Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C033802.284ON69769736440.0
Kpol_1003.352.284ON71332413850.0
TDEL0G021502.284ON66131913411e-176
Kwal_27.115422.284ON79137813311e-173
NCAS0B062602.284ON72335113181e-172
KLTH0G10318g2.284ON79035713201e-172
KLLA0E08405g2.284ON77744613161e-171
KAFR0J013702.284ON78032013161e-171
Suva_9.1042.284ON80537213141e-171
Smik_9.842.284ON80832313131e-170
SAKL0E07722g2.284ON79135913011e-169
YIL095W (PRK1)2.284ON81032313011e-168
NDAI0B035602.284ON75631812941e-168
NDAI0G006402.284ON62131912801e-168
Skud_9.782.284ON80932312861e-166
KAFR0H033302.284ON36931612311e-164
ZYRO0A01848g2.284ON70432212551e-163
Kpol_1039.332.284ON70132412451e-161
CAGL0G02607g2.284ON68832412311e-160
TBLA0B059302.284ON71731712231e-158
ADL217W2.284ON75035212251e-158
Skud_14.3092.284ON63933712101e-157
KNAG0H020202.284ON59231612021e-157
YNL020C (ARK1)2.284ON63831812001e-156
Smik_14.3112.284ON63731311881e-154
Suva_14.3272.284ON63240011881e-154
Ecym_33232.284ON74835111901e-153
TBLA0B069402.284ON144332111891e-146
KNAG0A054302.284ON78832811261e-143
CAGL0J03432g2.284ON62234911051e-142
TPHA0D015402.284ON70731110611e-134
KNAG0J008203.273ON10913277851e-90
Kpol_251.43.273ON8383157616e-89
SAKL0D03234g3.273ON8583207582e-88
KAFR0A010403.273ON9123287516e-87
KNAG0H012203.273ON9133277482e-86
CAGL0H10208g3.273ON10273247522e-86
YBR059C (AKL1)3.273ON11083277501e-85
NCAS0A105903.273ON10953197492e-85
Skud_2.1793.273ON10903487492e-85
Suva_4.2973.273ON11073277473e-85
Smik_2.1913.273ON11083487465e-85
Kpol_1052.223.273ON11013167431e-84
TPHA0M011203.273ON7883187281e-84
TBLA0E025903.273ON10613217384e-84
ZYRO0E06864g3.273ON11153237394e-84
KLLA0F18612g3.273ON8143197248e-84
TDEL0D035203.273ON10493207331e-83
CAGL0K11990g3.273ON9913227302e-83
Ecym_26503.273ON8943137201e-82
KAFR0C004303.273ON9493277231e-82
KLTH0C07260g3.273ON9013077182e-82
TPHA0A040303.273ON10543247225e-82
NDAI0A057003.273ON11573337178e-81
Kwal_27.109453.273ON9353087053e-80
TBLA0I019303.273ON13613687093e-79
AGR027C3.273ON9613116896e-78
Kwal_56.242746.262ON3463392432e-21
SAKL0A03344g6.262ON3643562389e-21
KLTH0H03080g6.262ON3463352316e-20
YPL236C (ENV7)6.262ON3643332317e-20
Ecym_21536.262ON3633542273e-19
Suva_16.706.262ON3643462273e-19
SAKL0H06754g8.668ON8841962333e-19
TDEL0A067506.262ON3723502264e-19
KAFR0A050906.31ON6682422324e-19
Skud_16.426.262ON3643332246e-19
Smik_6.4416.262ON3643332221e-18
NCAS0D021006.31ON7262782234e-18
CAGL0M11396g8.279ON11922272236e-18
Kpol_1072.198.668ON8962812236e-18
ZYRO0D06776g8.279ON12042152211e-17
KAFR0B028008.279ON10952452192e-17
Smik_13.1596.31ON7052782145e-17
ABL034W2.479ON14252182157e-17
KLTH0D11044g8.668ON8491962138e-17
TDEL0F040608.279ON11262192148e-17
Smik_4.3678.279ON10662242131e-16
CAGL0J11638g6.31ON7463422121e-16
Suva_2.2838.279ON10892272121e-16
TBLA0C046008.279ON13152272121e-16
TPHA0F024306.31ON7982782111e-16
Skud_4.3838.279ON10652272102e-16
Skud_13.1546.31ON7052782092e-16
YDR122W (KIN1)8.279ON10642272102e-16
YMR001C (CDC5)6.31ON7052782092e-16
KNAG0F001701.24ON5432372072e-16
Suva_13.1636.31ON7052782083e-16
Suva_16.1608.668ON9182952093e-16
NCAS0B037408.279ON10492202093e-16
Kpol_2002.241.24ON4872642054e-16
Kpol_1023.266.31ON7392752074e-16
TPHA0G016308.668ON8713002084e-16
NCAS0B050908.279ON12102432084e-16
Kpol_1037.206.31ON7042782065e-16
TPHA0E038501.24ON4823202045e-16
NDAI0B020708.279ON12582312075e-16
KLTH0G13288g8.279ON11422272067e-16
KLTH0G05214g5.591ON6531982031e-15
TDEL0G043806.31ON7222782031e-15
Kwal_56.237178.279ON8582272031e-15
NDAI0C026806.31ON7502842021e-15
Kpol_1066.468.279ON12252162031e-15
Kwal_26.87518.668ON8482292022e-15
TDEL0A061408.668ON8612362022e-15
CAGL0B01925g8.279ON9442252022e-15
NCAS0C016708.668ON8962002022e-15
SAKL0H16632g8.279ON10622192022e-15
KNAG0E008506.31ON7112782012e-15
ZYRO0D05500g7.86ON12621792022e-15
Skud_16.1328.668ON9242952012e-15
NCAS0C041008.141ON9053212003e-15
Kpol_431.92.479ON15521952013e-15
TPHA0J004206.31ON7072781993e-15
KNAG0G021108.279ON11922102003e-15
CAGL0M02299g8.668ON8932011994e-15
YLR096W (KIN2)8.279ON11472102004e-15
TBLA0A047207.86ON12621801994e-15
Ecym_42918.279ON11452151995e-15
Kpol_1065.36.222ON3762821945e-15
NDAI0F045201.24ON4891941965e-15
KLTH0C10912g6.31ON6972791975e-15
ZYRO0F07194g8.668ON9382971986e-15
Suva_10.1808.279ON11592101986e-15
KLLA0F07623g7.86ON12291971987e-15
AGR058W8.279ON10712151987e-15
KLTH0F16676g5.406ON8782131977e-15
NDAI0J012508.279ON11762081987e-15
ZYRO0E07876g6.262ON3693381927e-15
TPHA0J008208.279ON12182071977e-15
KLLA0E03587g5.591ON6472271967e-15
Kpol_1072.318.652ON5262771949e-15
YPL150W8.668ON9012931951e-14
Ecym_30356.31ON7402781951e-14
ZYRO0C07480g6.31ON7742781951e-14
TBLA0I011502.479ON17451971961e-14
Kpol_1031.105.406ON11272021951e-14
Ecym_73922.479ON14341991952e-14
ACL006W6.31ON7082821942e-14
KAFR0G026906.31ON7132781932e-14
Kwal_55.215455.406ON8652071932e-14
Smik_6.3478.668ON9172951932e-14
KLLA0C06138g6.31ON7082931922e-14
Suva_15.2975.406ON10741941932e-14
Skud_12.1648.279ON11602101932e-14
Kwal_26.77882.479ON12671951933e-14
TBLA0A022406.262ON4131531883e-14
TBLA0B004906.31ON7872791913e-14
NDAI0E023908.668ON8832341923e-14
TPHA0G032002.479ON15341981923e-14
KLTH0D05566g2.479ON11281951915e-14
TBLA0A074601.24ON5161871885e-14
KNAG0H031408.279ON9362101905e-14
SAKL0C01716g1.52ON12153341905e-14
AFL101C6.222ON3672831855e-14
TDEL0H036407.86ON12371831905e-14
SAKL0C00946g1.24ON5641931885e-14
Suva_11.1232.479ON15261991906e-14
KLLA0F13552g2.479ON12671991896e-14
TDEL0A025502.479ON13691881897e-14
KLTH0F00946g1.24ON5121921877e-14
Kpol_1072.298.654ON8932011897e-14
KNAG0F002901.52ON11252971898e-14
CAGL0K08514g2.479ON14891961898e-14
Skud_8.1635.406ON10761941888e-14
Smik_12.1558.279ON11622101889e-14
ZYRO0F18062g1.24ON4711931851e-13
TPHA0D011408.654ON6222021861e-13
KLLA0F19536g8.279ON11042271871e-13
KNAG0A030408.654ON6442001861e-13
Kwal_47.183075.591ON6211961861e-13
SAKL0H07084g8.654ON9192131871e-13
ZYRO0F06842g8.654ON8432531861e-13
YDR507C (GIN4)1.52ON11421901871e-13
KLTH0D10714g8.654ON8722001861e-13
KNAG0D048107.86ON14401791862e-13
TBLA0B023103.92ON8192341862e-13
KLLA0C01650g1.52ON11123011862e-13
Kwal_56.224766.31ON6972791852e-13
KAFR0K007007.86ON13811931862e-13
NDAI0H024707.86ON14111821862e-13
CAGL0K02673g2.496ON9152351852e-13
TDEL0A060008.654ON7902791852e-13
TDEL0A045805.591ON6941971842e-13
TBLA0A071501.52ON13912971852e-13
Smik_8.1805.406ON10731941852e-13
KAFR0C014403.92ON10951901843e-13
Smik_4.7673.92ON7582011833e-13
ACR133C8.668ON8511931834e-13
TDEL0C064901.52ON11531921834e-13
KLLA0F11319g8.668ON8431931824e-13
KAFR0D032002.479ON14481951834e-13
CAGL0F00913g7.86ON12062021834e-13
KNAG0J016708.668ON10091971824e-13
CAGL0L11550g5.406ON10721941824e-13
TBLA0B082503.92ON13472171825e-13
Kpol_1012.68.654ON6282361815e-13
NCAS0B086001.52ON11172461825e-13
Smik_3.541.52ON10321961816e-13
KAFR0D012207.86ON10552251816e-13
KAFR0G012001.24ON5071881796e-13
NDAI0E012908.654ON7292401806e-13
YKL101W (HSL1)2.479ON15181991816e-13
ZYRO0C06776g5.591ON8902801816e-13
NCAS0A057702.479ON14611881817e-13
CAGL0J03872g8.654ON6611961807e-13
SAKL0E01584g6.31ON6952791807e-13
CAGL0M02519g8.654ON7562001807e-13
YHR102W (KIC1)5.406ON10801941807e-13
Skud_4.7831.52ON11352501807e-13
SAKL0G01848g5.406ON8852051808e-13
KLLA0E21693g5.406ON10162261809e-13
TPHA0H026307.86ON13671811809e-13
Kwal_26.71547.86ON12131791809e-13
SAKL0E02860g2.479ON13771981801e-12
Smik_11.1392.479ON15341991801e-12
KNAG0D002106.371ON8331981791e-12
Ecym_24058.668ON8551941781e-12
YCL024W (KCC4)1.52ON10371961781e-12
CAGL0K05709g1.52ON11032011781e-12
Skud_4.7643.92ON7562041772e-12
TPHA0H016305.406ON10361941782e-12
Suva_2.6871.52ON11281901782e-12
KAFR0H025108.668ON8791481772e-12
Ecym_26407.86ON13251761782e-12
TBLA0A035705.406ON9751991772e-12
NCAS0F015807.86ON13821821782e-12
TDEL0C067801.24ON4682011752e-12
NCAS0C015908.654ON8641971772e-12
NDAI0A006601.52ON10222371772e-12
KLLA0B02332g6.222ON3612961732e-12
NDAI0F013406.262ON4061541732e-12
TPHA0G017108.654ON8052001762e-12
AFR696C1.52ON11422331762e-12
Smik_4.7891.52ON11361901763e-12
KAFR0D033902.496ON7982351753e-12
NDAI0D027502.479ON15151951763e-12
KNAG0A030608.652ON5002751733e-12
Kpol_1040.207.86ON12971781763e-12
Kpol_463.81.271ON14472981763e-12
Ecym_55055.406ON10031921753e-12
YPL141C (FRK1)8.654ON8652001753e-12
Kwal_33.131121.24ON5052721734e-12
YDR490C (PKH1)3.92ON7662031744e-12
Skud_15.3998.654ON8072001744e-12
Skud_8.392.496ON9232811744e-12
NCAS0A002801.24ON5352881724e-12
YOR233W (KIN4)8.654ON8002031734e-12
Ecym_10581.52ON11643021744e-12
AFR377C5.591ON7261981734e-12
NOTE: 1 genes in the same pillar as TPHA0C03380 were not hit in these BLAST results
LIST: NCAS0G03810

