 (62%), Positives = 542/706 (76%), Gaps = 8/706 (1%)

Query: 1   MSEQIGDKRKLKDESEFPSVSIGDEGKVIQVLPKRPVIVPTQKPNLHYTPLKTGICYDVR 60
           M E+   KRKL++ S     + G +     ++ KRPVIVP  +P + Y PLKTG+CYDVR
Sbjct: 1   MEERTQQKRKLEEGSPDGEAN-GGQASRKAIVQKRPVIVPPVRPKISYVPLKTGLCYDVR 59

Query: 61  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVRE 120
           MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DP+L+G+ +IG+LM KIPVRE
Sbjct: 60  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVRE 119

Query: 121 ATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIEAC 180
           AT+EEIL VH++EH++FL++T  M RE+LL +TE GDSVY NNDS ISARLSCGGAIEAC
Sbjct: 120 ATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEAC 179

Query: 181 KAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWD 240
           KAVVEGRVKNA+A+VRPPGHHAEP  AGGFCLFSNV+VAA++ILK YPESVR+++I+DWD
Sbjct: 180 KAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWD 239

Query: 241 IHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKG 300
           IHHGNGTQKAFY D+ VLY+SLHR+ELGK+YPG   GNYD+ GDGKG+GFNCNI W   G
Sbjct: 240 IHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSG 299

Query: 301 VGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSL 360
           VGD EY+WAFEQ+VIPM REF+PDLVI+SSGFDAA GDTIGQCHV+P CYG++THMLKSL
Sbjct: 300 VGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSL 359

Query: 361 ARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINK-VIRVQ 419
           ARGN+CVVLEGGYNLDSI+ SAL VAK+LIGEPPDE+P+  + PKP  +  I+  +++ Q
Sbjct: 360 ARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQ 419

Query: 420 SKYWKCFRRKFGNFGGEY-ENAI-ESQIPKMFPLQDAIR-NAQLSHYYDDFGMXXXXXXX 476
           SKYW CF+ + GN G  + E A+ +S   K FPLQ       Q      ++         
Sbjct: 420 SKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLN 479

Query: 477 XXXXXXXXXCSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAI 536
                    CS N     ++ + +HDTPE+W  RD +TG IDPSTSII D+++  INWA+
Sbjct: 480 MELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWAL 539

Query: 537 ERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGI 596
            R   VIDINIP+S FE DNYS+ L SQ+V+  LWD++ K    L ++ F+GIG+A SG 
Sbjct: 540 GRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGF 599

Query: 597 VHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCW---SE 653
           VHLLG RDTR+V K AI F     L+P+VP +DESLGDWYFKNSLVFT  +H CW     
Sbjct: 600 VHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGN 659

Query: 654 NDKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699
           + KKPRKK+GRVLR   DG++NI+EER EEATDFILD+F+EWS++E
Sbjct: 660 DSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/437 (74%), Positives = 385/437 (88%), Gaps = 1/437 (0%)

Query: 34  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 93
           K+ +IVP Q P +HY PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 40  KKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99

Query: 94  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 153
           ENGLINDP+L+GV +IGDLMLK+P+REAT  EIL+VH+ EH ++LE T    RE+LL +T
Sbjct: 100 ENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET 159

Query: 154 EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 213
           E GDSVY NNDS+ SA+LSCGGAIEACKAVVEGRVKNA+A+VRPPGHH+EP++AGGFCLF
Sbjct: 160 ENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLF 219

Query: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 273
           SNV+VA K+ILK YPESVRK+LI+DWDIHHGNGTQKAFY DDNVLYISLHRFELGK+YPG
Sbjct: 220 SNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPG 279

Query: 274 FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 333
             +G YD+ G+GKG+GFNCNITWP+  VGD EY+WAFEQ+V+PM+REF+PDLVI+SSGFD
Sbjct: 280 TIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFD 339

Query: 334 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 393
           AA GDTIGQCHV+P+CYG+MTHMLKSLARGNLCVVLEGGYNLD+I+ SAL+V+KILIGEP
Sbjct: 340 AADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGEP 399

Query: 394 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQ 452
           PDE+P+  +DPKP V+EMI+K+IR+QSKYWKCFRR+ GN G  ++ +I +S I K FPLQ
Sbjct: 400 PDELPDPLKDPKPEVIEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQ 459

Query: 453 DAIRNAQLSHYYDDFGM 469
            AIRN Q    +D+   
Sbjct: 460 TAIRNFQSKKLFDELNF 476

 Score =  279 bits (714), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 168/215 (78%), Gaps = 1/215 (0%)

Query: 486 CSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDI 545
           CS    ++K+L VL+HD+P++W  RD+ TG++D S++II DS+L FI W+++R   VIDI
Sbjct: 581 CSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDRNYGVIDI 640

Query: 546 NIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDT 605
           NIP++ FE DNYSS L +Q+ ++S WDN+ KY   +EK+ FIG G+A +GIVHLLG RDT
Sbjct: 641 NIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVHLLGHRDT 700

Query: 606 RTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEN-DKKPRKKYGR 664
           R+V K+ INF+G   LK +VP +DE+L DWYFKNSLVFTD  H  W++N +KKPRKK+GR
Sbjct: 701 RSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKKPRKKFGR 760

Query: 665 VLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699
           VLR   DGI N+IEERF+EATDFILD+F+EWSD E
Sbjct: 761 VLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  522 bits (1344), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 239/300 (79%), Positives = 269/300 (89%)

Query: 32  LPKRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKI 91
           +PKR VIVP ++P LHYTPLKTG+CYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKI
Sbjct: 50  MPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKI 109

Query: 92  LAENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLS 151
           LAENGLI D +L+G+ DIGD+MLKIPVR AT+EEIL VHT EH+ F+E+ E  +REEL+ 
Sbjct: 110 LAENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIK 169

Query: 152 KTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFC 211
            TEK DSVY NNDSY SA+LSCGG IEAC+AVVEGRVKN+LAIVRPPGHHAEPQAAGGFC
Sbjct: 170 LTEKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFC 229

Query: 212 LFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFY 271
           LFSNVSVAA+SIL+TYPESVRKILI+DWDIHHGNGTQKAFYED+NVLYISLHR+E   FY
Sbjct: 230 LFSNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFY 289

Query: 272 PGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSG 331
           PG   G YD+VG+GKG+GFNCNITWPV GVGD EY+WAFE +V+P+ REFRPDLVIVSSG
Sbjct: 290 PGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  288 bits (736), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 127/217 (58%), Positives = 175/217 (80%), Gaps = 1/217 (0%)

Query: 486 CSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIERETAVIDI 545
            S   FKA++L +L+HDTPE+WG+RDIITG++DPSTS++ D+S+KFI WA +R  +++DI
Sbjct: 362 ASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSILDI 421

Query: 546 NIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVHLLGKRDT 605
           NIP+S  E + +SS+  + ++M+SLWDNH +YI +L K+CFIGIGE+  GIVHL+G+RD 
Sbjct: 422 NIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGERDL 481

Query: 606 RTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEN-DKKPRKKYGR 664
           R ++KA INFVG+  LK +  + DE++ DWYFKNSLVFT+  H CW E+ +K+PRKK+GR
Sbjct: 482 RVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRPRKKFGR 541

Query: 665 VLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTEDE 701
           VL+ D+DGI +II ERF+EATDFILDAF+EWSD E +
Sbjct: 542 VLKSDSDGIISIINERFDEATDFILDAFEEWSDEESD 578

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 105/360 (29%), Positives = 184/360 (51%), Gaps = 37/360 (10%)

Query: 54  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 113
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + D+ +  
Sbjct: 25  GSAYCPRVSYHFNPKVSNYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 76

Query: 114 LKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYIS 168
                R ATK+E+LD H+++++ FL     E+  KM R  L  K   GD   +  + Y  
Sbjct: 77  ----TRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTL-EKYNIGDDCPIFQNLYDY 131

Query: 169 ARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTY 227
           + L  G +++A + ++    ++ +AI    G HHA+     GFC  +++ +A  ++L+ +
Sbjct: 132 SALYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLRYH 189

Query: 228 PESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG 287
           P    ++L +D D+HHG+G Q+AFY  D V  IS H++  G+F+PG   GNYD++G  +G
Sbjct: 190 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPG--TGNYDEIGCAQG 242

Query: 288 KGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVT 346
           K F  N+  P++ G+ D  YI  F+ I+ P+   ++P ++I   G D+   D +G  ++ 
Sbjct: 243 KHFAMNV--PLEDGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFNLN 300

Query: 347 PNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKILIGEPPDEIPESD 401
              +G     ++S     L VV  GGY   ++S      + +    +L  E P++IP  D
Sbjct: 301 IKAHGECVKFIRSFGIPML-VVGGGGYTPRNVSRLWTYETGVLNNVLLPAELPEDIPFRD 359

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  144 bits (362), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 106/372 (28%), Positives = 189/372 (50%), Gaps = 40/372 (10%)

Query: 42  QKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDP 101
           ++P   Y   + G  Y  R+ YH     S + Y   HP  P      ++++  + L++  
Sbjct: 14  EQPQFEY---EFGSSYTPRVSYHFNPKVSNYHYGVRHPMKP------FRLMLTDHLVSSY 64

Query: 102 SLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKG 156
            L  + D+ +       REAT+EE+   H++++++FL     E+  KM R  L  K   G
Sbjct: 65  GLHKIMDLYE------TREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTL-EKFNIG 117

Query: 157 DSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSN 215
           D   +  + Y  + L  G +++A + ++    ++ +AI    G HHA+     GFC  ++
Sbjct: 118 DDCPIFQNIYDYSTLYTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVND 175

Query: 216 VSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFP 275
           + ++  ++L+ +P    ++L +D D+HHG+G Q+AFY  D V  IS H+F  G+F+PG  
Sbjct: 176 IVLSILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPG-- 228

Query: 276 EGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDA 334
            G++D++G  KGK F  N+  P++ G+ D  YI  F+ I+ P+   ++P ++I   G D+
Sbjct: 229 TGDFDEIGCAKGKHFAMNV--PLEDGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADS 286

Query: 335 AHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKIL 389
              D +G  ++    +G     +KS     + VV  GGY   ++S      + +    +L
Sbjct: 287 LGHDRLGCFNLNIKAHGECVKFVKSFGIP-MLVVGGGGYTPRNVSRLWTYETGVLNNVLL 345

Query: 390 IGEPPDEIPESD 401
             E P+EIP  D
Sbjct: 346 PSEIPEEIPFRD 357

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  143 bits (360), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 102/356 (28%), Positives = 175/356 (49%), Gaps = 35/356 (9%)

Query: 54  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 113
           G  Y  R+ YH     S + Y   HP  P R      +++  GL N            +M
Sbjct: 22  GSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRFMLTDHLVSSYGLHN------------IM 69

Query: 114 LKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYIS 168
                REATKEE+L  H+E++++FL     ++  KM R     K   GD   +  + Y  
Sbjct: 70  DLYETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTF-DKYNIGDDCPIFQNIYEY 128

Query: 169 ARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTY 227
            +L  G +++A + ++    ++ +AI    G HHA+     GFC  +++ +A  ++L+ +
Sbjct: 129 CKLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRYH 186

Query: 228 PESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG 287
           P    ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   GNYD++G  +G
Sbjct: 187 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPG--TGNYDEIGCAEG 239

Query: 288 KGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTP 347
           K F  N+     G+ D  YI  F+ ++ P+   F+P  +I   G D+   D +G  ++  
Sbjct: 240 KHFAMNVPLN-DGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFNLNI 298

Query: 348 NCYGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKILIGEPPDEIP 398
             +G     ++S     + VV  GGY   ++S      + +    +L  E P+++P
Sbjct: 299 KAHGECVKFIRSFGIP-MVVVGGGGYTPRNVSRLYAYETGILNNVLLQSELPEDMP 353

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  142 bits (359), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 103/365 (28%), Positives = 183/365 (50%), Gaps = 35/365 (9%)

Query: 48  YTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVS 107
           Y P + G  Y   + YH     S + Y   HP  P      ++++  + L++   L  + 
Sbjct: 14  YLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKP------FRLMLTDHLVSSYGLHKIM 67

Query: 108 DIGDLMLKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLN 162
           D+ +       REAT++E+L+ H+ ++++FL     ++  KM R  L  K   GD   + 
Sbjct: 68  DLYE------TREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSL-EKFNIGDDCPIF 120

Query: 163 NDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAK 221
              +  + L  G +++A + ++ G  ++ +AI    G HHA+     GFC  +++ +A  
Sbjct: 121 QGIFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDIVLAIL 178

Query: 222 SILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDK 281
           ++L+ +P    ++L VD D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G++D+
Sbjct: 179 NLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPG--TGDFDE 231

Query: 282 VGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIG 341
           +G  +GK F  N+     G+ D  YI  F+ I+ P+   ++P ++I   G D+   D +G
Sbjct: 232 IGCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRLG 290

Query: 342 QCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKILIGEPPDE 396
             ++    +G     +KS     L VV  GGY   ++S      + L    +L  E P+ 
Sbjct: 291 CFNLNIRAHGECVKFVKSFGIPML-VVGGGGYTPRNVSRLWTYETGLLNDVLLPQEIPEN 349

Query: 397 IPESD 401
           IP  D
Sbjct: 350 IPFRD 354

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  143 bits (361), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 106/364 (29%), Positives = 185/364 (50%), Gaps = 37/364 (10%)

Query: 50  PLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDI 109
           P + G  Y  ++ YH     S + Y   HP  P      ++++  + L+   S  G+  I
Sbjct: 53  PFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKP------FRLMLTDHLV---SCYGLHKI 103

Query: 110 GDLMLKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNND 164
            DL      REATKEE+L+ H  ++++FL     E+  K+ R  L  K   GD   +   
Sbjct: 104 MDLY---ETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSL-EKFNIGDDCPIFQG 159

Query: 165 SYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSI 223
            +  + L  G +++A + ++    ++ +AI    G HHA+     GFC  +++ +A  S+
Sbjct: 160 MFDYSILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIISL 217

Query: 224 LKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVG 283
           L+ +P    ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G+ D++G
Sbjct: 218 LRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPG--TGDLDEIG 270

Query: 284 DGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQ 342
             KGK F+ N+  P++ G+ D  YI  F+ I+ P+   ++P ++I   G D+   D +G 
Sbjct: 271 CSKGKKFSLNV--PLQDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGC 328

Query: 343 CHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKILIGEPPDEI 397
            ++    +G     +KS     LCV   GGY   ++S      + +    +L  + P +I
Sbjct: 329 FNLNIKAHGECVKFVKSFGIPILCVG-GGGYTPRNVSRLWAYETGVLNDVLLPSDIPKDI 387

Query: 398 PESD 401
           P +D
Sbjct: 388 PFTD 391

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  140 bits (353), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 104/359 (28%), Positives = 178/359 (49%), Gaps = 35/359 (9%)

Query: 54  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 113
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  V D+ +  
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKP------FRLMLTDHLVSAYGLHKVMDLYE-- 75

Query: 114 LKIPVREATKEEILDVHTEEHMQFLESTEKMTREEL----LSKTEKGDSVYLNNDSYISA 169
                R ATK+E+   H+E+++ FL      T  +L    L K   GD   +    +  A
Sbjct: 76  ----TRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQGMFDYA 131

Query: 170 RLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYP 228
            L  G +++A + ++ G  ++ +AI    G HHA+     GFC  +++ +A  ++L+ +P
Sbjct: 132 ALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYHP 189

Query: 229 ESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGK 288
               ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G+ D++G  +GK
Sbjct: 190 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPG--TGDLDEIGCSRGK 242

Query: 289 GFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTP 347
            F  N+  P++ G+ D  YI  F+ I+ P+   FRP ++I   G D+   D +G  ++  
Sbjct: 243 HFALNV--PLQDGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNI 300

Query: 348 NCYGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKILIGEPPDEIPESD 401
             +G     +KS     L VV  GGY   ++S      + L    +L  + P+ IP  D
Sbjct: 301 KAHGECVRFVKSFGVPML-VVGGGGYTPRNVSRLWTYETGLLNGVLLQPKLPEGIPFRD 358

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  140 bits (352), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 100/353 (28%), Positives = 176/353 (49%), Gaps = 31/353 (8%)

Query: 54  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 113
           G  Y+  + YH     S F Y   HP  P      ++++  + L++   L  + D+ +  
Sbjct: 21  GAPYEPNVSYHFNSDVSQFHYGVRHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 72

Query: 114 LKIPVREATKEEILDVHTEEHMQFLESTEKMTREEL----LSKTEKGDSVYLNNDSYISA 169
                R AT+EE+ + H +++++FL         +L    L K   GD   +    Y  +
Sbjct: 73  ----TRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQYS 128

Query: 170 RLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYP 228
            L  G +++A + ++ G  ++ +AI    G HHA+  +  GFC  +++ ++  ++L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRYHP 186

Query: 229 ESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGK 288
               ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   GN D+ G  +GK
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPG--TGNLDETGCSRGK 239

Query: 289 GFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTP 347
            F  N+  P++ G+ D  YI  F+ I+ P+   F+P ++I   G D+   D +G  ++  
Sbjct: 240 HFALNV--PLEDGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNV 297

Query: 348 NCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIG-EPPDEIPE 399
             +G     +KS     L V+  GGY   ++S        +L G   P EIPE
Sbjct: 298 KAHGECVRFVKSFGIPML-VLGGGGYTPRNVSRLWTYETALLNGVSVPQEIPE 349

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  140 bits (352), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 101/357 (28%), Positives = 180/357 (50%), Gaps = 37/357 (10%)

Query: 54  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 113
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  V D+ +  
Sbjct: 21  GASYTPRVSYHYNSRVSQYHYGVRHPMKP------FRLMLTDHLVSRYGLHKVMDLYE-- 72

Query: 114 LKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYIS 168
                R ATKEE+L  H ++++ FL     E+  K+ R  L  K   GD   +    +  
Sbjct: 73  ----TRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSL-EKFNIGDDCPIFQGLFEY 127

Query: 169 ARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTY 227
           + L  G +++A + ++ G  ++ +AI    G HHA+     GFC  +++ +A  ++L+ +
Sbjct: 128 SMLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYH 185

Query: 228 PESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG 287
           P    ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G+ D++G  +G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPG--TGDLDEIGCSRG 238

Query: 288 KGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVT 346
           K F+ N+  P+  G+ D  YI  F+ I+ P+   ++P ++I   G D+   D +G  ++ 
Sbjct: 239 KHFSLNV--PLNDGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLN 296

Query: 347 PNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKILIGEPPDEIP 398
              +G     +KS     LCV   GGY   ++S      + +    +L  + P++IP
Sbjct: 297 IRAHGECVKFVKSFGIPMLCVG-GGGYTPRNVSRLWTYETGILNDVLLPSDIPEDIP 352

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  139 bits (351), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 106/357 (29%), Positives = 181/357 (50%), Gaps = 37/357 (10%)

Query: 54  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 113
           G  Y  R+ YH     S + Y   HP  P      +++L  + L++   L  + D+ +  
Sbjct: 21  GSAYCPRVSYHFNPKVSNYHYGVRHPMKP------FRLLLTDHLVSSYGLHKIMDLYE-- 72

Query: 114 LKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYIS 168
                R AT EEI + HT++++ FL     E+  KM R  L  K   GD   +  + +  
Sbjct: 73  ----TRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTL-EKFNIGDDCPIFQNLFNY 127

Query: 169 ARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTY 227
            +L  G +++A + ++    ++ +AI    G HHA+     GFC  +++ +A  ++L+ +
Sbjct: 128 CKLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYH 185

Query: 228 PESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG 287
           P    ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   GN+D+VG   G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPG--TGNHDEVGCANG 238

Query: 288 KGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVT 346
           K F  N+  P++ G+ D  YI  F+ I+ P+   ++P ++I   G D+   D IG  ++T
Sbjct: 239 KHFAMNV--PLEDGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGCFNLT 296

Query: 347 PNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKILIGEPPDEIP 398
              +G     ++S     L VV  GGY   ++S      + +    +L  E P+EIP
Sbjct: 297 IKGHGECVKFIRSFGIPML-VVGGGGYTPRNVSRLWAYETGVLNNVLLSKELPEEIP 352

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  139 bits (349), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 100/356 (28%), Positives = 177/356 (49%), Gaps = 35/356 (9%)

Query: 54  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 113
           G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + D+ +  
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 74

Query: 114 LKIPVREATKEEILDVHTEEHMQFLESTEKMTREEL----LSKTEKGDSVYLNNDSYISA 169
                REATKEE+   H+ +++ FLE     T  ++    L K   G    +  + Y  +
Sbjct: 75  ----TREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFENIYDYS 130

Query: 170 RLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYP 228
            L  G +++A + ++ G  ++ +AI    G HHA+     GFC  +++ ++  ++L+ +P
Sbjct: 131 TLYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYHP 188

Query: 229 ESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGK 288
               ++L +D D+HHG+G Q+AFY  D V  IS H++  G+F+PG   GNYD++G   GK
Sbjct: 189 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPG--TGNYDEIGCSGGK 241

Query: 289 GFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTP 347
            F  N+  P+  G+ D  YI  F+ I+ P+   ++P ++I   G D+   D +G  ++  
Sbjct: 242 HFAMNV--PLNDGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 348 NCYGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKILIGEPPDEIP 398
             +G     + S     + VV  GGY   ++S      + +    +L  E P+E+P
Sbjct: 300 KAHGECVKFVSSFGIP-MLVVGGGGYTPRNVSRLWAYETGILNNVLLPKELPEELP 354

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  139 bits (349), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/353 (28%), Positives = 177/353 (50%), Gaps = 31/353 (8%)

Query: 54  GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLM 113
           G  +   + YH     S F Y   HP  P      ++++  + L++   L  + D+ +  
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE-- 72

Query: 114 LKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYIS 168
                R AT+EE+ + H+E++++FL     ++  K+ R  L  K   GD   +    Y  
Sbjct: 73  ----TRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSL-EKFNIGDDCPIFQGLYQY 127

Query: 169 ARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTY 227
           + L  G +++A + ++ G  ++ +AI    G HHA+     GFC  +++ ++  ++L+ +
Sbjct: 128 STLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYH 185

Query: 228 PESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG 287
           P    ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   GN D++G  +G
Sbjct: 186 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPG--TGNLDEIGCSRG 238

Query: 288 KGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTP 347
           K F  N+     G+ D  YI  F+ I+ P+   F+P ++I   G D+   D +G  ++  
Sbjct: 239 KHFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNV 297

Query: 348 NCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGE-PPDEIPE 399
             +G     +KS     L VV  GGY   ++S        +L G   P+EIPE
Sbjct: 298 KAHGECVKYVKSFGLPML-VVGGGGYTPRNVSRLWAYETGLLNGVLLPEEIPE 349

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  138 bits (347), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 103/369 (27%), Positives = 187/369 (50%), Gaps = 40/369 (10%)

Query: 42  QKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDP 101
            +P  +Y   + G  Y  R+ YH     S + +   HP  P      ++++  + L++  
Sbjct: 14  NQPQFNY---EFGSTYAPRVSYHFNPKVSSYHFGVRHPMKP------FRLMLTDHLVSGY 64

Query: 102 SLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKG 156
            L  + D+ +       R+A+ +E+L+ HT++++ FL     ++  KM R  L  K   G
Sbjct: 65  GLHKIMDLYE------TRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTL-DKFNIG 117

Query: 157 DSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSN 215
           D   + ++ Y  + L  G +++A + ++ G  ++ +AI    G HHA+  +  GFC  ++
Sbjct: 118 DDCPIFHNLYEYSSLYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYIND 175

Query: 216 VSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFP 275
           + ++  ++L+ +P    ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG  
Sbjct: 176 IVLSILNLLRFHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPG-- 228

Query: 276 EGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDA 334
            GNYD+ G   GK F  N+  P+K G+ D  YI  F+ I+ P+   + P ++I   G D+
Sbjct: 229 TGNYDETGCSNGKHFALNV--PLKDGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADS 286

Query: 335 AHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKIL 389
              D +G  ++    +G     +KS     L VV  GGY   ++S      + +    +L
Sbjct: 287 LGHDRLGCFNLNIKAHGECVKFVKSFGIPML-VVGGGGYTPKNVSRLWTYETGILNNVLL 345

Query: 390 IGEPPDEIP 398
             E P +IP
Sbjct: 346 SPELPSDIP 354

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  137 bits (344), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 102/357 (28%), Positives = 179/357 (50%), Gaps = 37/357 (10%)

Query: 57  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKI 116
           Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + D+ +     
Sbjct: 28  YTPRVSYHFNPKVSNYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE----- 76

Query: 117 PVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARL 171
             R AT EE++  H+E+++ FL     E+  KM R  L  K   GD   +  + Y  + L
Sbjct: 77  -TRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRGTL-EKFNIGDDCPIFQNLYDYSTL 134

Query: 172 SCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPES 230
             G +++A + ++    ++ +AI    G HHA+     GFC  +++ ++  ++L+ +P  
Sbjct: 135 YTGASLDATRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYINDIVLSIVNLLRYHP-- 190

Query: 231 VRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGF 290
             ++L +D D+HHG+G Q+AFY  D V  IS H+F  G+F+PG   G+YD+ G  KGK F
Sbjct: 191 --RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPG--TGDYDETGCAKGKHF 245

Query: 291 NCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNC 349
             N+  P++ G+ D  YI  F+ I+ P+   ++P +++   G D+   D +G  ++    
Sbjct: 246 AMNV--PLEDGIDDDSYINLFKSIMDPLITSYKPTVIVQQCGADSLGHDRLGCFNLNIKG 303

Query: 350 YGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKILIGEPPDEIPESD 401
           +G     +KS     + VV  GGY   ++S      + +    +L  E P+ IP  D
Sbjct: 304 HGECVKFIKSFGIP-MLVVGGGGYTPRNVSRLWTYETGILNNVLLPNELPEGIPFRD 359

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 100/358 (27%), Positives = 180/358 (50%), Gaps = 37/358 (10%)

Query: 56  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLK 115
            Y  R+ YH     S++ Y   HP  P      ++++  + L++   L  + D+ +    
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE---- 72

Query: 116 IPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISAR 170
              R AT++E+L  H+E+++ FL     E+  K+ R  L      GD   +  + Y    
Sbjct: 73  --TRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTL-ENFNIGDDCPIFQNLYDYTT 129

Query: 171 LSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPE 229
           L  G +++A + ++    ++ +AI    G HHA+  +  GFC  +++ ++  ++L+ +P 
Sbjct: 130 LYTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP- 186

Query: 230 SVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKG 289
              +IL +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G+  ++G  KGK 
Sbjct: 187 ---RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPG--TGDLTEIGCDKGKH 240

Query: 290 FNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPN 348
           F  N+  P++ G+ D  YI  F+ IV P+   F+P L++   G D+   D +G  ++   
Sbjct: 241 FALNV--PLEDGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIK 298

Query: 349 CYGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKILIGEPPDEIPESD 401
            +G     +KS     L VV  GGY   ++S      + +    +L  + P++IP  D
Sbjct: 299 AHGECVKFVKSFGLPML-VVGGGGYTPRNVSRLWTYETGILNDVLLPEDIPEDIPFRD 355

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  135 bits (339), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 101/364 (27%), Positives = 183/364 (50%), Gaps = 37/364 (10%)

Query: 51  LKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIG 110
            + G  Y  R+ YH     S + Y   HP  P      ++++  + L++   L  + D+ 
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKP------FRLMLTDHLVSSYGLHKIMDLY 70

Query: 111 DLMLKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDS 165
           +       R AT EE+   H+EE++ F+     E+  K+ R  L  K   GD   +  + 
Sbjct: 71  E------TRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTL-EKFNIGDDCPIFPNL 123

Query: 166 YISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSIL 224
           Y  + L  G +++A + ++    ++ +AI    G HHA+     GFC  +++ +A  ++L
Sbjct: 124 YDYSSLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLL 181