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C03380
         (697 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...  1408   0.0  
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   538   0.0  
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   521   e-176
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   517   e-173
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   512   e-172
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   513   e-172
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   511   e-171
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   511   e-171
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   510   e-171
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   510   e-170
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   505   e-169
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   505   e-168
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   503   e-168
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    497   e-168
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   499   e-166
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   478   e-164
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   488   e-163
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   484   e-161
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   478   e-160
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   475   e-158
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   476   e-158
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   470   e-157
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   467   e-157
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   466   e-156
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   462   e-154
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   462   e-154
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   462   e-153
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   462   e-146
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   438   e-143
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   430   e-142
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   413   e-134
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   306   1e-90
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   297   6e-89
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   296   2e-88
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   293   6e-87
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   292   2e-86
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   294   2e-86
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   293   1e-85
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   293   2e-85
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   293   2e-85
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   292   3e-85
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   291   5e-85
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   290   1e-84
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   285   1e-84
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   288   4e-84
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   289   4e-84
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   283   8e-84
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   286   1e-83
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   285   2e-83
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   281   1e-82
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   283   1e-82
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   281   2e-82
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   282   5e-82
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   280   8e-81
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   276   3e-80
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   277   3e-79
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   270   6e-78
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    98   2e-21
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    96   9e-21
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    94   6e-20
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    94   7e-20
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    92   3e-19
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    92   3e-19
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    94   3e-19
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    92   4e-19
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             94   4e-19
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    91   6e-19
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    90   1e-18
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      91   4e-18
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    91   6e-18
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    91   6e-18
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    90   1e-17
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    89   2e-17
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    87   5e-17
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    87   7e-17
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    87   8e-17
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    87   8e-17
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    87   1e-16
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    86   1e-16
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    86   1e-16
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    86   1e-16
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    86   1e-16
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    86   2e-16
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    85   2e-16
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    86   2e-16
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    85   2e-16
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    84   2e-16
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    85   3e-16
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    85   3e-16
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    85   3e-16
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    84   4e-16
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    84   4e-16
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    85   4e-16
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              85   4e-16
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    84   5e-16
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    83   5e-16
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              84   5e-16
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    84   7e-16
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    83   1e-15
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    83   1e-15
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    83   1e-15
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    82   1e-15
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    83   1e-15
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    82   2e-15
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    82   2e-15
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    82   2e-15
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    82   2e-15
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    82   2e-15
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    82   2e-15
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    82   2e-15
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    82   2e-15
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     82   3e-15
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    82   3e-15
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    81   3e-15
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    82   3e-15
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    81   4e-15
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    82   4e-15
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    81   4e-15
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    81   5e-15
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    79   5e-15
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    80   5e-15
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    80   5e-15
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    81   6e-15
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    81   6e-15
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    81   7e-15
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    81   7e-15
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    80   7e-15
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    81   7e-15
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    79   7e-15
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    80   7e-15
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    80   7e-15
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    79   9e-15
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    80   1e-14
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    80   1e-14
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    80   1e-14
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    80   1e-14
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    80   1e-14
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    80   2e-14
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    79   2e-14
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    79   2e-14
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    79   2e-14
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    79   2e-14
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    79   2e-14
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    79   2e-14
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    79   2e-14
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    79   3e-14
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    77   3e-14
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    78   3e-14
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    79   3e-14
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    79   3e-14
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    78   5e-14
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    77   5e-14
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    78   5e-14
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    78   5e-14
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    76   5e-14
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    78   5e-14
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    77   5e-14
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    78   6e-14
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    77   6e-14
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    77   7e-14
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    77   7e-14
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    77   7e-14
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    77   8e-14
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    77   8e-14
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    77   8e-14
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    77   9e-14
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    76   1e-13
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    76   1e-13
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    77   1e-13
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    76   1e-13
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    76   1e-13
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    77   1e-13
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    76   1e-13
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    77   1e-13
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    76   1e-13
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    76   2e-13
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    76   2e-13
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    76   2e-13
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    76   2e-13
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    76   2e-13
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    76   2e-13
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    76   2e-13
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    76   2e-13
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    75   2e-13
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    76   2e-13
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    76   2e-13
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    75   3e-13
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    75   3e-13
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    75   4e-13
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    75   4e-13
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    75   4e-13
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    75   4e-13
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    75   4e-13
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    75   4e-13
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    75   4e-13
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    75   5e-13
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    74   5e-13
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    75   5e-13
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    74   6e-13
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    74   6e-13
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    74   6e-13
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    74   6e-13
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    74   6e-13
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    74   6e-13
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    74   7e-13
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    74   7e-13
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    74   7e-13
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    74   7e-13
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    74   7e-13
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    74   7e-13
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    74   8e-13
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    74   9e-13
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    74   9e-13
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    74   9e-13
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    74   1e-12
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    74   1e-12
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    74   1e-12
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    73   1e-12
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    73   1e-12
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    73   1e-12
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    73   2e-12
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    73   2e-12
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    73   2e-12
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    73   2e-12
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    73   2e-12
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    73   2e-12
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    73   2e-12
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    72   2e-12
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     73   2e-12
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     73   2e-12
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    71   2e-12
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    71   2e-12
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    72   2e-12
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    72   2e-12
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    72   3e-12
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    72   3e-12
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    72   3e-12
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    71   3e-12
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    72   3e-12
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    72   3e-12
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    72   3e-12
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    72   3e-12
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    71   4e-12
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    72   4e-12
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    72   4e-12
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    72   4e-12
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        71   4e-12
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    71   4e-12
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    72   4e-12
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    71   4e-12
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    71   5e-12
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    72   5e-12
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    71   6e-12
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    71   6e-12
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    71   6e-12
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    71   6e-12
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     71   6e-12
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    71   6e-12
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    71   6e-12
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    71   6e-12
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    71   6e-12
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    70   6e-12
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    71   6e-12
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    71   7e-12
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    71   7e-12
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    71   7e-12
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    71   7e-12
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    70   7e-12
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    71   7e-12
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    70   7e-12
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    71   7e-12
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    71   8e-12
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    70   8e-12
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    70   8e-12
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    71   8e-12
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    71   8e-12
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    70   8e-12
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    69   8e-12
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    70   8e-12
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    71   9e-12
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    70   9e-12
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    70   9e-12
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    69   9e-12
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    70   9e-12
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    70   1e-11
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    70   1e-11
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    70   1e-11
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    70   1e-11
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    70   1e-11
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    69   1e-11
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    69   1e-11
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    70   1e-11
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    70   1e-11
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    70   1e-11
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               70   1e-11
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    70   1e-11
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    70   1e-11
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    70   2e-11
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    70   2e-11
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    70   2e-11
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    70   2e-11
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    70   2e-11
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    69   2e-11
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    70   2e-11
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    70   2e-11
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    69   2e-11
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    69   2e-11
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    69   2e-11
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    69   2e-11
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    69   2e-11
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    69   2e-11
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    69   2e-11
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               69   2e-11
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    69   2e-11
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    69   2e-11
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    69   2e-11
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    69   2e-11
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    69   2e-11
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    68   2e-11
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    69   2e-11
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    69   2e-11
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    69   2e-11
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    69   3e-11
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    69   3e-11
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    69   3e-11
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     67   3e-11
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    69   3e-11
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    69   3e-11
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    69   3e-11
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    69   3e-11
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    69   3e-11
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               68   3e-11
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    69   4e-11
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    69   4e-11
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    68   4e-11
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    69   4e-11
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    67   4e-11
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    69   4e-11
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    68   4e-11
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    67   4e-11
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    68   5e-11
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    68   5e-11
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    67   5e-11
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    67   5e-11
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    68   5e-11
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    68   5e-11
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    68   5e-11
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    68   5e-11
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    67   5e-11
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    68   6e-11
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    68   6e-11
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    68   6e-11
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    67   6e-11
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    68   6e-11
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    68   6e-11
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    67   6e-11
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    68   7e-11
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    67   7e-11
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    68   7e-11
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    68   7e-11
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    68   7e-11
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    67   7e-11
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    67   7e-11
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    67   8e-11
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    67   8e-11
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    67   8e-11
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    67   8e-11
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    67   8e-11
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    67   8e-11
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    67   9e-11
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    67   9e-11
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    67   9e-11
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    67   9e-11
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    67   9e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     67   9e-11
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    67   1e-10
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    67   1e-10
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    67   1e-10
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    67   1e-10
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    67   1e-10
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    67   1e-10
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    66   1e-10
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    66   1e-10
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    65   1e-10
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    67   1e-10
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    65   1e-10
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    67   1e-10
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    67   1e-10
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    67   1e-10
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    67   1e-10
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    66   1e-10
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    66   2e-10
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    66   2e-10
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    67   2e-10
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    66   2e-10
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    65   2e-10
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    65   2e-10
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    66   2e-10
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    65   2e-10
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    65   2e-10
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    66   3e-10
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    66   3e-10
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    66   3e-10
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    65   3e-10
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    66   3e-10
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    64   3e-10
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    65   3e-10
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    65   3e-10
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    64   3e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    65   3e-10
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    65   3e-10
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    65   3e-10
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    65   3e-10
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    65   4e-10
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    65   4e-10
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    65   4e-10
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    65   4e-10
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    65   4e-10
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    65   4e-10
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     65   4e-10
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    65   4e-10
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    65   4e-10
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       64   4e-10
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     64   4e-10
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    64   4e-10
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    65   5e-10
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    65   5e-10
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    65   5e-10
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    65   5e-10
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    65   5e-10
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    64   6e-10
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    64   6e-10
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    64   6e-10
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    65   6e-10
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    65   6e-10
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    65   6e-10
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    64   6e-10
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    64   6e-10
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    64   6e-10
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    65   6e-10
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    64   6e-10
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    64   7e-10
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    65   7e-10
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    63   7e-10
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    63   7e-10
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    63   7e-10
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    64   7e-10
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    64   8e-10
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    63   8e-10
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    64   8e-10
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    64   8e-10
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    63   8e-10
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    64   8e-10
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    64   8e-10
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    64   8e-10