Query: 225 KTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGD 284
           + +P    ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   GN+D+VG 
Sbjct: 182 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPG--TGNHDEVGC 234

Query: 285 GKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQC 343
            +GK F  N+  P++ G+ D  YI  F+ I+ P+   ++P +++   G D+   D +G  
Sbjct: 235 ARGKHFALNV--PLQDGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCF 292

Query: 344 HVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKILIGEPPDEIP 398
           ++    +G   + ++S     L VV  GGY   ++S      + +    +L  + P+ IP
Sbjct: 293 NLNVKAHGECVNFVRSFGLPML-VVGGGGYTPRNVSRLWTYETGILNNVLLPKDLPEGIP 351

Query: 399 ESDR 402
             DR
Sbjct: 352 FRDR 355

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  135 bits (339), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 100/353 (28%), Positives = 180/353 (50%), Gaps = 33/353 (9%)

Query: 56  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLK 115
            Y  R+ YH     S++ Y   HP  P      ++++  + L++   L  + D+ +    
Sbjct: 23  AYSPRVSYHFNPKVSHYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE---- 72

Query: 116 IPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISAR 170
              R AT++E+L+ H+E+++ FL     +++ K+ R  L      GD   +  + Y    
Sbjct: 73  --TRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTL-ENFNIGDDCPIFQNLYDYTT 129

Query: 171 LSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPE 229
           L  G +++A + ++    ++ +AI    G HHA+  +  GFC  +++ ++  ++L+ +P 
Sbjct: 130 LYTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP- 186

Query: 230 SVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKG 289
              +IL +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G+  ++G  KGK 
Sbjct: 187 ---RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPG--TGDLTEIGCDKGKH 240

Query: 290 FNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPN 348
           F  N+  P++ G+ D  YI  F+ IV P+   F+P L++   G D+   D +G  ++   
Sbjct: 241 FALNV--PLEDGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIK 298

Query: 349 CYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGE-PPDEIPES 400
            +G     +KS     L VV  GGY   ++S        IL     P++IPE+
Sbjct: 299 AHGECVKFVKSFGLPML-VVGGGGYTPRNVSRLWTYETGILNDVLLPEDIPEN 350

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  134 bits (336), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 103/352 (29%), Positives = 174/352 (49%), Gaps = 33/352 (9%)

Query: 57  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKI 116
           Y  R+ YH     S++ Y   HP  P R+     +++  GL           I DL    
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGL---------HKIMDLY--- 71

Query: 117 PVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARL 171
             R ATK+E+ + HTE+++ FL     E+  K+ R  L      GD   +  + Y    L
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTL-ENFNIGDDCPIFQNLYDYTTL 130

Query: 172 SCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPES 230
             G  ++A + ++    ++ +AI    G HHA+  +  GFC  +++ ++  ++L+ +P  
Sbjct: 131 YTGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 231 VRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGF 290
             ++L +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G+  ++G  KGK F
Sbjct: 187 --RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPG--TGDLTEIGCDKGKHF 241

Query: 291 NCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNC 349
             N+  P++ G+ D  YI  F+ IV P+   F+P +++   G D+   D +G  ++    
Sbjct: 242 ALNV--PLEDGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKA 299

Query: 350 YGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGE-PPDEIPES 400
           +G     +KS     L VV  GGY   ++S        IL     P++IPE+
Sbjct: 300 HGECVKFVKSFGLPML-VVGGGGYTPKNVSRLWAYETGILNDVLLPEDIPEN 350

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 98/357 (27%), Positives = 176/357 (49%), Gaps = 35/357 (9%)

Query: 56  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLK 115
            Y  R+ YH     S++ Y   HP  P      ++++  + L++   L  + D+ +    
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKP------FRLMLTDHLVSSYGLHKIMDLYE---- 72

Query: 116 IPVREATKEEILDVHTEEHMQFLESTEKMTREEL----LSKTEKGDSVYLNNDSYISARL 171
              R AT++E+L  H+E+++ FL         +L    L     GD   +  + Y    L
Sbjct: 73  --TRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 172 SCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPES 230
             G +++A + ++    ++ +AI    G HHA+  +  GFC  +++ ++  ++L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 231 VRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGF 290
             +IL +D D+HHG+G Q+AFY  D V  +S H++  G+F+PG   G+  ++G  KGK F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPG--TGDLTEIGCDKGKHF 241

Query: 291 NCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNC 349
             N+  P++ G+ D  YI  F+ IV P+   F+P L++   G D+   D +G  ++    
Sbjct: 242 ALNV--PLEDGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKA 299

Query: 350 YGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKILIGEPPDEIPESD 401
           +G     +KS     L VV  GGY   ++S      + +    +L    P++IP  D
Sbjct: 300 HGECVKFVKSFGLPML-VVGGGGYTPRNVSRLWTYETGILNDVLLPENIPEDIPFRD 355

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  130 bits (326), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 100/364 (27%), Positives = 182/364 (50%), Gaps = 38/364 (10%)

Query: 48  YTPL-KTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGV 106
           + PL + G  Y  R+ YH     S++ Y   HP  P      ++++  + L++   L  +
Sbjct: 14  FQPLYEFGSNYAPRVSYHINPEVSHYHYGVRHPMKP------FRLMLTDHLVSGYGLHKI 67

Query: 107 SDIGDLMLKIPVREATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYL 161
            D+         R+AT EE+ + H+E+++ FL     E+  K+ R  L  K   GD   +
Sbjct: 68  MDL------YKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTL-EKFNIGDDCPI 120

Query: 162 NNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAA 220
             + +  + L  G +++A + ++    ++ +AI    G HHA+  +  GFC  +++ +A 
Sbjct: 121 FPNIFQYSSLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAI 178

Query: 221 KSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYD 280
            ++L+ +P    ++L +D D+HHG+G Q+AFY  D V  IS H++  G+F+PG   G  D
Sbjct: 179 LNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPG--TGKND 231

Query: 281 KVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDT 339
           + G   GK F  N+  P++ G+ D  YI  F+ I+ P+   F+P +++   G D+   D 
Sbjct: 232 ETGCADGKHFAMNV--PLEDGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDR 289

Query: 340 IGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISN-----SALAVAKILIGEPP 394
           +G  ++    +G     ++S     + VV  GGY   ++S      + +    +L  E P
Sbjct: 290 LGCFNLNIKAHGECVKFVRSFGIP-MLVVGGGGYTPRNVSRLWTYETGILNNVLLPEELP 348

Query: 395 DEIP 398
           D +P
Sbjct: 349 DNLP 352

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  128 bits (321), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 92/335 (27%), Positives = 168/335 (50%), Gaps = 30/335 (8%)

Query: 51  LKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIG 110
            + G    +R+ YH     S++ Y   HP  P      ++++  + L++   +  V D+ 
Sbjct: 19  FELGAARPLRVSYHFNPKVSHYHYGVKHPMKP------FRLMLTDHLVSGYGMHKVMDLY 72

Query: 111 DLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREEL----LSKTEKGDSVYLNNDSY 166
           +       R AT +E+ + HTE+++ FL+        +L    L K   GD   +  + Y
Sbjct: 73  E------TRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQNLY 126

Query: 167 ISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILK 225
             A L  G +++A + ++ G  ++ +AI    G HHA+  +  GFC  +++ ++  ++L+
Sbjct: 127 DYATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLR 184

Query: 226 TYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDG 285
            +P    ++L +D D+HHG+G Q+AFY  D V  IS H++  G F+PG   G+ D+ G  
Sbjct: 185 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPG--TGDIDETGCD 237

Query: 286 KGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCH 344
            G+ F  N+  P++ G+ D  YI  F+ ++ P+   + P ++I   G D+   D +G  +
Sbjct: 238 AGERFALNV--PLEDGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFN 295

Query: 345 VTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSIS 379
           +    +G     +KS     L VV  GGY   ++S
Sbjct: 296 LNIKAHGECVKFVKSFGIPML-VVGGGGYTPRNVS 329

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  123 bits (309), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 91/329 (27%), Positives = 160/329 (48%), Gaps = 34/329 (10%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 174
            ATK+E+   HT+E++ FL     ++ E   RE +  K   GD   + +  Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 175 GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 233
           G++E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 234 ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 293
           +L VD D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    VG GKGK ++ N
Sbjct: 180 VLYVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDVGVGKGKNYSVN 235

Query: 294 ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 352
           +  P++ G+ D  Y   FE +V  +   ++P  V++ +G D+  GD +G  +++   +  
Sbjct: 236 V--PLRDGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHAN 293

Query: 353 MTHMLKSLARGNLCVVLEGGYNLDSISNS 381
             + +KS     + VV  GGY + +++ +
Sbjct: 294 CVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  121 bits (304), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 88/329 (26%), Positives = 158/329 (48%), Gaps = 34/329 (10%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 174
            ATK+E+   HT+E++ FL     ++ E   RE +  K   GD   + +  Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 175 GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 233
           G++E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 234 ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 293
           +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    +G G GK +  N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPG--TGELRDIGVGTGKNYAVN 235

Query: 294 ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 352
           +  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +G 
Sbjct: 236 V--PLRDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGN 293

Query: 353 MTHMLKSLARGNLCVVLEGGYNLDSISNS 381
             + +KS     + VV  GGY + +++ +
Sbjct: 294 CVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  120 bits (302), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 89/327 (27%), Positives = 155/327 (47%), Gaps = 30/327 (9%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFLESTEKMTREELLSKTEK---GDSVYLNNDSYISARLSCGGA 176
            ATK+E+   HT+E++ FL        E    ++ K   GD   + +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 177 IEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKIL 235
           +E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 236 IVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNIT 295
            +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    VG GKGK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPG--TGELRDVGVGKGKYYAVNV- 236

Query: 296 WPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMT 354
            P++ G+ D  Y   FE +V  +   ++P  V++  G D+  GD +G  +++   +    
Sbjct: 237 -PLRDGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCV 295

Query: 355 HMLKSLARGNLCVVLEGGYNLDSISNS 381
           + +KS     + VV  GGY + +++ +
Sbjct: 296 NYVKSFGI-PMMVVGGGGYTMRNVART 321

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  120 bits (302), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 89/328 (27%), Positives = 156/328 (47%), Gaps = 32/328 (9%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFLESTE----KMTREELLSKTEKGDSVYLNNDSYISARLSCGG 175
            ATK+E+   HT+E++ FL         M ++E + K   GD   + +  Y    +S GG
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV-KFNVGDDCPVFDGLYEYCSISGGG 126

Query: 176 AIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 234
           ++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++
Sbjct: 127 SMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RV 180

Query: 235 LIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNI 294
           L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G     G GKGK +  N+
Sbjct: 181 LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDTGVGKGKNYAVNV 236

Query: 295 TWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYM 353
             P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +   
Sbjct: 237 --PLRDGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANC 294

Query: 354 THMLKSLARGNLCVVLEGGYNLDSISNS 381
            + +KS     L VV  GGY + +++ +
Sbjct: 295 VNFVKSFGI-PLMVVGGGGYTMRNVART 321

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  119 bits (298), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 88/328 (26%), Positives = 157/328 (47%), Gaps = 32/328 (9%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFLESTE----KMTREELLSKTEKGDSVYLNNDSYISARLSCGG 175
            ATK+E+   HT+E++ FL         M ++E + K   GD   + +  Y    +S GG
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV-KFNVGDDCPVFDGLYEYCSISGGG 126

Query: 176 AIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 234
           ++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++
Sbjct: 127 SMEGAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RV 180

Query: 235 LIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNI 294
           L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    +G GKGK +  N+
Sbjct: 181 LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDIGVGKGKNYAVNV 236

Query: 295 TWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYM 353
             P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +   
Sbjct: 237 --PLRDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANC 294

Query: 354 THMLKSLARGNLCVVLEGGYNLDSISNS 381
            + +KS     + VV  GGY + +++ +
Sbjct: 295 VNYVKSFNI-PMMVVGGGGYTMRNVART 321

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  119 bits (298), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 88/327 (26%), Positives = 156/327 (47%), Gaps = 30/327 (9%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y      S + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFLESTEKMTREELLSKTEK---GDSVYLNNDSYISARLSCGGA 176
            ATK+E+   H++E++ FL        E    ++ K   GD   + +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 177 IEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKIL 235
           +E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 236 IVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNIT 295
            +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G     G GKGK ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDTGVGKGKYYSVNV- 236

Query: 296 WPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMT 354
            P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +    
Sbjct: 237 -PLRDGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCV 295

Query: 355 HMLKSLARGNLCVVLEGGYNLDSISNS 381
           + +KS     L VV  GGY + +++ +
Sbjct: 296 NYVKSFGIPML-VVGGGGYTMRNVART 321

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  119 bits (298), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 87/327 (26%), Positives = 156/327 (47%), Gaps = 30/327 (9%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFLESTEKMTREELLSKTEK---GDSVYLNNDSYISARLSCGGA 176
            ATK+E+   HT+E++ FL        E    ++ K   GD   + +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 177 IEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKIL 235
           +E+   +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MESAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 236 IVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNIT 295
            +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    +G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDIGVGKGQNYAVNV- 236

Query: 296 WPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMT 354
            P++ G+ D  Y   FE +V  +   ++P  V++  G D+  GD +G  +++   +    
Sbjct: 237 -PLRDGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCV 295

Query: 355 HMLKSLARGNLCVVLEGGYNLDSISNS 381
           + +KS     + VV  GGY + +++ +
Sbjct: 296 NYVKSFNI-PMMVVGGGGYTMRNVART 321

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  119 bits (298), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 87/327 (26%), Positives = 155/327 (47%), Gaps = 30/327 (9%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFLESTEKMTREELLSKTEK---GDSVYLNNDSYISARLSCGGA 176
            ATK+E+   HT+E++ FL        E    ++ K   GD   + +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 177 IEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKIL 235
           +E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 236 IVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNIT 295
            +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    +G GKGK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDIGVGKGKYYAVNV- 236

Query: 296 WPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMT 354
            P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +    
Sbjct: 237 -PLRDGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCV 295

Query: 355 HMLKSLARGNLCVVLEGGYNLDSISNS 381
           + +KS     + VV  GGY + +++ +
Sbjct: 296 NYVKSFGI-PMMVVGGGGYTMRNVART 321

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  119 bits (298), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 89/327 (27%), Positives = 155/327 (47%), Gaps = 30/327 (9%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y      S + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFLESTEKMTREELLSKTEK---GDSVYLNNDSYISARLSCGGA 176
            ATK+E+   HT+E++ FL        E    ++ K   GD   + +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 177 IEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKIL 235
           +E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 236 IVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNIT 295
            +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G     G GKGK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDTGVGKGKYYAVNV- 236

Query: 296 WPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMT 354
            P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +    
Sbjct: 237 -PLRDGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCV 295

Query: 355 HMLKSLARGNLCVVLEGGYNLDSISNS 381
           + +KS     L VV  GGY + +++ +
Sbjct: 296 NYVKSFGIPML-VVGGGGYTMRNVART 321

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  119 bits (298), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 87/329 (26%), Positives = 157/329 (47%), Gaps = 34/329 (10%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 174
            ATK+E+   HT+E++ FL     ++ E   RE +  K   GD   + +  Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 175 GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 233
           G++E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 234 ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 293
           +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    +G G GK +  N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDIGVGTGKNYAVN 235

Query: 294 ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 352
           +  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 236 V--PLRDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHAN 293

Query: 353 MTHMLKSLARGNLCVVLEGGYNLDSISNS 381
             + +KS     + VV  GGY + +++ +
Sbjct: 294 CVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  119 bits (297), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 87/329 (26%), Positives = 157/329 (47%), Gaps = 34/329 (10%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFL-----ESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 174
            ATK+E+   HT+E++ FL     ++ E   RE +  K   GD   + +  Y    +S G
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESV--KFNVGDDCPVFDGLYEYCSISGG 125

Query: 175 GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 233
           G++E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +
Sbjct: 126 GSMEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----R 179

Query: 234 ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 293
           +L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    +G G GK +  N
Sbjct: 180 VLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDIGVGAGKNYAVN 235

Query: 294 ITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY 352
           +  P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +  
Sbjct: 236 V--PLRDGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHAN 293

Query: 353 MTHMLKSLARGNLCVVLEGGYNLDSISNS 381
             + +KS     + VV  GGY + +++ +
Sbjct: 294 CVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  119 bits (297), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 91/349 (26%), Positives = 162/349 (46%), Gaps = 33/349 (9%)

Query: 38  IVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGL 97
           +V  QKP   +  L        R+ Y        + Y   HP  P RI   + ++   GL
Sbjct: 1   MVFVQKP---FDELTVNSSQKKRVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGL 57

Query: 98  INDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEK-- 155
                          M     + ATK+E+   HT+E++ FL        +    ++ K  
Sbjct: 58  YKK------------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFN 105

Query: 156 -GDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLF 213
            GD   + +  Y    +S GG++E    +  G+    +AI    G HHA+   A GFC  
Sbjct: 106 VGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYL 163

Query: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 273
           +++ +    +L+ +P    ++L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG
Sbjct: 164 NDIVLGIIELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG 217

Query: 274 FPEGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGF 332
              G     G GKGK ++ N+  P++ G+ D  Y   FE ++  +   ++P  V++  G 
Sbjct: 218 --TGELRDTGVGKGKYYSVNV--PLRDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGG 273

Query: 333 DAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNS 381
           D+  GD +G  +++   +    + +KS     + VV  GGY + +++ +
Sbjct: 274 DSLSGDRLGCFNLSMRGHANCVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  119 bits (297), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 87/328 (26%), Positives = 156/328 (47%), Gaps = 32/328 (9%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL  +            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFLESTE----KMTREELLSKTEKGDSVYLNNDSYISARLSCGG 175
            ATK+E+   HT+E++ FL         M ++E + K   GD   + +  Y    +S GG
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV-KFNVGDDCPVFDGLYEYCSISGGG 126

Query: 176 AIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 234
           ++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++
Sbjct: 127 SMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RV 180

Query: 235 LIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNI 294
           L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G     G G GK +  N+
Sbjct: 181 LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDTGVGNGKNYAVNV 236

Query: 295 TWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYM 353
             P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +   
Sbjct: 237 --PLRDGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANC 294

Query: 354 THMLKSLARGNLCVVLEGGYNLDSISNS 381
            + +KS     + VV  GGY + +++ +
Sbjct: 295 VNFVKSFNI-PMMVVGGGGYTMRNVART 321

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  118 bits (296), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 87/327 (26%), Positives = 154/327 (47%), Gaps = 30/327 (9%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 120 EATKEEILDVHTEEHMQFLESTEKMTREELLSKTEK---GDSVYLNNDSYISARLSCGGA 176
            ATK+E+   HT+E++ FL        E    ++ K   GD   + +  Y    +S GG+
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 177 IEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKIL 235
           +E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 129 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVL 182

Query: 236 IVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNIT 295
            +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G     G GKGK +  N+ 
Sbjct: 183 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDTGVGKGKYYAVNV- 237

Query: 296 WPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMT 354
            P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +    
Sbjct: 238 -PLRDGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCV 296

Query: 355 HMLKSLARGNLCVVLEGGYNLDSISNS 381
           + +KS     + VV  GGY + +++ +
Sbjct: 297 NYVKSFGI-PMMVVGGGGYTMRNVART 322

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  118 bits (296), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 91/349 (26%), Positives = 162/349 (46%), Gaps = 33/349 (9%)

Query: 38  IVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGL 97
           +V  QKP   +  L        R+ Y        + Y   HP  P RI   + ++   GL
Sbjct: 1   MVFVQKP---FDDLTVNSSQKKRVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGL 57

Query: 98  INDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEK-- 155
                          M     + ATK+E+   HT+E++ FL        +    ++ K  
Sbjct: 58  YKK------------MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFN 105

Query: 156 -GDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLF 213
            GD   + +  Y    +S GG++E    +  G+    +AI    G HHA+   A GFC  
Sbjct: 106 VGDDCPVFDGLYEYCSISGGGSMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYL 163

Query: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 273
           +++ +    +L+ +P    ++L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG
Sbjct: 164 NDIVLGIIELLRYHP----RVLYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG 217

Query: 274 FPEGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGF 332
              G     G GKGK ++ N+  P++ G+ D  Y   FE ++  +   ++P  V++  G 
Sbjct: 218 --TGELRDTGVGKGKYYSVNV--PLRDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGG 273

Query: 333 DAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNS 381
           D+  GD +G  +++   +    + +KS     + VV  GGY + +++ +
Sbjct: 274 DSLSGDRLGCFNLSMRGHANCVNYVKSFGI-PMMVVGGGGYTMRNVART 321

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  118 bits (296), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 88/328 (26%), Positives = 156/328 (47%), Gaps = 32/328 (9%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFLESTE----KMTREELLSKTEKGDSVYLNNDSYISARLSCGG 175
            ATK+E+   HT+E++ FL         M ++E + K   GD   + +  Y    +S GG
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV-KFNVGDDCPVFDGLYEYCSISGGG 126

Query: 176 AIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 234
           ++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++
Sbjct: 127 SMEGAARLNRGKCD--VAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----RV 180

Query: 235 LIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNI 294
           L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G     G GKGK +  N+
Sbjct: 181 LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDTGVGKGKYYAVNV 236

Query: 295 TWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYM 353
             P++ G+ D  Y   FE +V  +   ++P  V++  G D+  GD +G  +++   +   
Sbjct: 237 --PLRDGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANC 294

Query: 354 THMLKSLARGNLCVVLEGGYNLDSISNS 381
            + +KS     + +V  GGY + +++ +
Sbjct: 295 VNFVKSFGL-PMMIVGGGGYTMRNVART 321

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  118 bits (296), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 88/328 (26%), Positives = 157/328 (47%), Gaps = 32/328 (9%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFLESTE----KMTREELLSKTEKGDSVYLNNDSYISARLSCGG 175
            ATK+E+   HT+E++ FL         M ++E + K   GD   + +  +    +S GG
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESV-KFNVGDDCPVFDGLFEYCSISGGG 126

Query: 176 AIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 234
           ++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++
Sbjct: 127 SMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RV 180

Query: 235 LIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNI 294
           L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    VG GKGK +  N+
Sbjct: 181 LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDVGIGKGKNYAVNV 236

Query: 295 TWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYM 353
             P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +   
Sbjct: 237 --PLRDGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANC 294

Query: 354 THMLKSLARGNLCVVLEGGYNLDSISNS 381
            + +KS     + VV  GGY + +++ +
Sbjct: 295 VNFVKSFNI-PMMVVGGGGYTMRNVART 321

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  118 bits (296), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 88/328 (26%), Positives = 157/328 (47%), Gaps = 32/328 (9%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFLESTE----KMTREELLSKTEKGDSVYLNNDSYISARLSCGG 175
            ATK+E+   HT+E++ FL         M ++E + K   GD   + +  Y    +S GG
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESV-KFNVGDDCPVFDGLYEYCSISGGG 126

Query: 176 AIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 234
           ++E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++
Sbjct: 127 SMEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RV 180

Query: 235 LIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNI 294
           L +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G     G GKGK ++ N+
Sbjct: 181 LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDTGVGKGKYYSVNV 236

Query: 295 TWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYM 353
             P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +   
Sbjct: 237 --PLRDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANC 294

Query: 354 THMLKSLARGNLCVVLEGGYNLDSISNS 381
            + +KS     + VV  GGY + +++ +
Sbjct: 295 VNYVKSFGI-PMMVVGGGGYTMRNVART 321

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  118 bits (295), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/327 (26%), Positives = 154/327 (47%), Gaps = 30/327 (9%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFLESTEKMTREELLSKTEK---GDSVYLNNDSYISARLSCGGA 176
            ATK+E+   HT+E++ FL        +    ++ K   GD   + +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 177 IEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKIL 235
           +E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 236 IVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNIT 295
            +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G     G GKGK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDTGVGKGKYYAVNV- 236

Query: 296 WPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMT 354
            P++ G+ D  Y   FE ++  +   ++P  V++  G D+  GD +G  +++   +    
Sbjct: 237 -PLRDGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCV 295

Query: 355 HMLKSLARGNLCVVLEGGYNLDSISNS 381
           + +KS     L +V  GGY + +++ +
Sbjct: 296 NYMKSFGV-PLMIVGGGGYTMRNVART 321

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  116 bits (291), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 87/327 (26%), Positives = 154/327 (47%), Gaps = 30/327 (9%)

Query: 60  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLMLKIPVR 119
           R+ Y        F Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 120 EATKEEILDVHTEEHMQFLESTEKMTREELLSKTEK---GDSVYLNNDSYISARLSCGGA 176
            ATK+E+   HT+E++ FL        E    ++ K   GD   + +  Y    +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 177 IEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKIL 235
           +E    +  G+    +AI    G HHA+   A GFC  +++ +    +L+ +P    ++L
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 236 IVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNIT 295
            +D D+HHG+G ++AFY  D V+  S H++  G+F+PG   G    +G G GK +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPG--TGELRDIGVGSGKYYAVNV- 236

Query: 296 WPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMT 354
            P++ G+ D  +   FE +V  +   ++P  V++  G D+  GD +G  +++   +    
Sbjct: 237 -PLRDGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCV 295

Query: 355 HMLKSLARGNLCVVLEGGYNLDSISNS 381
           + +KS     + VV  GGY + +++ +
Sbjct: 296 NYVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 91/181 (50%), Gaps = 11/181 (6%)

Query: 200 HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 259
           HHA  Q A GFC  +++ +    I K   +  +KI  +D+D+HHG+G +KAF    NV  
Sbjct: 206 HHAFKQKASGFCYVNDIVLL---IQKLRRKGFQKISYIDFDLHHGDGVEKAFQFSSNVQT 262

Query: 260 ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAR 319
           ISLH FE+G F+PG   GN  +  D +    N  +   + G+ D       EQIV P+  
Sbjct: 263 ISLHLFEVG-FFPG--TGNLSE-SDKRRNVVNIPL---LHGLDDTSLEQLIEQIVKPVIE 315

Query: 320 EFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGY-MTHMLKSLARGNLCVVLEGGYNLDSI 378
              PD++++  G D   GD   +  ++       +T ++ +     + ++  GGYN+  +
Sbjct: 316 RHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAKCITELINNTKDCPVILLGGGGYNVTLM 375

Query: 379 S 379
           S
Sbjct: 376 S 376

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 101/214 (47%), Gaps = 14/214 (6%)

Query: 200 HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 259
           HHA  Q A GFC  ++V +  + + K     + KI  VD+D+HHG+G ++AF     +  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRKM---KLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 260 ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYI-WAFEQIVIPMA 318
           IS+H +E G F+PG   G+ +    GK       +  P+K   D  Y+     +I+ P+ 
Sbjct: 269 ISIHLYEPG-FFPG--TGSLNDARKGKSV-----VNIPLKHGCDDSYLDLVASKIISPLI 320

Query: 319 REFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYG-YMTHMLKSLARGNLCVVLEGGYNLDS 377
           +   PD++I+  G D   GD   +  +T       + +++K   R ++ ++  GGYN D 
Sbjct: 321 KRHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYN-DL 379

Query: 378 ISNSALAVAKILIGEPPDEIPESDRDPKPGVLEM 411
           + +         +      I ++D   K G  +M
Sbjct: 380 LMSRFYTYLTWCVTREFSTIGQADDSSKDGPFDM 413

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 91/177 (51%), Gaps = 13/177 (7%)

Query: 200 HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 259
           HHA  Q A GFC  ++V +  + + K     + K+  +D+D+HHG+G +KAF     +  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRKL---KLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 260 ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYI-WAFEQIVIPMA 318
           IS+H +E G F+PG   G+ +   +GK       +  P+K   D  Y+     +I+ P+ 
Sbjct: 269 ISVHLYEPG-FFPG--TGSLNDSQNGKNI-----VNIPLKHGCDDNYLNLVASKIIHPLI 320