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    64   8e-10
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    64   9e-10
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    64   9e-10
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    64   9e-10
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    63   9e-10
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    64   1e-09
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    64   1e-09
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    64   1e-09
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    64   1e-09
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    64   1e-09
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    63   1e-09
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    64   1e-09
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    63   1e-09
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    64   1e-09
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    64   1e-09
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    64   1e-09
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    63   1e-09
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    64   1e-09
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    63   1e-09
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               63   1e-09
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    63   1e-09
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    62   1e-09
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    63   1e-09
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    63   1e-09
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    63   2e-09
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       63   2e-09
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    62   2e-09
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    63   2e-09
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    62   2e-09
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    63   2e-09
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    62   2e-09
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    63   2e-09
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    62   2e-09
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    62   2e-09
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    63   2e-09
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    63   2e-09
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    62   2e-09
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    62   2e-09
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    63   2e-09
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    63   2e-09
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    62   2e-09
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    63   2e-09
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    63   2e-09
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    63   2e-09
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    62   2e-09
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    63   2e-09
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    63   2e-09
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    63   2e-09
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    62   2e-09
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    63   2e-09
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    62   2e-09
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    62   2e-09
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    62   3e-09
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    63   3e-09
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    62   3e-09
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    62   3e-09
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    62   3e-09
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    62   3e-09
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    62   3e-09
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    62   3e-09
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    62   3e-09
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    62   3e-09
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    62   3e-09
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    62   3e-09
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    62   3e-09
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    62   3e-09
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    61   3e-09
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    62   3e-09
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    62   3e-09
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    62   3e-09
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    61   4e-09
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    62   4e-09
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    62   4e-09
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    61   4e-09
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    62   4e-09
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    62   4e-09
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    62   4e-09
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    62   4e-09
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    62   4e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    62   4e-09
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     61   4e-09
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    62   4e-09
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    62   4e-09
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    61   4e-09
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    62   4e-09
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    62   4e-09
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    62   4e-09
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    62   4e-09
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    62   4e-09
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    62   4e-09
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    62   4e-09
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    62   5e-09
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    62   5e-09
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    62   5e-09
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    61   5e-09
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    62   5e-09
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               62   5e-09
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    62   5e-09
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    62   5e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    61   5e-09
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    61   5e-09
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    60   5e-09
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    61   5e-09
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    61   5e-09
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    61   5e-09
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              62   6e-09
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    60   6e-09
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    62   6e-09
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    61   6e-09
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    61   6e-09
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    60   6e-09
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    61   6e-09
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    61   6e-09
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    61   6e-09
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    61   6e-09
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    61   6e-09
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    61   6e-09
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    61   7e-09
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    61   7e-09
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    61   7e-09
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    61   7e-09
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    60   8e-09
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    60   8e-09
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    60   8e-09
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    60   8e-09
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    61   8e-09
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    61   9e-09
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    61   9e-09
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    60   9e-09
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    61   9e-09
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    61   9e-09
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    60   1e-08
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    60   1e-08
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    61   1e-08
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               60   1e-08
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    61   1e-08
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    60   1e-08
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    61   1e-08
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    60   1e-08
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    60   1e-08
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    61   1e-08
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    60   1e-08
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    60   1e-08
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    60   1e-08
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    60   1e-08
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    60   1e-08
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    60   1e-08
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    60   1e-08
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    60   1e-08
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    60   1e-08
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    60   1e-08
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    59   1e-08
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    60   1e-08
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    60   1e-08
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    60   1e-08
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    60   1e-08
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    59   1e-08
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    59   1e-08
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    59   1e-08
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    60   1e-08
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    60   1e-08
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    60   1e-08
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    59   1e-08
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    60   1e-08
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    60   1e-08
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    59   1e-08
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    59   2e-08
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    60   2e-08
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    60   2e-08
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    60   2e-08
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    60   2e-08
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    59   2e-08
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    59   2e-08
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    60   2e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    60   2e-08
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    60   2e-08
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    59   2e-08
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    60   2e-08
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    60   2e-08
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    59   2e-08
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    59   2e-08
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    59   2e-08
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    60   2e-08
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    60   2e-08
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    60   2e-08
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    59   2e-08
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    59   2e-08
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    60   2e-08
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    59   2e-08
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    59   2e-08
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    60   2e-08
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    59   2e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    59   2e-08
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               59   2e-08
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    59   3e-08
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    58   3e-08
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    59   3e-08
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    59   3e-08
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    59   3e-08
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    59   3e-08
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    59   3e-08
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    59   3e-08
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    59   3e-08
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    59   3e-08
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    59   3e-08
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     59   3e-08
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    59   3e-08
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              59   3e-08
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    59   3e-08
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    59   3e-08
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    59   3e-08
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    59   4e-08
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    58   4e-08
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    58   4e-08
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    59   4e-08
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    59   4e-08
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    58   4e-08
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    59   4e-08
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    59   4e-08
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    59   4e-08
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    59   4e-08
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    59   4e-08
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    59   4e-08
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    59   4e-08
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    59   4e-08
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    59   4e-08
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    59   4e-08
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    59   4e-08
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    59   4e-08
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    59   4e-08
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    59   4e-08
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    59   5e-08
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    58   5e-08
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    58   5e-08
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    57   5e-08
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    58   5e-08
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    58   5e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    58   5e-08
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    58   5e-08
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    58   5e-08
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    58   5e-08
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    59   5e-08
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    58   5e-08
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    58   5e-08
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    59   5e-08
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    59   5e-08
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    58   5e-08
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    57   5e-08
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    57   5e-08
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    58   5e-08
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    58   6e-08
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    57   6e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    58   6e-08
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    57   6e-08
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    58   6e-08
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    58   6e-08
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    58   6e-08
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    58   6e-08
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    58   6e-08
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              57   6e-08
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    58   6e-08
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    57   6e-08
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    57   7e-08
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    58   7e-08
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    58   7e-08
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    57   7e-08
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    58   7e-08
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    57   7e-08
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    58   7e-08
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    58   7e-08
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    58   7e-08
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    58   7e-08
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    56   7e-08
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    58   8e-08
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    57   8e-08
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    58   8e-08
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    58   8e-08
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    58   8e-08
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    58   8e-08
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    57   9e-08
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    57   9e-08
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    57   9e-08
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    58   9e-08
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    58   9e-08
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    58   9e-08
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    57   9e-08
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    58   9e-08
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     57   9e-08
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    57   9e-08
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    57   9e-08
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    57   1e-07
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    57   1e-07
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    57   1e-07
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    57   1e-07
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    57   1e-07
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    57   1e-07
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    57   1e-07
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    57   1e-07
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              57   1e-07
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    57   1e-07
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    57   1e-07
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    56   1e-07
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    57   1e-07
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    56   1e-07
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    57   1e-07
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    57   1e-07
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    57   1e-07
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    56   1e-07
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    57   1e-07
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    57   1e-07
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    57   1e-07
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    56   1e-07
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    56   2e-07
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     57   2e-07
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    57   2e-07
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    56   2e-07
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    56   2e-07
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      57   2e-07
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    57   2e-07
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    57   2e-07
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    57   2e-07
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    56   2e-07
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    57   2e-07
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    56   2e-07
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    56   2e-07
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    56   2e-07
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              56   2e-07
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    56   2e-07
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    55   2e-07
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    56   2e-07
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     56   2e-07
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    56   2e-07
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    57   2e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    55   2e-07
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    56   2e-07
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    56   2e-07
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    56   2e-07
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    56   2e-07
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    56   2e-07
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    56   2e-07
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              56   2e-07
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    56   2e-07
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    57   2e-07
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    55   2e-07
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    56   2e-07
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    56   2e-07
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    55   2e-07
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    56   3e-07
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    56   3e-07
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    56   3e-07
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    56   3e-07
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    56   3e-07
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    55   3e-07
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    55   3e-07
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    56   3e-07
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    56   3e-07
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    55   3e-07
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    55   3e-07
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    56   3e-07
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    56   3e-07
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    56   3e-07
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    55   3e-07
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    55   3e-07
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    56   3e-07
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    56   3e-07
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    55   3e-07
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    54   3e-07
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    55   3e-07
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     55   3e-07
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    55   3e-07
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    55   3e-07
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    55   3e-07
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    54   3e-07
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    56   3e-07
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    55   3e-07
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    55   3e-07
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    54   4e-07
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    55   4e-07
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    55   4e-07
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    55   4e-07
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    55   4e-07
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    54   4e-07
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    55   4e-07
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    55   4e-07
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    55   4e-07
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    55   4e-07
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    55   4e-07
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    54   4e-07
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    55   4e-07
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    55   4e-07
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    55   5e-07
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    55   5e-07
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    55   5e-07
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    55   5e-07
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    55   5e-07
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    55   5e-07
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    55   5e-07
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    55   5e-07
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    55   5e-07
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    55   5e-07
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    55   5e-07
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    55   5e-07
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    55   5e-07
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    55   5e-07
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    55   6e-07
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    55   6e-07
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    55   6e-07
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    55   6e-07
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    55   6e-07
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    54   6e-07
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    55   6e-07
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    54   6e-07
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    55   6e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    54   6e-07
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    55   6e-07
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    55   6e-07
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    55   6e-07
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    55   7e-07
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    55   7e-07
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     54   7e-07
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    55   7e-07
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    54   7e-07
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    55   7e-07
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    54   7e-07
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    54   8e-07
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    54   8e-07
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    54   8e-07
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    52   8e-07
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    54   9e-07
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    54   9e-07
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              54   9e-07
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    54   9e-07
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    54   9e-07
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    54   9e-07
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    54   9e-07
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     54   9e-07
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    54   9e-07
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    54   1e-06
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    54   1e-06
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               54   1e-06
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    54   1e-06
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    54   1e-06
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    54   1e-06
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    54   1e-06
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    54   1e-06
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    53   1e-06
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    54   1e-06
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    54   1e-06
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    54   1e-06
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    53   1e-06
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    54   1e-06
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    54   1e-06
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    54   1e-06
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    54   1e-06
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    54   1e-06
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    54   1e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     54   1e-06