Query: 319 REFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYG-YMTHMLKSLARGNLCVVLEGGYN 374
           +   P+++I+  G D   GD   +  +T       + +++KS  + ++ ++  GGYN
Sbjct: 321 KRHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYN 377

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 84/334 (25%), Positives = 142/334 (42%), Gaps = 71/334 (21%)

Query: 159 VYLNNDSYISARLSCGGAIEACKAVVEGRVKN-----ALAIVRPPGHHAEPQAAGGFCLF 213
           +YL  ++  + R S G       ++ +G V       A   +RPPGHH+      GFCL 
Sbjct: 147 IYLCEETVYALRGSIGAVEYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGFCLL 206

Query: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-----KAFYEDDNVLYISLHRFELG 268
           +N  +A +    TY   V   +I+D+D+HHG+GTQ     +A ++ D++        E  
Sbjct: 207 NNAHIAVEYAADTY--GVTHAVILDFDLHHGDGTQDICWKRAGFKADDIQDAKGEYNEFD 264

Query: 269 KFYPGFPEGNY------------------DKVGDGKG---KGFNCNITW-----PVKGVG 302
           K +  FP+  Y                  DKV D         + NI W     P +   
Sbjct: 265 KKFAEFPKVGYFSMHDINSFPTELNYASKDKVKDASTCIMDAHDVNI-WNIHLLPYETEE 323

Query: 303 DVEYIWA-------------FEQIVIPMAREFRP--DLVIVSSGFDAAHGDTIG-QCH-- 344
           +   ++              F+   + MA++ +P   LV++S+GFDA+  + +  Q H  
Sbjct: 324 EFNKLYQTRYRTLFAKADEFFKAAKLSMAKDGKPFKGLVVMSAGFDASEYEQVSMQRHGV 383

Query: 345 -VTPNCYGYMTHMLKSLAR----GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPE 399
            V  + Y   T     LA+    G +  +LEGGY+  +I   A  V   LIG     +  
Sbjct: 384 NVPTSFYSTFTKDALKLAQMHTNGKIISLLEGGYSDAAI---ASGVFSHLIG-----LQN 435

Query: 400 SDRDPKPGVLEMINKVIRVQSKYWKCFR-RKFGN 432
            +   + G  +++ +++R     WK ++ RK G+
Sbjct: 436 QNWITEWGSAQVVKEIVRGCKPRWKPYKTRKAGD 469

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 54/177 (30%), Positives = 87/177 (49%), Gaps = 13/177 (7%)

Query: 200 HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 259
           HHA  Q A GFC  ++V +  + + K     + KI  VD+D+HHG+G +KAF     +  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRKA---KLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 260 ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAF-EQIVIPMA 318
           IS+H +E G F+PG        + D +      NI  P+K   D  Y+     +IV P+ 
Sbjct: 267 ISVHLYEPG-FFPGTG-----SLSDSRKDKNVVNI--PLKHGCDDNYLELIASKIVNPLI 318

Query: 319 REFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYG-YMTHMLKSLARGNLCVVLEGGYN 374
               P+ +I+  G D   GD   +  +T       + +++KS  R ++ ++  GGYN
Sbjct: 319 ERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYN 375

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 120/255 (47%), Gaps = 23/255 (9%)

Query: 119 REATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCGGAIE 178
           R A + E+ DV         ES +++TR   L+K    D   +     +   +S G  + 
Sbjct: 131 RTALEAELSDV---------ESGDEVTRRSTLAKFNLLDDCPIFPYLPLYCYVSTGATLS 181

Query: 179 ACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIV 237
             + ++EG  +  +AI    G HH+    A GFC  +++++   ++ +     V +I  V
Sbjct: 182 LAQYILEGS-ERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRRG---GVDRISYV 237

Query: 238 DWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWP 297
           D+D+HHG+G +KAF     V  ISLH +E G F+P    G+ +    GK      NI   
Sbjct: 238 DFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFPC--SGSLEDNSSGKSI---VNIPL- 290

Query: 298 VKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHML 357
           + G+ D       ++I++P   + +P+++++  G D   GD   +  ++    G  + + 
Sbjct: 291 LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQLSIK--GLTSTIT 348

Query: 358 KSLARGNLCVVLEGG 372
             + + N  +VL GG
Sbjct: 349 SLIEQFNCHIVLLGG 363

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 85/180 (47%), Gaps = 19/180 (10%)

Query: 200 HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 259
           HHA  + A GFC  +++ +    I K   +  +++  +D+D+HHG+G ++AF    NV  
Sbjct: 195 HHAMKKRASGFCYVNDIVLL---IQKLRSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 260 ISLHRFELGKFYP--GFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPM 317
           IS+H FE G F+P  G  E N         KG N        G+ D        Q+VIP+
Sbjct: 252 ISMHLFECG-FFPTSGSLEDN--------KKGKNIANIPLAHGLNDEYLNEIVTQVVIPL 302

Query: 318 AREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVL---EGGYN 374
                P ++I+  G D   GD   +  +T    G   ++LK + R   C ++    GGYN
Sbjct: 303 TDRHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYN 360

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 113/242 (46%), Gaps = 21/242 (8%)

Query: 139 ESTEKMTREELLSKTEKGDSVYLNNDSY--ISARLSCGGAIEACKAVVEGRVKNALAIVR 196
           ++ ++M RE+L     +GD       SY  +  ++  G  +   K +     +  +A+  
Sbjct: 172 DNEKEMIREKLKGYNLEGDCPIF---SYLPVYCQVIVGATLSLAKHITAVANERTIAVNW 228

Query: 197 PPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDD 255
             G HHA    A GFC  +++ +  + +        ++I  +D+D+HHG+G Q++F    
Sbjct: 229 DGGRHHALRNKASGFCYINDIVLLIQQLRSN---GYKRITYIDFDLHHGDGVQRSFQYST 285

Query: 256 NVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVI 315
           +V  IS H FE G F+P        K+G         NI   + GV D+      E+++I
Sbjct: 286 SVQTISAHMFEPG-FFPCTGSLKESKMGKNI-----VNIPL-LHGVDDMLMNEIVEKVMI 338

Query: 316 PMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVL---EGG 372
           P  + + P+++++  G D   GD   +  +T   +G + ++LK L     C V+    GG
Sbjct: 339 PCVKRYDPEILVIQCGGDGLIGDGYAEWQLT--IHGLVNNILKLLRIFPGCPVVLLGGGG 396

Query: 373 YN 374
           YN
Sbjct: 397 YN 398

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 108/222 (48%), Gaps = 19/222 (8%)

Query: 161 LNNDSYISARLS--CGGAIEACKAVVEG---RVKNALAIVRPPG-HHAEPQAAGGFCLFS 214
           L++D Y+ A L   C     A  ++V     R + A++I    G HHA    A GFC  +
Sbjct: 176 LSHDCYLFAYLPLYCQVIAGATLSLVRAACLRHERAISINWDGGRHHASRSRASGFCYIN 235

Query: 215 NVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGF 274
           ++++    I K     +R+I  +D+D+HH +G ++AF    +V  IS+H  E G F+PG 
Sbjct: 236 DIALL---IQKLRRRGIRRISYIDFDLHHCDGVERAFQHSQSVQTISVHLHEPG-FFPG- 290

Query: 275 PEGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 333
             G+  +   GK       +  PV+ G+ D       +++++P  R   P+++++  G D
Sbjct: 291 -TGSLKEASVGKNV-----VNIPVQHGMDDTFLNQIVQRVIMPCIRSHNPEVLVIQCGGD 344

Query: 334 AAHGDTIGQCHVT-PNCYGYMTHMLKSLARGNLCVVLEGGYN 374
              GD   +  +T       + ++++     N+ ++  GGYN
Sbjct: 345 GLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYN 386

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 95/202 (47%), Gaps = 12/202 (5%)

Query: 175 GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 233
           GA  +    ++   + ++AI    G HHA    A GFC  +++ +  + I K      + 
Sbjct: 189 GATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKN 245

Query: 234 ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 293
           I  VD+D+HHG+G QKAF    NV  +SLH FE G F+P         + + K      N
Sbjct: 246 ISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPG-FFPC-----TGSLQEAKAGSSIVN 299

Query: 294 ITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVT-PNCYGY 352
           I   + G+         + I+IP+  +  P+++++  G D   GD   +  +T  +  G 
Sbjct: 300 IPL-LHGLDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSGA 358

Query: 353 MTHMLKSLARGNLCVVLEGGYN 374
           +  ++ +    ++ ++  GGYN
Sbjct: 359 IMKLINTFPSCSVVLLGGGGYN 380

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 103/230 (44%), Gaps = 18/230 (7%)

Query: 200 HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 259
           HH+    A GFC  +++ +A + + + +      I  VD+D+HHG+G ++AF    NV  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFS----NISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 260 ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIPMA 318
           ISLH  E G F+PG   G+ +   DG        I  P++ G  D   +   E +VIP  
Sbjct: 298 ISLHNHEPG-FFPG--TGSMESSQDGHSI-----INIPLRHGADDDCLMKITESVVIPCI 349

Query: 319 REFRPDLVIVSSGFDAAHGDTIGQCHVT-PNCYGYMTHMLKSLARGNLCVVLEGGYNLDS 377
           ++  P ++++  G D   GD   +  +T       +  +L SL   ++ ++  GGYN   
Sbjct: 350 QKHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYNDRV 409

Query: 378 ISN----SALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYW 423
           +S         V       PP++ P  D +      E ++       K+W
Sbjct: 410 MSRFYTYLTWKVCDQFSKSPPEDPPFIDDEDLIPDHEFLDLYTDEHYKFW 459

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 116/260 (44%), Gaps = 23/260 (8%)

Query: 172 SCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPES 230
           +  GA  A    +     +ALA+    G HHA    A GFC  +++++  +++ +   + 
Sbjct: 164 TVAGATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QG 220

Query: 231 VRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGF 290
             ++  VD+D+HHG+G + AF    NV   SLH FE G F+PG         G  K    
Sbjct: 221 FLRVSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPG-FFPG--------TGACKNCTD 271

Query: 291 NCNITWP-VKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNC 349
           N  +  P + GV D       + IV P  +   P+++I+  G D   GD  G+  ++   
Sbjct: 272 NSVLNVPLLHGVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQLS--I 329

Query: 350 YGYMTHMLKSLAR---GNLCVVLEGGYNLDSISNSALAVAKILIGEP---PDEIPESDRD 403
           +G   ++LK +       + ++  GGYN    S     +  +L+ +    P EI + D D
Sbjct: 330 HGLTRNILKLVQAHKFKKIALLGGGGYNGRLQSRFYAYLTSMLLAQCKGIPTEIGD-DED 388

Query: 404 PKPGVLEMINKVIRVQSKYW 423
                 E+I    +   K+W
Sbjct: 389 ELIRDHELIEMYEQEDYKFW 408

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 91/203 (44%), Gaps = 14/203 (6%)

Query: 175 GAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 233
           GA          R +  +++    G HHA    A GFC  +++++    I K     + K
Sbjct: 198 GATIKLARYASSRQQRTISVNWDGGRHHAFKSKASGFCYVNDIAIL---IQKLRRRGIHK 254

Query: 234 ILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCN 293
           I  +D+D+HHG+G ++AF    NV  IS+H +E G F+PG   G       G+       
Sbjct: 255 ISYLDFDLHHGDGVERAFQHSANVQTISIHMYEEG-FFPG--TGTLKDASSGRNI----- 306

Query: 294 ITWPV-KGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVT-PNCYG 351
           +  PV  G+ D        ++VIP      P++VI+  G D   GD   +  +T      
Sbjct: 307 VNIPVLHGMDDTFLNEVVNRVVIPCLHNHNPEVVIIQCGGDGLIGDKYKEWQLTLKGLTD 366

Query: 352 YMTHMLKSLARGNLCVVLEGGYN 374
            +  +++     N+ ++  GGYN
Sbjct: 367 TIMKVVEDFPSSNIVLLGGGGYN 389

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 91/177 (51%), Gaps = 13/177 (7%)

Query: 200 HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 259
           HHA  Q A GFC  ++V +  + + K     + KI  +D+D+HHG+G +KAF     +  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRKI---KLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 260 ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYI-WAFEQIVIPMA 318
           IS+H +E G F+PG   G+ D   D +G     NI  P+K   D  Y+     +I+ P+ 
Sbjct: 267 ISVHIYEPG-FFPG--TGSLD---DSRGGKNVVNI--PLKHGCDDSYLNLIASKIINPLI 318

Query: 319 REFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYG-YMTHMLKSLARGNLCVVLEGGYN 374
            +  P+++I+  G D   GD   +  +T       + + +K  ++ ++ ++  GGYN
Sbjct: 319 DKHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYN 375

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 95/210 (45%), Gaps = 19/210 (9%)

Query: 170 RLSCGGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYP 228
           +++ G  +   K +V       + I    G HHA  + A GFC  +++ +  + + K   
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 229 ESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGK 288
              +KI  +D+D+HHG+G +KAF    ++  ISLH FE G F+PG         G    K
Sbjct: 246 -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPG--------TGGLSNK 295

Query: 289 GFNCNITWPVK-GVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTP 347
           G    I  P+  G+ D       +QI+IP       + +++  G D   GD   +  +T 
Sbjct: 296 GSRDLIDIPLSHGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTI 355

Query: 348 NCYGYMTHMLKSLARGNLCVVL---EGGYN 374
              G    ++  + + + C ++    GGYN
Sbjct: 356 K--GLTQCIIDVIGKFSDCQIVLLGGGGYN 383

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 73.6 bits (179), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 90/178 (50%), Gaps = 15/178 (8%)

Query: 200 HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 259
           HH+  + A GFC  +++ +    I K   +  RKI  +D+D+HHG+G +K+F    ++  
Sbjct: 299 HHSRKKKASGFCYVNDIVLC---IQKLGEKGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 260 ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAR 319
           IS+H FE G F+P    G+ ++       GFN      + G+ D    +   +++IP+ +
Sbjct: 356 ISVHLFEPG-FFPC--TGSLEET----KHGFNIVNIPTLHGLDDNYLTYLLNRVIIPLIK 408

Query: 320 EFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVL---EGGYN 374
           + +P+ ++V  G D   GD   +  +T +  G   +++  L     C V+    GGYN
Sbjct: 409 KHKPECLVVQCGGDGLIGDRYKEWQMTIS--GLTKNIMLVLQNFPECSVVLLGGGGYN 464

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 98/204 (48%), Gaps = 14/204 (6%)

Query: 174 GGAIEACKAVVEGRVKNALAIVRPPG-HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVR 232
           G ++     + +   +  +AI    G HHA    A GFC  +++ +  + + K   + + 
Sbjct: 196 GASLMLSDFIEKSSSQRTIAINWDGGRHHAIKNKASGFCYINDIVILIQKLRK---KGIS 252

Query: 233 KILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNC 292
           K+  +D+D+HHG+G +KAF    N+  IS+H +E G F+P    G+ +   +GK      
Sbjct: 253 KVSYIDFDLHHGDGVEKAFRYSSNIQTISMHMYEPG-FFPC--TGSLEDTLNGKNI---- 305

Query: 293 NITWPV-KGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVT-PNCY 350
            +  P+  GV D        +++ P+     P+++++  G D   GD   +  +T     
Sbjct: 306 -VNVPLYHGVDDNYMTEIVNELIKPLIERHSPEVLVIQCGGDGLIGDKFEEWQLTISGLT 364

Query: 351 GYMTHMLKSLARGNLCVVLEGGYN 374
             + ++++   + ++ ++  GGYN
Sbjct: 365 RNIQNLIEWFPKSDIILLGGGGYN 388

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 82/331 (24%), Positives = 137/331 (41%), Gaps = 72/331 (21%)

Query: 159 VYLNNDSYISARLSCGGAIEACKAVVEG----RVKN-ALAIVRPPGHHAEPQAAGGFCLF 213
           +YL++ +  + + S G       ++ EG     V N A  ++RPPGHH       GFCL 
Sbjct: 147 IYLSSKTIEALQGSIGALETGVDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLL 206

Query: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ------------------------- 248
           +N  V+ +    TY   +   +++D+D+HHG+GTQ                         
Sbjct: 207 NNAHVSIEYAHDTY--GITHAVVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYDEFG 264

Query: 249 KAFYEDDNVLYISLHRFELGKFYPGFP-EGNYDKVGDGKGKGFNCNITWPV-----KGVG 302
           K F E   V Y S+H         G+  + N          G + NI W V     +   
Sbjct: 265 KKFAEFPRVGYFSMHDINSFPTESGYATKDNIKSASTCIMNGHDLNI-WNVHLSAWETEE 323

Query: 303 DVEYIWA-------------FEQIVIPMA---REFRPDLVIVSSGFDAAHGDTIG-QCH- 344
           D   ++              F+   I M+   ++F+  LV++S+GFDA+  + +  Q H 
Sbjct: 324 DFNKLYQSKYRTLFAKADEFFKNAKIEMSAKGKKFK-GLVVISAGFDASEFEQVSMQRHG 382

Query: 345 --VTPNCYGYMTHMLKSLAR----GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIP 398
             V  N Y   T     LA+    G +  VLEGGY+  +I++   A    LIG     + 
Sbjct: 383 VNVPTNFYTMFTKDALKLAQMHSEGKVLSVLEGGYSDKAITSGVFA---HLIG-----LQ 434

Query: 399 ESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
             +   + G  +++ +++R     WK ++ K
Sbjct: 435 NQNWIKEWGSEQVVKEIVRGCKPNWKPYKSK 465

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 88/332 (26%), Positives = 140/332 (42%), Gaps = 70/332 (21%)

Query: 156 GDSVYLNNDSYISARLSCGGAIEA-CKAVVEG----RVKN-ALAIVRPPGHHAEPQAAGG 209
           GD +YL++ + I A     GAIE    ++ +G     + N A   +RPPGHH       G
Sbjct: 147 GD-IYLSSKT-IKALQGTIGAIETGVDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSG 204

Query: 210 FCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ--------------------- 248
           FCL +N  VA +    TY  +V  ++++D+D+HHG+GTQ                     
Sbjct: 205 FCLLNNAHVAIEYAYDTY--NVTHVVVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYD 262

Query: 249 ---KAFYEDDNVLYISLHRFELGKFYPGFP-EGNYDKVGDGKGKGFNCNI------TWPV 298
              K F E   V Y S+H         GF  + N            + NI       W  
Sbjct: 263 DFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTT 322

Query: 299 KGVGDVEY------IWA-----FEQIVIPMAREFRP--DLVIVSSGFDAAHGD-TIGQCH 344
           +   +V Y      ++A     F    + M ++ RP   LV++S+GFDA+  + T  Q H
Sbjct: 323 EEEFNVLYRTKYRTLFAKADEFFRSAKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRH 382

Query: 345 ---VTPNCYGYMTHMLKSLAR----GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEI 397
              V  + Y   T     LA+    G +  ++EGGY+  +I +   A    LIG     +
Sbjct: 383 SVNVPTSFYTTFTKDALKLAQMHCHGKVLSLMEGGYSDKAICSGVFAH---LIG-----L 434

Query: 398 PESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
              D   + G  +++ +++R     WK ++ K
Sbjct: 435 QNQDWVKEWGSEQVVKEIVRGCKPAWKPYKTK 466

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 130/331 (39%), Gaps = 72/331 (21%)

Query: 159 VYLNNDSYISARLSCGGAIEAC------KAVVEGRVKNALAIVRPPGHHAEPQAAGGFCL 212
           +YL+  + ISA     GA+E           VE     A   +RPPGHH+      GFCL
Sbjct: 148 IYLSRQT-ISALEGSIGALETGVDSIFHGPSVEQTSNRAFVALRPPGHHSHASTPSGFCL 206

Query: 213 FSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-----KAFYEDDNVLYISLHRFEL 267
            +N  +A +    TY   V   +++D+D+HHG+GTQ     +A ++ D          E 
Sbjct: 207 LNNAHIAIEYAADTY--GVTHAVVLDFDLHHGDGTQDICWKRAGFKPDGCDDGGSEYNEF 264

Query: 268 GKFYPGFPEGNYDKVGD--------GKGKGFNC-NITWPVKGVGDV-------------- 304
           GK +  FP+  Y  + D        G     N  N    +    DV              
Sbjct: 265 GKKFAEFPKVGYFSLHDINSFPTELGYATKENVRNAATCIMDAHDVNIWNVHLQSYDSDE 324

Query: 305 ------------------EYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVT 346
                             EY    +Q +  + + F+  LV++S+GFDA+  +        
Sbjct: 325 AFTKLYQTKYRTLFAKADEYFRTAKQNMRALGKPFK-GLVVISAGFDASEYEQPSMQRHA 383

Query: 347 PNC----YGYMTHMLKSLAR----GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIP 398
            N     Y   T     LA+    G L  VLEGGY+  +IS+   A    LIG     + 
Sbjct: 384 VNVPTFFYNLFTKDALKLAQMHSHGKLLSVLEGGYSDGAISSGVFA---HLIG-----LQ 435

Query: 399 ESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
             +   + G  +++ +++R     WK ++ K
Sbjct: 436 NQNWINEWGSAQVVKEIVRGCKPQWKPYKTK 466

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 84/352 (23%), Positives = 145/352 (41%), Gaps = 72/352 (20%)

Query: 139 ESTEKMTREEL-LSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEG----RVKN-AL 192
           E+ EK+ + E+ + ++     +YL++ +  + + + G       ++ +G     + N A 
Sbjct: 126 EADEKLAKGEIEVPESWNAGDIYLSSKTIQALQGTIGALETGVDSIFKGPSADHISNRAF 185

Query: 193 AIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ---- 248
             +RPPGHH       GFCL +N  VA +    TY   V  + ++D+D+HHG+GTQ    
Sbjct: 186 VAIRPPGHHCHFATPSGFCLLNNAHVAIEYAADTY--GVTHVAVLDFDLHHGDGTQDLCW 243

Query: 249 --KAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG----KGFNC-----NITWP 297
               F  D+++        + GK +  FP+  Y  + D        GF       N +  
Sbjct: 244 KRAGFKPDEDINPKEGEYDDFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTC 303

Query: 298 VKGVGDVEYIWA------------------------------FEQIVIPMAREFRP--DL 325
           +    D+  IW                               F+   + MA   RP   +
Sbjct: 304 LMNSHDLN-IWNIHMSNWNNEEEFVKLYRSKYRVLFAKADEYFKTAKLEMAALGRPFKGM 362

Query: 326 VIVSSGFDAAHGD-TIGQCH---VTPNCYGYMTHMLKSLA----RGNLCVVLEGGYNLDS 377
           V++S+GFDA+  + T  Q H   V    Y   T     LA    +G +  ++EGGY+  +
Sbjct: 363 VLISAGFDASEFEQTTMQRHGSNVPTEFYTMFTKDALKLAQMHCQGKVLSLMEGGYSDKA 422

Query: 378 ISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
           I++   A    LIG     +   D   + G   +I +++R     WK ++ K
Sbjct: 423 ITSGVFAH---LIG-----LQNQDWIKEWGSEHVIKEIVRGCKPAWKPYKTK 466

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 108/234 (46%), Gaps = 30/234 (12%)

Query: 200 HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 259
           HHA    A GFC  +++ +  + + K   +   K+  +D+D+HHG+G ++AF     V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 260 ISLHRFELGKFYP--GFPEGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIP 316
           ISLH +E G F+P  G  EG+          GF+  +  P++ G+ D       +Q+V P
Sbjct: 263 ISLHLYEPG-FFPCTGSLEGS---------SGFD-TVNLPLQHGLTDSFLQGLVDQVVNP 311

Query: 317 MAREFRPDLVIVSSGFDAAHGDTIGQCHVT----PNCYGYMTHMLKSLARGNLCVVLEGG 372
           + +   P+++++  G D   GDT  +  ++      C   +  ++    + ++ ++  GG
Sbjct: 312 LIQRHGPEVIVIQCGGDGLLGDTFHEWQLSIRGLTKC---ILDVMSHSTQAHVILLGGGG 368

Query: 373 YNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCF 426
           YN   +S         L G    +   +  DP PG+     + +    KY +C+
Sbjct: 369 YNPTLMSR----FYTYLTGRILHQFKNT--DPFPGMNGAQEESLIRDHKYIECY 416

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 84/332 (25%), Positives = 134/332 (40%), Gaps = 70/332 (21%)

Query: 156 GDSVYLNNDSYISARLSCGGAIEA-CKAVVEG----RVKN-ALAIVRPPGHHAEPQAAGG 209
           GD +YL++ + I A     GAIE    ++ EG     + N A   +RPPGHH       G
Sbjct: 147 GD-IYLSSKT-IKALQGTIGAIETGVDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSG 204

Query: 210 FCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ--------------------- 248
           FCL +N  VA +    TY  +V  ++++D+D+HHG+GTQ                     
Sbjct: 205 FCLLNNAHVAIEYAYDTY--NVTHVVVLDFDLHHGDGTQDICWKRAGFKPEEEPENSSYD 262

Query: 249 ---KAFYEDDNVLYISLHRFELGKFYPGFP-EGNYDKVGDGKGKGFNCNI------TWPV 298
              K F E   V Y S+H         GF  + N            + NI       W  
Sbjct: 263 EFDKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTT 322

Query: 299 KGVGDVEYIWAFEQIVIPMAREFRP-------------DLVIVSSGFDAAHGD-TIGQCH 344
           +   ++ Y   +  +       FR               LV++S+GFDA+  + T  Q H
Sbjct: 323 EEEFNILYRTKYRTLFAKADEFFRSAKQEMNQNEKPFKGLVVISAGFDASEFEQTSMQRH 382

Query: 345 ---VTPNCYGYMTHMLKSLAR----GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEI 397
              V  + Y   T     LA+    G +  ++EGGY+  +I +   A    LIG     +
Sbjct: 383 SVNVPTSFYTTFTKDALKLAQMHCHGKVLSLMEGGYSDKAICSGVFAH---LIG-----L 434

Query: 398 PESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
              D   + G  +++ +++R     WK ++ +
Sbjct: 435 QNQDWVKEWGSEQVVKEIVRGCKPAWKPYKTR 466

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 84/349 (24%), Positives = 138/349 (39%), Gaps = 71/349 (20%)

Query: 142 EKMTREEL-LSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEG----RVKN-ALAIV 195
           EK+ R E+ + K      +YL++ +  + R + G        +  G     + N    +V
Sbjct: 128 EKLARGEIEVPKEWNAGDIYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVVV 187

Query: 196 RPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDD 255
           RPPGHH       GFCL +N  ++ +    TY   V    I+D+D+HHG+GTQ   ++  
Sbjct: 188 RPPGHHCHVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQDICWKRA 245

Query: 256 NVLYISLHRFE-------LGKFYPGFPEGNYDKVGD------GKGKGFNCNITWPVKGVG 302
                   R E        GK    FP+  Y  + D        G   + NI      + 
Sbjct: 246 GFKPDGATREENEEPYDDFGKRTAAFPKVGYFSMHDINSFPTESGYATSENIRNASTCIM 305

Query: 303 DVEYI---------WA-----------------------FEQIVIPMAREFRP--DLVIV 328
           D   +         WA                       F+   + M ++  P   LV++
Sbjct: 306 DSHDLNIWNVHLAPWATEEDFMKLYRSKYRTLFAKADEYFKTARLEMQKQGTPFKGLVVI 365

Query: 329 SSGFDAAHGD-TIGQCH---VTPNCYGYMTHMLKSLA----RGNLCVVLEGGYNLDSISN 380
           S+GFDA+  + T  Q H   V    Y   T  +  LA    +G +  V+EGGY+  +I++
Sbjct: 366 SAGFDASEFEQTSMQRHSVNVPTEFYTLFTKDVLKLAQMHTQGKVLSVMEGGYSDKAITS 425

Query: 381 SALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
              A    LIG     +   D   + G  +++ +++R     WK ++ K
Sbjct: 426 GVFA---HLIG-----LQNQDWIREWGSEQVVKEIVRGCKPNWKPYKTK 466