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    54   1e-06
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    53   1e-06
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    53   1e-06
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    53   1e-06
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    54   1e-06
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    53   1e-06
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    54   2e-06
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    52   2e-06
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    54   2e-06
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    53   2e-06
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    53   2e-06
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    53   2e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    53   2e-06
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    53   2e-06
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    53   2e-06
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    53   2e-06
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    54   2e-06
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    54   2e-06
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    52   2e-06
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    53   2e-06
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    52   2e-06
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    53   2e-06
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    53   2e-06
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    53   2e-06
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    53   2e-06
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    53   2e-06
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     53   2e-06
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    53   2e-06
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    53   2e-06
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    53   2e-06
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    53   2e-06
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    53   2e-06
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    53   2e-06
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    53   2e-06
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    52   2e-06
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    53   2e-06
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    53   2e-06
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    52   2e-06
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    53   2e-06
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    53   2e-06
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    53   2e-06
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    53   2e-06
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    53   2e-06
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    53   2e-06
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    52   2e-06
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    53   2e-06
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    52   3e-06
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    52   3e-06
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    52   3e-06
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    52   3e-06
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    52   3e-06
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    52   3e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    52   3e-06
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    52   3e-06
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    52   3e-06
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    52   3e-06
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    52   3e-06
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    52   3e-06
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    52   3e-06
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    52   3e-06
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    52   3e-06
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    52   3e-06
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    52   3e-06
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    52   3e-06
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    52   3e-06
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    52   3e-06
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    52   3e-06
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    52   3e-06
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    52   4e-06
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    52   4e-06
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    52   4e-06
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    52   4e-06
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    52   4e-06
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    52   4e-06
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    52   4e-06
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    52   4e-06
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    52   4e-06
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    52   4e-06
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    52   4e-06
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    52   4e-06
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    52   4e-06
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    52   4e-06
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    52   4e-06
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    52   4e-06
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    52   4e-06
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    52   4e-06
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    52   4e-06
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    52   4e-06
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    52   4e-06
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    52   4e-06
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    52   5e-06
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    52   5e-06
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    52   5e-06
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    52   5e-06
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    51   5e-06
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    52   5e-06
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    52   5e-06
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    51   5e-06
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    52   5e-06
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    52   5e-06
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    52   5e-06
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    52   5e-06
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    52   5e-06
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    52   5e-06
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    51   5e-06
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    50   6e-06
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    50   6e-06
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    51   6e-06
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    51   6e-06
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    51   6e-06
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    50   6e-06
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    51   6e-06
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     52   6e-06
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    51   6e-06
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    52   6e-06
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    52   7e-06
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    51   7e-06
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    51   7e-06
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    51   7e-06
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    51   7e-06
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    51   7e-06
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    51   7e-06
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    51   7e-06
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    51   7e-06
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    51   7e-06
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    51   7e-06
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    51   7e-06
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    52   7e-06
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    50   7e-06
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    51   7e-06
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    51   7e-06
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     50   7e-06
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    51   8e-06
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    50   8e-06
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    51   8e-06
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    51   8e-06
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    51   8e-06
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    51   8e-06
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    51   9e-06
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    51   9e-06
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    51   9e-06
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    51   9e-06
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    51   9e-06
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    51   9e-06
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    51   9e-06
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    51   9e-06
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    51   1e-05
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    51   1e-05
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    51   1e-05
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    50   1e-05
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    51   1e-05
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               50   1e-05
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    51   1e-05
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    50   1e-05
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    51   1e-05
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    50   1e-05
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    50   1e-05
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    50   1e-05
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    50   1e-05
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    50   1e-05
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    50   1e-05
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    50   1e-05
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    50   1e-05
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    50   1e-05
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    50   1e-05
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    50   1e-05
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    50   1e-05
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    50   1e-05
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    51   1e-05
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    50   1e-05
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    50   2e-05
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    50   2e-05
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    50   2e-05
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    50   2e-05
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    50   2e-05
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    50   2e-05
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    50   2e-05
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    50   2e-05
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    50   2e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    50   2e-05
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    50   2e-05
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    50   2e-05
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    50   2e-05
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    50   2e-05
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    50   2e-05
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    50   2e-05
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    50   2e-05
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    49   2e-05
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             50   2e-05
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    50   2e-05
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     49   2e-05
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    49   2e-05
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    50   2e-05
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    50   2e-05
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    49   2e-05
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    50   2e-05
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    50   2e-05
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    50   2e-05
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    50   2e-05
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    49   2e-05
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    50   2e-05
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    50   2e-05
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    50   2e-05
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    49   2e-05
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    49   2e-05
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    49   2e-05
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    50   2e-05
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    49   3e-05
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    49   3e-05
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               49   3e-05
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    49   3e-05
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    49   3e-05
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    49   3e-05
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    49   3e-05
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    49   3e-05
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    49   3e-05
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    49   3e-05
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    49   3e-05
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    49   3e-05
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    49   3e-05
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    49   3e-05
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    49   3e-05
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    49   3e-05
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    49   3e-05
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    49   3e-05
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    49   3e-05
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    49   3e-05
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    49   3e-05
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    49   3e-05
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    49   3e-05
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    49   3e-05
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    49   3e-05
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    48   3e-05
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    49   3e-05
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    49   3e-05
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    49   3e-05
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    49   3e-05
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    49   3e-05
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    48   3e-05
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    49   3e-05
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    49   4e-05
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    49   4e-05
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    49   4e-05
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    49   4e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    49   4e-05
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    49   4e-05
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    49   4e-05
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    49   4e-05
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    48   4e-05
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    48   4e-05
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    49   4e-05
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    49   4e-05
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    49   4e-05
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    48   4e-05
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    49   4e-05
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    49   4e-05
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    49   4e-05
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    49   4e-05
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    48   4e-05
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    49   4e-05
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    49   4e-05
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    48   4e-05
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    49   4e-05
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    49   4e-05
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    49   4e-05
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    49   4e-05
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    49   4e-05
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    49   4e-05
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    49   4e-05
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    49   4e-05
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    48   4e-05
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    49   4e-05
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    48   4e-05
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    49   4e-05
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    49   5e-05
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     48   5e-05
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    49   5e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    49   5e-05
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    49   5e-05
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    49   5e-05
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    49   5e-05
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    48   5e-05
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    49   5e-05
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               49   5e-05
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    49   5e-05
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    48   5e-05
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    49   5e-05
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    49   5e-05
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    48   5e-05
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    49   5e-05
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    48   6e-05
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      49   6e-05
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    47   6e-05
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    48   6e-05
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    48   6e-05
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    48   6e-05
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    48   6e-05
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    48   6e-05
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    48   6e-05
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    48   6e-05
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    48   6e-05
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    48   6e-05
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    48   6e-05
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    48   6e-05
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               48   6e-05
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    48   7e-05
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    48   7e-05
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    48   7e-05
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    48   7e-05
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    48   7e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    49   7e-05
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    48   7e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    47   7e-05
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    48   7e-05
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    47   7e-05
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    47   7e-05
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    47   7e-05
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    48   7e-05
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     48   7e-05
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    48   7e-05
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    48   7e-05
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    48   8e-05
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    48   8e-05
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    48   8e-05
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    48   8e-05
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    48   8e-05
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    47   8e-05
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    48   8e-05
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    48   8e-05
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    48   8e-05
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    47   8e-05
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    48   8e-05
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    48   8e-05
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    47   9e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    48   9e-05
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     48   9e-05
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    48   9e-05
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    48   9e-05
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    48   9e-05
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    48   9e-05
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    47   9e-05
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    48   9e-05
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    48   9e-05
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    47   1e-04
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    47   1e-04
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    47   1e-04
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    47   1e-04
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    47   1e-04
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    47   1e-04
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    47   1e-04
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    47   1e-04
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    47   1e-04
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    47   1e-04
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    47   1e-04
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    47   1e-04
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    47   1e-04
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    47   1e-04
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    47   1e-04
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    47   1e-04
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    47   1e-04
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    47   1e-04
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    47   1e-04
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    47   1e-04
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    47   1e-04
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    47   1e-04
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    47   2e-04
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    47   2e-04
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    47   2e-04
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    47   2e-04
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    47   2e-04
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    47   2e-04
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    47   2e-04
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    46   2e-04
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    46   2e-04
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    46   2e-04
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    47   2e-04
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    47   2e-04
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    47   2e-04
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    47   2e-04
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    47   2e-04
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    47   2e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    47   2e-04
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    46   2e-04
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    47   2e-04
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    46   2e-04
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    46   2e-04
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    46   2e-04
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    46   2e-04
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    47   2e-04
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    47   2e-04
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    46   2e-04
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    46   2e-04
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    47   2e-04
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    46   2e-04
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    46   2e-04
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    47   2e-04
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    46   2e-04
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    47   2e-04
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    46   2e-04
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    46   2e-04
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    46   2e-04
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    46   2e-04
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    46   2e-04
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    46   2e-04
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    46   2e-04
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    46   3e-04
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    46   3e-04
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    46   3e-04
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    46   3e-04
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    46   3e-04
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               46   3e-04
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    46   3e-04
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    46   3e-04
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    46   3e-04
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    45   3e-04
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    46   3e-04
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    46   3e-04
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    46   3e-04
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    45   3e-04
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    46   3e-04
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    46   3e-04
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    46   3e-04
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    46   3e-04
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    46   3e-04
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    45   3e-04
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    45   4e-04
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    45   4e-04
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    45   4e-04
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    45   4e-04
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    45   4e-04
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    45   4e-04
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    45   4e-04
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    45   4e-04
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    45   4e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    46   4e-04
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    45   4e-04
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    45   4e-04
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    45   4e-04
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    45   4e-04
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    45   4e-04
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    45   5e-04
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    45   5e-04
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    45   5e-04
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    45   5e-04
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    45   5e-04
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    45   5e-04
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    45   5e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    45   5e-04
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    45   5e-04
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    45   5e-04
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    45   5e-04
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    45   5e-04
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    45   5e-04
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    45   6e-04
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    44   6e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    45   6e-04