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 120/294 (40%), Gaps = 67/294 (22%)

Query: 191 ALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-- 248
           A   +RPPGHH+      GFCL +N  +A +     Y   V    I+D+D+HHG+GTQ  
Sbjct: 184 AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQDI 241

Query: 249 ---KAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGD------GKGKGFNCNITWPVK 299
              +A ++ D+    +    + GK +  FP+  Y  + D       +G     +I     
Sbjct: 242 CWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDINSFPTEQGYAHKTSIKDASV 301

Query: 300 GVGDVE--YIW-----AFE-------------QIVIPMAREF--------------RPDL 325
            + D     IW     A+E             + +   A EF                 L
Sbjct: 302 CIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKADEFLRVSQKRMASEGKNYKGL 361

Query: 326 VIVSSGFDAAHGDTIGQ----CHVTPNCYGYMTHMLKSLA----RGNLCVVLEGGYNLDS 377
           +I+S+GFDA+  + +       HV  + Y   T     LA    +G L  +LEGGY    
Sbjct: 362 IIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKLAQMHTQGKLLSLLEGGY---- 417

Query: 378 ISNSAL--AVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
            S++AL   V   LIG     +   +  P+ G  ++I +V R     WK ++ K
Sbjct: 418 -SDAALVSGVFSHLIG-----MQNQNWIPEWGSAQVIKEVCRGCRPNWKAYKTK 465

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 85/177 (48%), Gaps = 13/177 (7%)

Query: 200 HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 259
           HHA    A GFC  +++ +  +S+ +   +  +++  +D+D+H+G+G  KAF   +NV  
Sbjct: 193 HHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAKAFRFSENVQT 249

Query: 260 ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPV-KGVGDVEYIWAFEQIVIPMA 318
           IS+H +E G F+PG   G+ ++  + K       +  PV  G+ D   +     ++ P+ 
Sbjct: 250 ISVHLYEPG-FFPG--TGSLEETRNSKQM-----VNLPVLHGMDDKYLLELISSVITPLI 301

Query: 319 REFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVL-EGGYN 374
             F  + +++  G D   GD   +  ++     +    +  + R     +L  GGYN
Sbjct: 302 ETFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLLGGGGYN 358

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 91/379 (24%), Positives = 152/379 (40%), Gaps = 97/379 (25%)

Query: 126 ILDVH----TEEHMQFL-ESTEKMTRE--ELLSKTEKGDSVYLNNDSYISARLSCGGAIE 178
           +L VH     +E +Q   +S+EK+  +  E+      GD +YL+  +  +   S G    
Sbjct: 109 VLKVHGTDWPKELLQLCKQSSEKLAHKQVEVPDDWNVGD-IYLSQQTIAALEGSIGALET 167

Query: 179 ACKAVVEGRVK-----NALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRK 233
              ++ +G  +      A   VRPPGHH+      GFCL +N  +A +    T+  +V  
Sbjct: 168 GIDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADTF--NVTH 225

Query: 234 ILIVDWDIHHGNGTQKAFY---------EDDNVLYISLHRFELGKFYPGFPEGNYDKVGD 284
            +++D+D+HHG+GTQ   +         +DD+  Y      E GK +  FP+  Y  + D
Sbjct: 226 AVVLDFDLHHGDGTQDICWKRAGFNPDEQDDDPAYD-----EFGKKFAEFPKVGYFSMHD 280

Query: 285 --------GKGKGFNC-NITWPVKGVGDVEYIWA-------------------------- 309
                   G     N  N +  +    D+  IW                           
Sbjct: 281 INSFPTELGYATKENIKNASTCIMNAHDLN-IWNVHLSHYETEEDFVKLYQSKYRSLFAK 339

Query: 310 ----FEQIVIPMAREFR--PDLVIVSSGFDAA---------HGDTIGQCHVTPNCYGYMT 354
               F+     MA + +    LV++S+GFDA+         HG  +  C      Y   T
Sbjct: 340 ADEFFKNAKKEMASQGKKFKGLVVISAGFDASEYEQPSMQRHGVNVPTC-----FYNMFT 394

Query: 355 HMLKSLAR----GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLE 410
                LA+    G +  V+EGGY+  +IS+    V   LIG     +   +   + G  +
Sbjct: 395 KDALKLAQMHTSGKVLSVMEGGYSDGAISS---GVFSHLIG-----LQNQNWINEWGSAQ 446

Query: 411 MINKVIRVQSKYWKCFRRK 429
           ++ ++IR     WK ++ K
Sbjct: 447 VVKEIIRGCKPQWKPYKTK 465

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 82/332 (24%), Positives = 133/332 (40%), Gaps = 70/332 (21%)

Query: 156 GDSVYLNNDSYISARLSCGGAIEA-CKAVVEG----RVKN-ALAIVRPPGHHAEPQAAGG 209
           GD +YL++ + I A     GAIE    ++ +G     + N A   +RPPGHH       G
Sbjct: 147 GD-IYLSSKT-IQALQGTIGAIETGVDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSG 204

Query: 210 FCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ--------------------- 248
           FCL +N  VA +    TY   V  ++++D+D+HHG+GTQ                     
Sbjct: 205 FCLLNNAHVAIEYAFDTY--DVTHVVVLDFDLHHGDGTQDICWKRAGFKPEEESENSSYD 262

Query: 249 ---KAFYEDDNVLYISLHRFELGKFYPGFP-EGNYDKVGDGKGKGFNCNI------TWPV 298
              K F E   V Y S+H         GF  + N            + NI       W  
Sbjct: 263 NFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTT 322

Query: 299 KGVGDVEYIWAFEQIVIPMAREFRP-------------DLVIVSSGFDAAHGD-TIGQCH 344
           +   ++ Y   +  +       F+               LV++S+GFDA+  + T  Q H
Sbjct: 323 EEDFNILYRTKYRTLFAKADEFFKTAKLEMNQQEKTFKGLVVISAGFDASEFEQTSMQRH 382

Query: 345 ---VTPNCYGYMTHMLKSLAR----GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEI 397
              V  + Y   T     LA+    G +  ++EGGY+  +I +   A    LIG     +
Sbjct: 383 SVNVPTSFYTTFTKDALKLAQMHCHGKVLSLMEGGYSDKAICSGVFAH---LIG-----L 434

Query: 398 PESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
              D   + G  +++ +++R     WK ++ +
Sbjct: 435 QNQDWVKEWGSEQVVKEIVRGCKSTWKPYKTR 466

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 119/294 (40%), Gaps = 67/294 (22%)

Query: 191 ALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-- 248
           A   +RPPGHH +     GFCL +N  ++ +     Y   +   +I+D+D+HHG+GTQ  
Sbjct: 187 AFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDI 244

Query: 249 -----------------------KAFYEDDNVLYISLHRFELGKFYPGFPEG-NYDKVGD 284
                                  K F E   V Y S+H         G+    N      
Sbjct: 245 CWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFSMHDINSFPTETGYATKVNIRNAST 304

Query: 285 GKGKGFNCNITW-----PVKGVGDVEYIWA-------------FEQIVIPMAREFRP--D 324
               G + NI W     P     D + ++              F      MA+E +P   
Sbjct: 305 CIMDGHDLNI-WNIHLSPWNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFKG 363

Query: 325 LVIVSSGFDAA-HGDTIGQCH---VTPNCYGYMTHMLKSLA----RGNLCVVLEGGYNLD 376
           LV++S+GFDA+ +  T  Q H   V  N Y   T     LA    +G +  +LEGGY+  
Sbjct: 364 LVVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYSDK 423

Query: 377 SISNSALAVAKILIG-EPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
           ++++   A    LIG +  + I E       G  +++ +++R    +WK ++ K
Sbjct: 424 ALTSGVFAH---LIGFQNQNWINEW------GSEQVVKEIVRGCKPHWKPYKTK 468

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 79/293 (26%), Positives = 122/293 (41%), Gaps = 40/293 (13%)

Query: 200 HHAEPQAAGGFCLFSNVSVAAKSILKTYPES--VRKILIVDWDIHHGNGTQKAFYEDDNV 257
           HHA    A GFC  +++      + KT  +    RK+  +D D+HHG+G + AF    ++
Sbjct: 206 HHAMKSRANGFCYINDIVSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKDI 265

Query: 258 LYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVK-GVGDVEYIWAFEQIVIP 316
             IS+H FE G FYP      +     GK K  N  I  PVK G+ +         I+IP
Sbjct: 266 QIISIHLFEPG-FYPCTGGLKF-----GKPKSNNI-INLPVKHGLSNSNMFELVTNIIIP 318

Query: 317 MAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSLAR----------GNLC 366
           +    + D +++  G D  + D   +  +T    G    ++K +A            N+ 
Sbjct: 319 LIELHQSDDIVILCGGDGLNNDYYNEWQLT--IIGLTRCIIKIIAAFVGPHQPGSCKNVV 376

Query: 367 VVLEGGYN--LDSISNSALAVAKI-LIGEPP-------DEIPESDRDPKPGVL-----EM 411
           ++  GGYN  L S   + L    + L G  P        E+P    D K   L     E 
Sbjct: 377 LLGGGGYNELLASRFYTYLTYKVLQLAGRIPPAATTLAAEVPHGTIDDKDKELLIKDHEH 436

Query: 412 INKVIRVQSKYWKCFRRKFGNFGGEYENAIESQIPKMFPLQDAIRNAQLSHYY 464
           I++  +   KYW C+  + G  G  ++  I     K  P    I  A+L  +Y
Sbjct: 437 IDEYEKEYYKYW-CYEIENGLDGLSFKRQINYNDTKQKPFTKYI--AELRAHY 486

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 82/183 (44%), Gaps = 26/183 (14%)

Query: 200 HHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLY 259
           HHA    A GFC  +++ +  + + K       ++  VD+D+HHG+  + AF    NV  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 260 ISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNITWPVK-----GVGDVEYIWAFEQIV 314
            SLH FE G F+P            G G   NC  T  V      G+ D       + I+
Sbjct: 252 CSLHLFEAG-FFP------------GTGSFKNCRETNVVNIPLFHGLDDESLDEIVDNIL 298

Query: 315 IPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMTHMLKSL---ARGNLCVVLEG 371
           IP   +  P+++++  G D   GD   +  +T   +G   ++LK +   +   + ++  G
Sbjct: 299 IPCVNKHDPEVLVIQCGADGLSGDKYKEWQLT--IHGLTRNILKLVDIHSYKKVVLLGGG 356

Query: 372 GYN 374
           GYN
Sbjct: 357 GYN 359

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 61/135 (45%), Gaps = 25/135 (18%)

Query: 159 VYLNNDSYISARLSCGGAIEACKAVVEGR-----VKNALAIVRPPGHHAEPQAAGGFCLF 213
           +YLN+D+ ++ + S G       ++  G         A   +RPPGHH       GFCL 
Sbjct: 148 IYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRAFVAIRPPGHHCHVGMPSGFCLL 207

Query: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 273
           +N ++  +    TY   V  ++++D+D+HHG+GTQ   ++                   G
Sbjct: 208 NNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQDICWK-----------------RAG 248

Query: 274 F-PEGNYDKVGDGKG 287
           F P+GNY    D  G
Sbjct: 249 FKPDGNYIDEADSTG 263

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 60/130 (46%), Gaps = 18/130 (13%)

Query: 310 FEQIVIPMAREFRP--DLVIVSSGFDAAHGDTIG----QCHVTPNCYGYMTHMLKSLAR- 362
           F+   + MA   +P   LV++SSGFDA+  + +       +V    Y   T     LA+ 
Sbjct: 348 FKAAKLEMASMGKPYKGLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKLAQM 407

Query: 363 ---GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQ 419
              G +  ++EGGY+  +I++   A    LIG     +   D   + G  +++ +++R  
Sbjct: 408 HCHGKVISIMEGGYSDKAITSGVFAH---LIG-----LQNQDWIKEWGSEQVVKEIVRGC 459

Query: 420 SKYWKCFRRK 429
              WK ++ K
Sbjct: 460 KPTWKPYKTK 469

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 83/341 (24%), Positives = 135/341 (39%), Gaps = 71/341 (20%)

Query: 148 ELLSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEG----RVKN-ALAIVRPPGHHA 202
           E+ +    GD +YL++ +  + + S G    A  ++ +G     + N A   +RPPGHH 
Sbjct: 135 EVPASWNAGD-IYLSSKTVEALQGSIGALETAVDSIFDGPSPEHISNRAFVAIRPPGHHC 193

Query: 203 EPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-------------- 248
                 GFCL +N  VA +     +   V    I+D+D+HHG+GTQ              
Sbjct: 194 HVATPSGFCLLNNAHVAIEYAKDRF--GVTHAAILDFDLHHGDGTQDICWKRAGFRPDEE 251

Query: 249 -----------KAFYEDDNVLYISLHRFELGKFYPGFP-EGNYDKVGDGKGKGFNCNITW 296
                      K F E   V Y S+H         G+  + N            + NI W
Sbjct: 252 DEDSPGYDSFGKKFAEYPRVGYFSMHDINSFPTESGYATKENVKNASTCIMNAHDVNI-W 310

Query: 297 -----PVKGVGDVEYIWA-------------FEQIVIPMAREFRP--DLVIVSSGFDAAH 336
                P +   D   ++              F+Q  I MA + +P   LV++SSGFDA+ 
Sbjct: 311 NIHLSPWETEEDFAKLYHTKYRSLFVKADEFFKQGKIEMAAQNKPFKGLVVISSGFDASE 370

Query: 337 GD-TIGQCHVTPNCYGYMTHMLKSLAR-------GNLCVVLEGGYNLDSISNSALAVAKI 388
            + T  Q H T     + T   K   +       G +  ++EGGY+  +I +   A    
Sbjct: 371 FEQTSMQRHGTNVPTYFYTAFTKDALKLSQMHCHGKVLSIMEGGYSDKAIVSGVFA---H 427

Query: 389 LIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
           LIG     +   +   + G   ++ +++R     WK ++ K
Sbjct: 428 LIG-----LQNQNWIKEWGSEHVVKEIVRGCKSNWKPYKTK 463

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 85/350 (24%), Positives = 145/350 (41%), Gaps = 70/350 (20%)

Query: 139 ESTEKMTREEL-LSKTEKGDSVYLNNDSYISARLSCGGAIE-ACKAVVEG----RVKN-A 191
           E+  K+ + E+ +  T     +YL++ + I A     GAIE    ++ +G     + N A
Sbjct: 128 EADSKLLKGEIEVPDTWNSGDIYLSSKT-IKALQGTIGAIETGVDSIFKGPSPEHISNRA 186

Query: 192 LAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ--- 248
              +RPPGHH       GFCL +N  VA +     Y  +V  ++++D+D+HHG+GTQ   
Sbjct: 187 FVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NVTHVVVLDFDLHHGDGTQDIC 244

Query: 249 ---------------------KAFYEDDNVLYISLHRFELGKFYPGFP-EGNYDKVGDGK 286
                                K F E   V Y S+H         GF  + N        
Sbjct: 245 WKRAGFKPEEEAKDTSYDDFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTCI 304

Query: 287 GKGFNCNI------TWPVKGVGDVEY------IWA-----FEQIVIPMAREFRP--DLVI 327
               + NI       W  +   ++ Y      ++A     F+   + M ++ +    LV+
Sbjct: 305 MNSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADEFFKSAKVEMKQQGKSFEGLVV 364

Query: 328 VSSGFDAAHGD-TIGQCH-VTPNCYGYMTHMLKSL------ARGNLCVVLEGGYNLDSIS 379
           +S+GFDA+  + T  Q H V    Y Y T    +L        G +  ++EGGY+  +I 
Sbjct: 365 ISAGFDASEFEQTSMQRHSVNVPTYFYTTFTKDALKLAQMHCHGKVLSLMEGGYSDKAIC 424

Query: 380 NSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
           +   A    LIG     +   D   + G  +++ +++R     WK ++ +
Sbjct: 425 SGVFAH---LIG-----LQNQDWVNEWGSEQVVKEIVRGCKPAWKPYKTR 466

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 120/307 (39%), Gaps = 71/307 (23%)

Query: 184 VEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHH 243
           VE     A   +RPPGHH+      GFCL +N  +A +   + Y   V   +I+D+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 244 GNGTQ-----KAFYEDDNVLYISLHRF--------ELGKFYPGFPEGNYDKVGDGK---- 286
           G+GTQ     +A +  D     + H          E GK +  FP+  Y  + D      
Sbjct: 234 GDGTQDICWKRAGFRPDEFSTDAEHGASEDDNKYDEFGKSFAEFPKVGYFSLHDINSFPT 293

Query: 287 --GKGFNCNITWPVKGVGDV-----------------EYIWAFE---QIVIPMAREFRPD 324
             G     NI      + D                  E++  ++   + +   A EF  +
Sbjct: 294 ELGYATKENIRNASTCIMDAHDINIWNVHLQSYKDEEEFVKLYQTKYRSIFAKADEFFKN 353

Query: 325 --------------LVIVSSGFDAAHGDTIG----QCHVTPNCYGYMTHMLKSLAR---- 362
                         LV++S+GFDA+  +         +V  + Y   T     LA+    
Sbjct: 354 AKLEMKQGGFRFKGLVVISAGFDASEYEQQSMQRHNVNVPTSFYNLFTKDALKLAQMHSN 413

Query: 363 GNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKY 422
           G +  V+EGGY+  +I   A  V   LIG         +   + G  +++ ++IR     
Sbjct: 414 GKIISVMEGGYSDGAI---ASGVFSHLIG-----FQNQNWISEWGSEQVVKEIIRGCKPR 465

Query: 423 WKCFRRK 429
           WK ++ K
Sbjct: 466 WKPYKTK 472

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 116/296 (39%), Gaps = 67/296 (22%)

Query: 191 ALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-- 248
           A   +RPPGHH       GFCL +N  +A +   + Y   V   +I+D+D+HHG+GTQ  
Sbjct: 186 AFVAIRPPGHHCHVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQDI 243

Query: 249 ----KAFYEDDNVLYISLHRFE---LGKFYPGFPEGNYDKVGD------GKGKGFNCNIT 295
                 F  DD  +     + E    GK    FP+  Y  + D        G     NI 
Sbjct: 244 CWKRAGFKPDDGNVQDDEDKNEYDDFGKKMADFPKVGYFSMHDINSFPTESGYATKDNIK 303

Query: 296 WPVKGVGDVEYI---------WAFEQ-----------IVIPMAREFRPD----------- 324
                V D   +         WA E+            +   A EF  +           
Sbjct: 304 NASTCVMDAHDLNIWNVHLQTWATEEDFNKLYQTKYRTLFAKADEFFKNAKNQMQEMNKP 363

Query: 325 ---LVIVSSGFDAAHGD-TIGQCH---VTPNCYGYMTHMLKSLAR----GNLCVVLEGGY 373
              LV++S+GFDA+  + T  Q H   V  + Y   T     LA+    G +  VLEGGY
Sbjct: 364 FKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSVLEGGY 423

Query: 374 NLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
           +  +I   A  V   LIG     +   +   + G  ++I +++R     W  ++ K
Sbjct: 424 SDKAI---ASGVFSHLIG-----LQNQNWIKEWGSEQVIKEIVRGCKPSWTPYKTK 471

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 83/347 (23%), Positives = 142/347 (40%), Gaps = 69/347 (19%)

Query: 142 EKMTREEL-LSKTEKGDSVYLNNDSYISARLSCGGAIEACKAVVEG----RVKN-ALAIV 195
           EK+ + E+ +  +     +YL++ +  + + S G       ++  G     + N A   +
Sbjct: 130 EKLAKGEIEVPASWNAGDIYLSSRTIEALQGSIGALETGVDSIFSGPSPDHISNRAFVAI 189

Query: 196 RPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-----KA 250
           RPPGHH       GFCL +N  +A +    TY   +   +I+D+D+HHG+GTQ     +A
Sbjct: 190 RPPGHHCHVDTPSGFCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDICWKRA 247

Query: 251 FYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG---------KGFNCNITWPVKGV 301
            +  +     +    E GK +  FP+  Y  + D            K    N +  V   
Sbjct: 248 GFRTEAEPETTEGYDEFGKKFAEFPKVGYFSMHDINSFPTESQYATKENIRNASTCVMNA 307

Query: 302 GDVEYI------WAFEQ-----------IVIPMAREF------------RP--DLVIVSS 330
            DV         W  EQ            +   A EF            +P   LV++S+
Sbjct: 308 HDVNIWNIHLSPWETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQGLVVISA 367

Query: 331 GFDAAHGD-TIGQCH---VTPNCYGYMTHMLKSLAR----GNLCVVLEGGYNLDSISNSA 382
           GFDA+  + T  Q H   V  + Y   T     L++    G +  ++EGGY+  +I   A
Sbjct: 368 GFDASEFEQTSMQRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYSDKAI---A 424

Query: 383 LAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
             V   LIG     +   +   + G  +++ +++R    +WK ++ K
Sbjct: 425 SGVFSHLIG-----LQNQNWIKEWGSEQVVKEIVRGCKPHWKPYKTK 466

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 122/293 (41%), Gaps = 66/293 (22%)

Query: 191 ALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-- 248
           A   +RPPGHH+      GFCL +N  +A +    TY  +V   +++D+D+HHG+GTQ  
Sbjct: 187 AFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NVTHAVVLDFDLHHGDGTQDI 244

Query: 249 ---KAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGK------GKGFNCNITWPVK 299
              +A ++ D     S    E GK +  +P+  Y  V D        G     NI     
Sbjct: 245 CWKRAGFKPDECA-DSGEFDEFGKKFAEYPKVGYFSVHDINSFPTELGYATKENIRNAAT 303

Query: 300 GVGDVE--YIW-----------AF----------------------EQIVIPMAREFRPD 324
            + D     IW           AF                      +Q +  + + F+  
Sbjct: 304 CIMDAHDVNIWNVHLQPYDSEEAFTKLYQTKYRTLFAKADEFFRISKQTMKALGKPFK-G 362

Query: 325 LVIVSSGFDAAHGD--TIGQCHVTPNCYGYMTHMLKSL------ARGNLCVVLEGGYNLD 376
           LV++S+GFDA+  +  ++ +  V    + Y T    +L      + G +  V+EGGY+  
Sbjct: 363 LVVISAGFDASEYEQPSMQRHAVNVPTFFYNTFTKDALKLAQMHSHGKVLSVMEGGYSDG 422

Query: 377 SISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
           +I++   A    LIG     +       + G  +++ +++R     WK ++ K
Sbjct: 423 AITSGVFA---HLIG-----LQNQSWINEWGSAQVVKEIVRGCKPNWKPYKTK 467

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 87/368 (23%), Positives = 147/368 (39%), Gaps = 75/368 (20%)

Query: 126 ILDVHTEEHMQFL-----ESTEKMTREEL-LSKTEKGDSVYLNNDSYISARLSCGGAIEA 179
           +L VH  E  + L     +S  K+ R E+ +        +YL + +  + + + G     
Sbjct: 106 VLKVHGSEWPRTLLQLCKQSDSKLARGEVEVPDNWNAGDIYLTSRTIEALQGTIGAVETG 165

Query: 180 CKAVVEG----RVKNALAI-VRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 234
             ++  G     + N + + +RPPGHH       GFCL +N  +  +     Y   V   
Sbjct: 166 VDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--GVTHA 223

Query: 235 LIVDWDIHHGNGTQ------------------------KAFYEDDNVLYISLHRFELGKF 270
           +I+D+D+HHG+GTQ                        K F E   V Y S+H       
Sbjct: 224 VILDFDLHHGDGTQDLCWKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSMHDINSFPT 283

Query: 271 YPGFP-EGNYDKVGDGKGKGFNCNITWPV---KGVGDVEYIWAFE---QIVIPMAREF-- 321
             GF  + N            + NI W V   +   + E+   ++   + +   A EF  
Sbjct: 284 ESGFATKENIKNASTCIMNSHDLNI-WNVHLSRWSTEEEFAKIYKSKYRTLFAKADEFFK 342

Query: 322 ----------RP--DLVIVSSGFDAAHGD-TIGQCH---VTPNCYGYMTHMLKSLA---- 361
                     +P   LV++S+GFDA+  + T  Q H   V  + Y   T     LA    
Sbjct: 343 NSKNEMNELGKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQMHC 402

Query: 362 RGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINKVIRVQSK 421
           +G +  +LEGGY+  +I++    V   LIG     +   D   + G  +++ +++R    
Sbjct: 403 QGKVLSLLEGGYSDKAITS---GVFSHLIG-----LQNQDWINEWGSEQVVKEIVRGCKP 454

Query: 422 YWKCFRRK 429
            WK ++ K
Sbjct: 455 SWKPYKTK 462

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 77/330 (23%), Positives = 133/330 (40%), Gaps = 70/330 (21%)

Query: 159 VYLNNDSYISARLSCGGAIEACKAVVEG----RVKN-ALAIVRPPGHHAEPQAAGGFCLF 213
           +YL++ +  + + S G    A  ++ +G     + N A   +RPPGHH       GFC+ 
Sbjct: 147 IYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSGFCVL 206

Query: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQ-----KAFYEDDNVLYISLHRFELG 268
           +N  VA +    +Y   V  + ++D+D+HHG+GTQ     +A ++ D     +      G
Sbjct: 207 NNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQDICWKRAGFKPDEETKENEEYDGFG 264

Query: 269 KFYPGFPEGNYDKVGDGKG----KGFNC-----NITWPVKGVGDVEYIWAFE-------- 311
           K    FP   Y  + D        GF       N +  +    D+  IW           
Sbjct: 265 KKLAEFPRVGYFSMHDINSFPTESGFATKENIKNASTCIMNSHDLN-IWNIHLSSWSNEE 323

Query: 312 ----------QIVIPMAREF------------RP--DLVIVSSGFDAAHGDT-IGQCH-- 344
                     +++   A EF            +P   L+++S+GFDA+  +    Q H  
Sbjct: 324 EFSKLYRSKYRLLFAKADEFFKTAKSEMADMGKPFKGLILLSAGFDASEFEQKTMQRHSV 383

Query: 345 -VTPNCYGYMTHMLKSLA----RGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPE 399
            V    Y   T     LA    +G +  ++EGGY+  +I++   A    LIG     +  
Sbjct: 384 NVPTEFYTMFTKDALKLAQMHCQGKVLSLMEGGYSDKAITSGVFAH---LIG-----LQN 435

Query: 400 SDRDPKPGVLEMINKVIRVQSKYWKCFRRK 429
            D   + G   ++ +++R     WK ++ K
Sbjct: 436 QDWIKEWGSEHVVKEIVRGCKPAWKPYKTK 465

>KNAG0B05980 Chr2 (1171306..1172601) [1296 bp, 431 aa] {ON}
           Anc_4.234 YLR380W
          Length = 431

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 49/90 (54%), Gaps = 9/90 (10%)

Query: 497 CVLLHDTP----EVWGNRDIITGIIDP--STSIIFDSSLKFINWAIERETAVIDINIPRS 550
            +L+H  P     +W   +II   +DP  ++ I+F  ++K ++  I ++   + +    +
Sbjct: 281 ALLIHKAPWLFSPIW---NIIKTWLDPVVASKIVFTKNIKELSRYIGQQELPVYMEGKNN 337

Query: 551 AFEADNYSSNLLSQDVMISLWDNHFKYIES 580
           A + D+YS    SQD ++++ D++FK + +
Sbjct: 338 ALDLDHYSPPDGSQDKLLNVKDDNFKKLST 367

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,789,422
Number of extensions: 3605083
Number of successful extensions: 9399
Number of sequences better than 10.0: 104
Number of HSP's gapped: 9342
Number of HSP's successfully gapped: 116
Length of query: 701
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 584
Effective length of database: 40,065,477
Effective search space: 23398238568
Effective search space used: 23398238568
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)