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    45   6e-04
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    45   6e-04
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    45   6e-04
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    45   6e-04
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    45   6e-04
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    45   6e-04
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    45   6e-04
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    45   6e-04
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    45   6e-04
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    45   6e-04
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    45   6e-04
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     45   6e-04
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    45   6e-04
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    45   6e-04
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    44   7e-04
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    45   7e-04
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    44   7e-04
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    44   7e-04
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       45   7e-04
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    45   7e-04
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    45   7e-04
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    45   7e-04
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    44   7e-04
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              45   7e-04
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    45   8e-04
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    45   8e-04
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    45   8e-04
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    45   8e-04
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    45   8e-04
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    44   8e-04
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              44   8e-04
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    44   8e-04
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    45   8e-04
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    45   8e-04
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    45   8e-04
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    45   8e-04
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    45   8e-04
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    44   8e-04
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    44   8e-04
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    44   8e-04
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    45   8e-04
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    44   8e-04
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    45   9e-04
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    45   9e-04
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    44   9e-04
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    45   9e-04
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    44   0.001
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    44   0.001
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    44   0.001
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    44   0.001
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    44   0.001
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     44   0.001
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    44   0.001
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    44   0.001
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    44   0.001
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    44   0.001
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    44   0.001
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    44   0.001
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    44   0.001
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               44   0.001
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    44   0.001
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    44   0.001
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    44   0.001
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    44   0.001
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    44   0.001
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    44   0.001
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    44   0.001
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    44   0.001
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    44   0.001
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    44   0.001
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    44   0.001
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      44   0.001
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    44   0.001
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    44   0.001
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    44   0.001
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    44   0.001
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     44   0.001
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    44   0.001
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    43   0.001
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    43   0.001
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    44   0.002
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    44   0.002
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    44   0.002
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    44   0.002
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    43   0.002
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    44   0.002
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    44   0.002
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    44   0.002
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    44   0.002
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    44   0.002
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    44   0.002
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    44   0.002
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    44   0.002
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    44   0.002
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    44   0.002
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    44   0.002
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    44   0.002
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    44   0.002
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    44   0.002
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    44   0.002
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    43   0.002
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    41   0.002
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    43   0.002
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               44   0.002
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    43   0.002
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    43   0.002
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    43   0.002
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    43   0.002
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    44   0.002
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    44   0.002
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    44   0.002
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    44   0.002
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    43   0.002
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    43   0.002
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    43   0.002
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    43   0.002
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    43   0.002
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    43   0.002
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    44   0.002
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    43   0.002
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    42   0.002
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    43   0.002
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    43   0.002
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    43   0.002
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    43   0.002
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    43   0.002
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    43   0.002
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    43   0.002
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    43   0.003
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    43   0.003
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    43   0.003
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     43   0.003
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    43   0.003
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    43   0.003
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    42   0.003
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    42   0.003
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    43   0.003
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    42   0.003
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    43   0.003
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    43   0.003
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    42   0.003
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    42   0.003
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    42   0.003
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    43   0.003
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    43   0.003
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    43   0.003
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    42   0.003
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    42   0.003
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    43   0.003
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    42   0.003
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    42   0.003
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    42   0.003
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    42   0.003
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    42   0.003
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    42   0.004
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    42   0.004
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    42   0.004
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    42   0.004
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    42   0.004
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 42   0.004
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       42   0.004
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    42   0.004
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    42   0.004
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    42   0.004
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    42   0.004
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    42   0.004
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    42   0.004
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    42   0.004
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    42   0.004
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    42   0.004
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    42   0.004
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    42   0.004
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    42   0.004
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    42   0.004
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    42   0.004
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    42   0.004
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    42   0.005
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    42   0.005
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    42   0.005
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    42   0.005
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    42   0.005
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    42   0.005
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    42   0.005
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    42   0.005
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    42   0.005
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    42   0.005
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    42   0.005
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    42   0.005
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    42   0.005
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    42   0.005
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    42   0.005
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    42   0.006
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    42   0.006
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    42   0.006
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    42   0.006
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    42   0.006
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    42   0.006
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    42   0.006
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    42   0.006
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    42   0.006
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    42   0.006
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    42   0.006
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    42   0.006
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    42   0.006
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    42   0.006
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    42   0.007
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    41   0.007
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    42   0.007
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    41   0.007
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    42   0.007
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    42   0.007
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    42   0.007
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    41   0.007
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    42   0.007
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    42   0.007
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    42   0.007
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    41   0.007
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    41   0.007
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    41   0.008
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    41   0.008
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    42   0.008
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    41   0.008
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    41   0.008
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    41   0.008
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    41   0.008
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    41   0.008
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    41   0.008
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    41   0.008
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    41   0.009
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    41   0.010
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    41   0.010
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               41   0.010
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      41   0.010
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    41   0.010
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    41   0.010
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    40   0.010
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    41   0.010
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     41   0.011
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    41   0.011
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    41   0.011
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    41   0.012
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    41   0.012
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    40   0.012
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    40   0.012
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    41   0.012
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    40   0.013
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    40   0.013
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    41   0.013
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    40   0.013
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    41   0.013
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    41   0.013
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    41   0.014
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    40   0.014
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    40   0.014
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    40   0.014
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    40   0.015
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    40   0.015
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    40   0.016
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    40   0.016
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    40   0.016
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    40   0.016
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    40   0.016
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    40   0.017
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    40   0.017
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    40   0.017
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    40   0.017
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    40   0.017
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    40   0.018
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    40   0.018
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    40   0.018
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    40   0.018
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    40   0.018
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    40   0.019
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    40   0.020
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               40   0.020
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    40   0.020
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    40   0.020
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    40   0.021
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    40   0.021
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    39   0.021
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    40   0.022
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    40   0.022
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    40   0.022
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    40   0.025
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    40   0.026
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    40   0.026
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    40   0.031
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.031
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    40   0.031
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    40   0.032
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    39   0.033
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    40   0.034
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    39   0.035
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    39   0.035
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    39   0.036
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    39   0.037
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    39   0.037
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    39   0.038
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    39   0.039
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    39   0.041
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    39   0.042
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      39   0.044
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.044
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    39   0.047
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    39   0.047
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    39   0.050
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    39   0.051
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    39   0.051
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    39   0.054
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    39   0.054
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    39   0.055
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    39   0.055
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    38   0.055
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    39   0.056
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    39   0.058
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    39   0.058
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    38   0.067
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    38   0.067
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    39   0.067
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    38   0.067
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    38   0.074
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    39   0.075
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    38   0.078
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      38   0.085
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    38   0.086
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    38   0.090
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    38   0.092
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    38   0.093
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    37   0.098
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    38   0.10 
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    38   0.11 
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    37   0.11 
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    38   0.11 
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    37   0.11 
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    37   0.13 
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    38   0.13 
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    37   0.13 
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    37   0.13 
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    37   0.13 
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               37   0.14 
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    37   0.15 
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    37   0.15 
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    37   0.15 
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    37   0.15 
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    37   0.15 
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    37   0.16 
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    37   0.16 
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    37   0.17 
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    37   0.17 
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    37   0.17 
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    37   0.17 
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    37   0.17 
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    37   0.18 
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    37   0.18 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    37   0.19 
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    36   0.23 
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    37   0.24 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.24 
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    36   0.24 
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    37   0.24 
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    36   0.25 
TPHA0J01160 Chr10 (268613..269905) [1293 bp, 430 aa] {ON} Anc_3....    36   0.27 
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    36   0.28 
Ecym_7425 Chr7 complement(870347..873136) [2790 bp, 929 aa] {ON}...    36   0.32 
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    36   0.32 
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    36   0.32 
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    36   0.32 
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    36   0.32 
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    36   0.32 
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    36   0.34 
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    36   0.34 
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    36   0.35 
TPHA0M01300 Chr13 complement(266838..269699) [2862 bp, 953 aa] {...    36   0.35 
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    36   0.36 
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    36   0.37 
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    35   0.40 
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    36   0.41 
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    35   0.51 
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    35   0.53 
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    35   0.55 
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    35   0.56 
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    35   0.57 
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    35   0.58 
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    35   0.59 
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    35   0.60 
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    35   0.61 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    35   0.62 
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             35   0.63 
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    35   0.64 
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    35   0.64 
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    35   0.66 
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    35   0.66 
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    35   0.67 
ZYRO0G12716g Chr7 complement(1009177..1012215) [3039 bp, 1012 aa...    35   0.68 
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    35   0.69 
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    35   0.69 
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    35   0.71 
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    35   0.80 
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    35   0.81 
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    35   0.81 
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    34   0.87 
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    35   0.87 
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    35   0.90 
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    34   0.90 
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    35   0.91 
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    34   0.92 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    34   0.93 
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    35   0.96 
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    35   0.98 
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    34   0.99 
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    34   1.1  
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    34   1.1  
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               34   1.1  
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    34   1.1  
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    34   1.2  
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    34   1.2  
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    34   1.3  
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    34   1.3  
KNAG0B01260 Chr2 (237922..240345) [2424 bp, 807 aa] {ON} Anc_3.3...    34   1.3  
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    34   1.3  
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    34   1.4  
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    34   1.4  
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    34   1.5  
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    34   1.6  
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    34   1.6  
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    34   1.6  
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    33   1.6  
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    33   1.6  
TDEL0D03220 Chr4 (600997..603954) [2958 bp, 985 aa] {ON} Anc_3.3...    34   1.8  
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    33   1.8  
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    33   1.8  
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    33   1.9  
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    33   1.9  
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    33   1.9  
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    33   2.0  
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    33   2.0  
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    33   2.0  
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    33   2.1  
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    33   2.1  
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    33   2.2  
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    33   2.4  
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    33   2.5  
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    33   2.5  
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    33   2.6  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    33   2.7  
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    33   3.3  
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    32   3.7  
KNAG0F02990 Chr6 (567737..568444) [708 bp, 235 aa] {ON}                32   3.8  
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    33   4.0  
Ecym_2077 Chr2 complement(132047..133528) [1482 bp, 493 aa] {ON}...    32   4.3  
Suva_14.293 Chr14 complement(532558..534519) [1962 bp, 653 aa] {...    32   4.4  
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    33   4.5  
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    32   7.4  
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    32   8.5  
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    32   9.6  

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score = 1408 bits (3644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 685/697 (98%), Positives = 685/697 (98%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNIGLS 360
           SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNIGLS
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNIGLS 360

Query: 361 NINFLQNVNNSAIQTANTTSRINNNPYSLHNSSTLQNTPQTIAADRRYPVSTAPKQQHNI 420
           NINFLQNVNNSAIQTANTTSRINNNPYSLHNSSTLQNTPQTIAADRRYPVSTAPKQQHNI
Sbjct: 361 NINFLQNVNNSAIQTANTTSRINNNPYSLHNSSTLQNTPQTIAADRRYPVSTAPKQQHNI 420

Query: 421 PAYNNQINDITLQKSLSATMADAPVSTINISDNAFDRGLHLSELQKSVTALNNDMNHIYS 480
           PAYNNQINDITLQKSLSATMADAPVSTINISDNAFDRGLHLSELQKSVTALNNDMNHIYS
Sbjct: 421 PAYNNQINDITLQKSLSATMADAPVSTINISDNAFDRGLHLSELQKSVTALNNDMNHIYS 480

Query: 481 QKQEGGRGKXXXXXXXXXXXXDQSPTRAENNALSTKSSRVDLSVFNDNDQPPYIKNVLPV 540
           QKQEGGRGK            DQSPTRAENNALSTKSSRVDLSVFNDNDQPPYIKNVLPV
Sbjct: 481 QKQEGGRGKISSILNSNPNSLDQSPTRAENNALSTKSSRVDLSVFNDNDQPPYIKNVLPV 540

Query: 541 EDDADDDIYTTKPFNSKLTDISLTSLQKEITELKMELSKNDSKNAVDSRSSFNSNAEPSS 600
           EDDADDDIYTTKPFNSKLTDISLTSLQKEITELKMELSKNDSKNAVDSRSSFNSNAEPSS
Sbjct: 541 EDDADDDIYTTKPFNSKLTDISLTSLQKEITELKMELSKNDSKNAVDSRSSFNSNAEPSS 600

Query: 601 ELTNKTVKKNSITDRYLNSVGDNGVTSVKKTAEGYGKYTKVSDKEGSLTSVNTAKPLESG 660
           ELTNKTVKKNSITDRYLNSVGDNGVTSVKKTAEGYGKYTKVSDKEGSLTSVNTAKPLESG
Sbjct: 601 ELTNKTVKKNSITDRYLNSVGDNGVTSVKKTAEGYGKYTKVSDKEGSLTSVNTAKPLESG 660

Query: 661 HKSENTNKYIKGNTKQKVPPKLPTKPSYLGGKRIESK 697
           HKSENTNKYIKGNTKQKVPPKLPTKPSYLGGKRIESK
Sbjct: 661 HKSENTNKYIKGNTKQKVPPKLPTKPSYLGGKRIESK 697

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/324 (76%), Positives = 283/324 (87%), Gaps = 4/324 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQP+IP Y  GI L VG H A ILKYLTSGG+AQVYQ +ISP D  +GS+I CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLN PRAEV+AMKLLRN  +VVSYIDS+AAKS    G+ NG+YEV LLME+C+  G
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKS----GLHNGAYEVLLLMEFCAEGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL+EFEILNIMS V+QGVAAMH+L+PPLLHRDIKIENVLISN  E+KLC
Sbjct: 117 LIDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCGVIRPPT+Q E +FVQHDILKNTTAQYR+PEM+ LS+ +PI+EKSDIWALGVFL
Sbjct: 177 DFGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE AILHSRY+Y AYP YSDNLKNLIR+ML   PS+RPNICQV+EEV
Sbjct: 237 YKLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEV 296

Query: 301 SRLQGVPCPLKNFYLERAIRQTAV 324
           SRLQG+PCP+KNFYLERAI ++ +
Sbjct: 297 SRLQGIPCPIKNFYLERAIHRSTL 320

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  521 bits (1341), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 239/319 (74%), Positives = 272/319 (85%), Gaps = 4/319 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQPEIP Y PG +L VGSH AK++ YLTSGGFAQVY  EI P D    SN+ACLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLN  RAEV+AMKLLRNNK+VVSYIDSHAAKS      PNGSYEVFLLMEYC+G G
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKS----SFPNGSYEVFLLMEYCAGGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL+EFEILNIMS V+QG+AAMHALQPPL+HRDIKIENVLIS+  ++K+C
Sbjct: 117 LIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCGVIRPP N  E  +VQHD+LKNTTAQYRSPEM+ L +  PI+EKSDIWALGVFL
Sbjct: 177 DFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE AILHSR+Q+PA P YSD LK LIR MLM +P +RPN+CQV+E+V
Sbjct: 237 YKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDV 296

Query: 301 SRLQGVPCPLKNFYLERAI 319
           SR+QG+ CP++NFYL RA+
Sbjct: 297 SRMQGIQCPVRNFYLLRAM 315

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  517 bits (1331), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 250/378 (66%), Positives = 297/378 (78%), Gaps = 11/378 (2%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQP   +YT G  L VGSHQA+I+KYLTSGGFA +Y  EISP D +S  N+ACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLNV RAEV+AMKLLR NK+VVSYIDSHAAKS    G  +GSYEVFLLMEYCS  G
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKS----GAQDGSYEVFLLMEYCSAGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL E E+L IMS ++QG+AAMHAL PPL+HRDIKIENVLIS+   FK+C
Sbjct: 117 LIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCGVIRPP N  E  +VQ+DILKNTTAQYRSPEM+ L +  PINEKSDIWALGVFL
Sbjct: 177 DFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK G+ AILHSR+Q+PAYPQYSD LKNLI VML  +P++RPNICQV+EEV
Sbjct: 237 YKLCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEV 296

Query: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNIGLS 360
           SR+Q VPCPL+NFYL R+++Q   Q      Q + FP + + HS+S P +   N  +   
Sbjct: 297 SRIQNVPCPLRNFYLLRSMQQQQQQH---QQQQQTFPSVEVHHSLSQPRMDLKNGPV--- 350

Query: 361 NINFLQNVNNSAIQTANT 378
            +   ++  +SA++T+ T
Sbjct: 351 -LTPFKHAQSSALRTSKT 367

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  512 bits (1318), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 244/351 (69%), Positives = 278/351 (79%), Gaps = 7/351 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQP IP Y PG +L VGSH  KI+KYLTSGGFAQ+Y  EISP + ++ S  ACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK  LN  RAEV+AMKLL+NN++VVSYIDSHAA+S     V  G+YEVFLLMEYC G G
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARS----TVLAGAYEVFLLMEYCKGGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL E EILNI+S   QGV+AMHALQP L+HRDIKIENVLIS K EFK+C
Sbjct: 117 LIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKIC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVC  IRPP N  EL +VQHD+LKNTTAQYR+PEML L + +PINEKSDIWALGVFL
Sbjct: 177 DFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE AILHSRYQYPA+P Y+D LKNLIR  LM DPSKRPNICQ++EE+
Sbjct: 237 YKLCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296

Query: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALS 351
           SR+QG+PCP+ NFYL R I    VQ +  N  +       L+HS SS  +S
Sbjct: 297 SRIQGIPCPINNFYLSRTIN---VQASLMNPIITPTQQTALKHSQSSATIS 344

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  513 bits (1320), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 242/357 (67%), Positives = 284/357 (79%), Gaps = 13/357 (3%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQ    +Y PG  L VGSH+A+I+KYLTSGGFA +Y  EI P D+ S + IACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLNV RAEV+AMKLLR N++VVSYIDSHAAKS    GV +GSYEVFLLMEYCSG G
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKS----GVHDGSYEVFLLMEYCSGGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL+E E+L I S ++QG+AAMHALQPPL+HRDIKIENVLIS+   FK+C
Sbjct: 117 LIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCGVIRPP N  E ++VQHDILKNTTAQYR+PEM+ L +  PINEKSDIWALGVFL
Sbjct: 177 DFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE AILHSR+Q+P+YPQYSD+LK+LI  ML  +P++RPNICQV+EEV
Sbjct: 237 YKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEV 296

Query: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNI 357
           SR+QG PCPL+NFY+ RA++Q               P +   HS S P L + NN I
Sbjct: 297 SRIQGTPCPLRNFYVTRAMQQQQQHQQ---------PKIKFDHSASQPKLDSANNII 344

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  511 bits (1316), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 266/446 (59%), Positives = 322/446 (72%), Gaps = 21/446 (4%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQP+I  Y  G ILPVGSHQ K+LKYL SGGFA VY VEISP D     N+ACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLN  RAEV++MK LR NK++VSYIDSHA KS     V  G YEV+LLMEYCSG G
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKS----PVNVGMYEVYLLMEYCSGGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL+EFEILNIMS VSQGVAAMHALQPPL+HRDIKIENVL+S  +EFKLC
Sbjct: 117 LIDFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSV GVIR P N  E ++VQ+DI+KNTTAQYR PEM+ L + +PI+EKSDIWALGVFL
Sbjct: 177 DFGSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK CYYTTPFEK GE+AIL S++++PAYP+YSD +KNLI VML VDP KRPNICQVVEEV
Sbjct: 237 YKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEV 296

Query: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNIGLS 360
           SR+QG+PCP+KNFYL R + +          Q    PP H+   ++ PA  TV  ++   
Sbjct: 297 SRIQGIPCPIKNFYLLRMMDK--------QEQPRVSPPPHVPQ-MTVPA--TVPTSVSTQ 345

Query: 361 NINFLQNVNNSAIQTANTTSRINNNPYSLHNSSTLQNTPQTIAADRRYPVSTAPKQQHNI 420
           ++   Q V+N  +QT + T+ I + PY   + S    T Q + + ++    T P+   N 
Sbjct: 346 HLP-PQVVSN--VQTPSKTASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNY 402

Query: 421 PAYN--NQINDITLQKSLSATMADAP 444
            + +  ++I+   L  S SATM   P
Sbjct: 403 TSSDPFSKIDRSALL-STSATMESLP 427

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  511 bits (1316), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 235/320 (73%), Positives = 272/320 (85%), Gaps = 5/320 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MN P+I  +  G IL VGSH AK++KYLTSGG+AQVY+VEISP D +  SNIACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLN  RAEV+AMKLL+NN++VVSYIDSHA+KS     + NG+YEVF+LME+C   G
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKS----AIYNGAYEVFVLMEFCERGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMN+RLQ+RL E EIL IMSH SQG+AAMH LQP LLHRDIKIENVLIS  NE+K+C
Sbjct: 117 LIDFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCG++RPP NQ E +FV HDI+KNTTAQYRSPEML LSK +PINEKSDIWALGVFL
Sbjct: 177 DFGSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFL 236

Query: 241 YKVCYYTTPFEKE-GENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEE 299
           YK+CYYTTPFEK  GE AIL +R+QYP+YP YSD LKNLIRVML  +PS RPN+CQV+EE
Sbjct: 237 YKLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEE 296

Query: 300 VSRLQGVPCPLKNFYLERAI 319
           VSRLQG+PCP++NFYL RA+
Sbjct: 297 VSRLQGIPCPIRNFYLLRAM 316

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  510 bits (1314), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 248/372 (66%), Positives = 291/372 (78%), Gaps = 6/372 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MN P+I LY PG IL VGSH AKI+KYLTSGGFAQVY  EISP D +S +NIACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK  LN  RAEV+AMKLL+NNK+VVSYIDSHAAKS     V   +YEVF+LMEYC   G
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-----VNGVAYEVFVLMEYCERGG 115

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRL+NRL+E EIL+IM    QG+AAMHALQPPL+HRDIKIENVLIS++  +K+C
Sbjct: 116 LIDFMNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVC 175

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSV GVIRPP N  E ++VQHDIL NTTAQYRSPEM+ L + +PI+EKSDIWALGVFL
Sbjct: 176 DFGSVSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFL 235

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE AILH+RYQYP++PQYSD LKNLIR+MLM  PS+RPNICQV+EEV
Sbjct: 236 YKICYYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEV 295

Query: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNIGLS 360
           SRLQ  PCP++NFYL RA+ Q A Q    +  M   P   L    S   +  + N + LS
Sbjct: 296 SRLQNRPCPIRNFYLLRAMNQNA-QFGSESTSMTYTPAQQLVSPQSFQNIQAMPNIVPLS 354

Query: 361 NINFLQNVNNSA 372
           NI    N+++++
Sbjct: 355 NIKTTPNLDSAS 366

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  510 bits (1313), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 237/323 (73%), Positives = 269/323 (83%), Gaps = 5/323 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MN P+I LY PG IL VGSH AKI+KYLTSGGFAQVY  EISP D ++ +NIACLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK  LN  RAEV+AMKLL+NNK+VVSYIDSHAAKS     V   +YEVF+LME+C   G
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-----VNGVAYEVFVLMEFCERGG 115

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL+E EIL IMS   QG+AAMHALQPPL+HRDIKIENVLIS+   +K+C
Sbjct: 116 LIDFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVC 175

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSV GVIRPP N  E ++VQHDIL NTTAQYRSPEM+ L + +PI+EKSDIWALG+FL
Sbjct: 176 DFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFL 235

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE  ILH+RYQYP +PQYSD LKNLIR+MLM  PSKRPNICQV+EEV
Sbjct: 236 YKICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEV 295

Query: 301 SRLQGVPCPLKNFYLERAIRQTA 323
           SRLQ  PCP++NFYL RA+ QTA
Sbjct: 296 SRLQIKPCPIRNFYLLRAMSQTA 318

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  505 bits (1301), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 243/359 (67%), Positives = 285/359 (79%), Gaps = 12/359 (3%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           M+QP +  Y  G +L VGSH+A+I+KYLTSGGFA +Y  EISP D +S S+IACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNS-SSIACLKRVLV 59

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLN  RAEV+AMKLL+ +K+VVSYIDSHAAKS     + NGSYEVFLLMEYC+  G
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKS----SLNNGSYEVFLLMEYCARGG 115

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRLKEFE+L IMS VSQGVAAMHALQPPL+HRDIKIENVLIS    FK+C
Sbjct: 116 LIDFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVC 175

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCGVIRPP N  EL++VQHDILKNTTAQYRSPEM+ L + +P++EKSDIWALGVFL
Sbjct: 176 DFGSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFL 235

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE AILHS++Q+PAYPQYSD LKNLI  +L  +P +RPNICQ++ EV
Sbjct: 236 YKLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEV 295

Query: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNIGL 359
           SR+QGVPCP+KNFYLER +     Q      Q        L+HS+S P +  +   I L
Sbjct: 296 SRIQGVPCPVKNFYLERKMLLQQQQQQQQQLQ-------PLRHSVSQPQMEAITLPITL 347

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  505 bits (1301), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 235/323 (72%), Positives = 267/323 (82%), Gaps = 5/323 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MN P+I LY PG IL VGSH AKI+KYLTSGGFAQVY  EISP D +S +NIACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           P K  LN  RAEV+AMKLLRNNK+VVSYIDSHAA+S     V   +YEVF+LME+C   G
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARS-----VNGIAYEVFVLMEFCERGG 115

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL+E EIL IMS   QG+ AMHALQPPL+HRDIKIENVLIS+   +K+C
Sbjct: 116 LIDFMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVC 175

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSV GVIRPP N  E ++VQHDIL NTTAQYRSPEM+ L + +PI+EKSDIWALGVFL
Sbjct: 176 DFGSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFL 235

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE  ILH+RYQYP++PQYSD LKNLIR+MLM  PS+RPNICQV+EEV
Sbjct: 236 YKICYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEV 295

Query: 301 SRLQGVPCPLKNFYLERAIRQTA 323
           SRLQ  PCP++NFYL RA+ Q A
Sbjct: 296 SRLQNKPCPIRNFYLLRAMNQNA 318

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  503 bits (1294), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 234/318 (73%), Positives = 267/318 (83%), Gaps = 4/318 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQP IPLY  G +L VG+H+A I KYLTSGGFAQ+Y VEI+P D +S SN+ACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           P K+ LN  RAEV+AMKLL+NN++VVSYIDS+A KS       NGSYEV LLMEYC G G
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKS----AFNNGSYEVLLLMEYCEGGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMN+RLQNRL E EILNI+S  +QGVA MHALQP LLHRDIKIENVL S   EFKLC
Sbjct: 117 LIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCG IRPP NQ EL +VQHDILKNTTAQYR PEML L + +PI+EKSDIWALGVFL
Sbjct: 177 DFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GENAILHS++QYPA+P YSD LKNLIRVML  +P+KRPNIC+++EE+
Sbjct: 237 YKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296

Query: 301 SRLQGVPCPLKNFYLERA 318
           S +QGVPCP++NFYL RA
Sbjct: 297 SSIQGVPCPIQNFYLIRA 314

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  497 bits (1280), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/319 (72%), Positives = 268/319 (84%), Gaps = 4/319 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQP++ +Y PG +L VGSHQA+I+KYLTSGGFAQVY  EISP D    S+I CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLN  RAEV+AMKLLRNN +VVSYIDSHAAK         GSYEVFLLMEYC   G
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKF----DTNIGSYEVFLLMEYCDRGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL E EIL+IMS VSQGVAAMHALQPPLLHRDIKIENVL++++  +KLC
Sbjct: 117 LIDFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCG+IRPPTN  E  +VQHDI+KNTTAQYRSPEM++L K +PINEKSDIWALGVFL
Sbjct: 177 DFGSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GENAILH+ +Q+P +P YSD +K+LIR+ L V PS+RPNI Q++EEV
Sbjct: 237 YKLCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296

Query: 301 SRLQGVPCPLKNFYLERAI 319
           S++Q VPCP+ +FYL+R +
Sbjct: 297 SKIQNVPCPIPDFYLQRKL 315

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  499 bits (1286), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 233/323 (72%), Positives = 266/323 (82%), Gaps = 5/323 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MN P+I LY PG +L VGSH AKI+KYLTSGGFAQVY  EISP D +S +N ACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK  LN  RAEV+AMKLL+NNK+VVSYIDSHAAKS     V   +YEVF+LME+C   G
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-----VNGIAYEVFVLMEFCERGG 115

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQ+RL+E EIL IMS   QG+AAMH LQPPL+HRDIKIENVLIS+   +K+C
Sbjct: 116 LIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVC 175

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSV GVIRPP N  E ++VQHDIL NTTAQYRSPEM+ L ++ PI+EKSDIWALGVFL
Sbjct: 176 DFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFL 235

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE AILHSRYQYP++PQYSD LK LI +MLM  PS+RPNICQV+EEV
Sbjct: 236 YKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295

Query: 301 SRLQGVPCPLKNFYLERAIRQTA 323
           SRLQ  PCP++NFYL RA+ Q A
Sbjct: 296 SRLQNEPCPIRNFYLLRAMGQNA 318

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 12/105 (11%)

Query: 577 LSKNDSKNAVDSRSSFNSNAEPSSELTNKTVKKNSITDRYLNSVGDNGVTSVKKTAEGYG 636
           + KN +     SR++  S+   SS++  K V K SI  R  N + ++      K+A GYG
Sbjct: 643 VKKNQTTPKTASRTTLKSD---SSDIDVKQVNKESIQRRVHNLLNNSEDPLAHKSASGYG 699

Query: 637 KYTKVSDKEGSLTSVNTAKPLESGHKSENTNKY-----IKGNTKQ 676
           KYT V+ +  +  S     P+  G      NKY     +KG T +
Sbjct: 700 KYTDVNAEASNRHSSVRITPITEG----KFNKYYNSGTLKGETSR 740

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  478 bits (1231), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 227/316 (71%), Positives = 263/316 (83%), Gaps = 5/316 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQP+I  Y PG ILPVGSHQ +I+KY+TSGGFAQ+Y VEISP D    SNIACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLN  RAEV+AMKLLRNNK+VVSYIDSHA+KS       NGSYEVFLLMEYC   G
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKS----NFNNGSYEVFLLMEYCERGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL E E+L+I S V+QG+AAMHALQPPLLHRDIKIENVLIS  N++K+C
Sbjct: 117 LIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKIC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSV G+IRPP N  EL +VQHD+LKNTTAQYRSPEM+   + +PI+EKSDIWA+GVFL
Sbjct: 177 DFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFL 236

Query: 241 YKVCYYTTPFEKE-GENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEE 299
           YK+CYYTTPFEK  GE AIL +RY+YP +P YS+ LK+LI  MLM +P +RPNI QV+EE
Sbjct: 237 YKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEE 296

Query: 300 VSRLQGVPCPLKNFYL 315
           +S++Q VPCP+ NFYL
Sbjct: 297 ISKMQNVPCPIVNFYL 312

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  488 bits (1255), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 225/322 (69%), Positives = 262/322 (81%), Gaps = 4/322 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MN PEIP YTPG +L VG+H AKILKY+ SGGFAQVY  E+ P D  +G+N  CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           P+K  LN  RAEV AMKLL+ +K+VV YIDSHAA+S     + NG+YEVFLLME+C+  G
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSL----LQNGTYEVFLLMEFCTAGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRLKE+EILNIMS V+QG+AAMHALQPPL+HRDIKIENVLIS   E+K+C
Sbjct: 117 LIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSV G IRPP N  E  FVQHDILKNTTAQYRSPEM+ L +   I+EKSDIWALG+FL
Sbjct: 177 DFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK G+ AILHSRYQ+ A+P YSD LKNLI  ML   P +RPNICQV+EEV
Sbjct: 237 YKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296

Query: 301 SRLQGVPCPLKNFYLERAIRQT 322
           SR+QGV  P++NFYL RA++ T
Sbjct: 297 SRMQGVSSPMRNFYLLRAMQHT 318

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  484 bits (1245), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 220/324 (67%), Positives = 267/324 (82%), Gaps = 4/324 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQ ++PLY P  ++ VGSH AKI+KYL SGG+AQVY   ++P D    +NIACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLN  RAEV+A+K+LRN KYVVSYIDSHA+K         GSYEVF+LMEYCSG  
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGH----TGSYEVFVLMEYCSGGS 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDF+NTRL+NRL+E EIL+IM+ V+ GVA MH LQP L+HRDIKIEN+LIS   E+K+C
Sbjct: 117 LIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCGVIRPP +  E+ ++QHDI+KNTTAQYRSPEML L+K   INEKSDIWALGVFL
Sbjct: 177 DFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           +K+CYYTTPFEKEGE AIL S++QYPAYP YSD+LKN+IRV+L VDP KRPNICQ++EE+
Sbjct: 237 FKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEEL 296

Query: 301 SRLQGVPCPLKNFYLERAIRQTAV 324
           SRLQG+  P+KNFYL RA+  +++
Sbjct: 297 SRLQGIVPPMKNFYLSRALETSSL 320

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  478 bits (1231), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 223/324 (68%), Positives = 262/324 (80%), Gaps = 4/324 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQPE+     G  L VG+H  KILKYLTSGGFAQ+Y VEI    + +GSN+ACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLN+ RAEV+AMKLL NNK+VVSYIDSHA +S       +G+YEVFLLMEYC G G
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRS----PTNDGTYEVFLLMEYCEGGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL E EIL+IMS  +QG+A MHAL PPLLHRDIKIENVL+S    +K+C
Sbjct: 117 LIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSV GVIRPP NQ EL +VQHDI+KNTTAQYR PEML L + +PI+EK+DIWALGVFL
Sbjct: 177 DFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE AILH+R+Q+P++P YSD LKNLI+ ML   PS RPN+CQV+EEV
Sbjct: 237 YKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296

Query: 301 SRLQGVPCPLKNFYLERAIRQTAV 324
           SR+Q VPCP++NFYL RA+ +  +
Sbjct: 297 SRMQNVPCPIRNFYLLRAMEKVKL 320

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  475 bits (1223), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 217/317 (68%), Positives = 257/317 (81%), Gaps = 4/317 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQP I  Y PG  L VG HQ  I+KYLTSGGFAQ+YQV+++P +  +G N+ACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           P+K+ LN  RAEVEAM+LL+   +VV YIDS+AA+S       +G+YEV  LME+C G G
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISN----DGTYEVLQLMEFCPGGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRLKEFE+LNIM+ V+QG+ AMH+L PPL+HRDIKIENVLIS+  E+K+C
Sbjct: 117 LIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSV G+IRPP N  E +FVQ DI+KNTTAQYR PEML L +  PINEKSDIWALGVFL
Sbjct: 177 DFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFE  GE AILH+RYQYP YP YS  LKNLIR+MLM  P +RPN+CQV+EEV
Sbjct: 237 YKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296

Query: 301 SRLQGVPCPLKNFYLER 317
           S +QG+PCPL NFYL+R
Sbjct: 297 SSMQGIPCPLPNFYLQR 313

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  476 bits (1225), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 226/352 (64%), Positives = 274/352 (77%), Gaps = 8/352 (2%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEI-SPYDIHSGSNIACLKRVI 59
           MNQ       PGIIL VGSH+ KI++YLTSGGFAQ+Y  E+ SP  I    ++ACLKRV 
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQG--SLACLKRVH 58

Query: 60  VPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGK 119
           VPDK SLN  RAEV+AMK+L+ +++VVSYIDSHAAKS       +G+YEV+LLMEYC   
Sbjct: 59  VPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRH----DGTYEVYLLMEYCLRG 114

Query: 120 GLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKL 179
           GLIDFMN+RLQ RL EFE+L IMSHV+QG+ AMHAL PPL+HRDIKIENVLIS   +FK+
Sbjct: 115 GLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKV 174

Query: 180 CDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVF 239
           CDFGSV GVIRPP N  E ++VQHDILKNTTAQYR+PEM+ L +++P++EKSDIWALGVF
Sbjct: 175 CDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVF 234

Query: 240 LYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEE 299
           LYKVCY+TTPFEK GENAIL +++Q+P+YPQY+D LKNLI VML   P +RPNICQV+EE
Sbjct: 235 LYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEE 294

Query: 300 VSRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALS 351
           VSR+QGVPCPL NFYLER ++  A    H +      P    Q S S+P ++
Sbjct: 295 VSRIQGVPCPLPNFYLER-MKHGACTPVHHSASQPALPLATHQFSTSTPMVT 345

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  470 bits (1210), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 224/337 (66%), Positives = 266/337 (78%), Gaps = 14/337 (4%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQP+I  Y  G  L VGSHQ +I+KYLTSGGFAQVY   ISP D HS SNIACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLN  RAEV+AM+LLRNN+YVVSYIDSHAAK+     + NGSYEVF+LMEYC   G
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAM----LHNGSYEVFVLMEYCERGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL EFEIL IMS V+QGVAAMHALQPPL+HRDIKIENVLIS  NE+KLC
Sbjct: 117 LIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCGVIRPP N  EL +VQ DI KNTTAQYRSPEM+ + + +PI+EKSDIWALG+FL
Sbjct: 177 DFGSVCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE AIL   +++P YP YS+ L++LIR +L+ +P +RPN+ Q+++ +
Sbjct: 237 YKLCYYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRI 296

Query: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFN----HQM 333
           S +Q VPCP+ +  + +A       D+H N    HQ+
Sbjct: 297 SIMQNVPCPISDIQVPQA------PDSHLNLTELHQL 327

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  467 bits (1202), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 220/316 (69%), Positives = 258/316 (81%), Gaps = 4/316 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQP I  Y  G  L VGSHQ +I+KYLT+GGFAQ+YQ  ISP D  SG+NIACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLNV RAEV+AMKLLRNN+ VVSYIDSHAAKS       NG+YEVFLLMEYC   G
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKS----SFQNGTYEVFLLMEYCENGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LI+F+N+RLQNRLKE E++NIM  VSQGVAAMHALQPPL+HRDIKIENVL+S  NEFKLC
Sbjct: 117 LINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSV G IRPP+N  EL  VQ+DI++NTTAQYRSPEM+ +S+  PI+EKSDIWALGVFL
Sbjct: 177 DFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE  IL SRY++PA+P YSD L++LI  +L V P+ RPNI  VV+E+
Sbjct: 237 YKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296

Query: 301 SRLQGVPCPLKNFYLE 316
           S ++ + CP+ NFYL+
Sbjct: 297 SDMKNISCPIINFYLK 312

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  466 bits (1200), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 216/318 (67%), Positives = 258/318 (81%), Gaps = 4/318 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQP+I  Y  G  L VGSHQ +I+KYLTSGGFAQVY   I+P D HS S++ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLN  RAEV+AM+LL+NN+YVVSYIDSHAAK+     + NGSYEVF+LMEYC   G
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAM----LHNGSYEVFVLMEYCERGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL EFEIL IMS V+QGVAAMHALQPPL+HRDIKIENVLIS  NE+KLC
Sbjct: 117 LIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCG+IRPP N  EL +VQ DILKNTTAQYRSPEM+   + +PI+EKSDIWALG+FL
Sbjct: 177 DFGSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK G+ AIL  ++++P YP YS+ LK LIR +L+ DP  RPN+ Q+++ +
Sbjct: 237 YKLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRI 296

Query: 301 SRLQGVPCPLKNFYLERA 318
           S +Q VPCP+ +  + +A
Sbjct: 297 SIMQNVPCPINDIQVVQA 314

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  462 bits (1188), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 213/313 (68%), Positives = 257/313 (82%), Gaps = 4/313 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQP+I  Y  G  L VGSHQ +I+KYLTSGGFAQVY V ISP D H+ +N+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLN  RAEV+AM+LL+NN+YVVSYIDSHAAK+     + NGSYEVF+LMEYC   G
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAI----LQNGSYEVFVLMEYCERGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL EFEIL I+S V+QGVAAMHALQPPL+HRDIKIENVLIS  NE+KLC
Sbjct: 117 LIDFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCG+IR P N  EL +VQ DILKNTTAQYRSPEM+ + + +PI+EKSDIWALG+FL
Sbjct: 177 DFGSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE AIL  ++++P YP YS+ LK+LIR +L+ +P  RP++ Q+++ +
Sbjct: 237 YKLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRI 296

Query: 301 SRLQGVPCPLKNF 313
           S +Q VPCP+ + 
Sbjct: 297 SIMQNVPCPINDI 309

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  462 bits (1188), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 232/400 (58%), Positives = 292/400 (73%), Gaps = 15/400 (3%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQP+I  Y  G  L VGSHQ +I+KYLTSGGFAQVY   ISP D H+ SN+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDKTSLN  RAEV+AMKLLRNN+YVVSYIDSHAAK+     + NGSYEVF+LMEYC   G
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKAT----LHNGSYEVFVLMEYCERGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL E EIL IM  V+QGVAAMHALQPPL+HRDIKIENVLIS KNE+KLC
Sbjct: 117 LIDFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCGVIRPP N  EL +V+ D+LKNTTAQYRSPEM+ + + +PI+EKSDIWALG+FL
Sbjct: 177 DFGSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE AIL+ ++++  YP YS+ L+NLI  +L+ +PS+RPN+ Q+++++
Sbjct: 237 YKLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQI 296

Query: 301 SRLQGVPCPLKNFY-LERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNIGL 359
           + +Q  P P+++   ++R      + + H N   +    L+  HSI         N   +
Sbjct: 297 TNMQNAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLN-SHSI---------NENSM 346

Query: 360 SNINFLQNVNNSAIQTANTTSRINNNPYSLHNSSTLQNTP 399
           SN NF   +  + I   +  +R N+  +    SS+L  +P
Sbjct: 347 SNQNFQFRMPANVITAQSLPTRENSQAFINATSSSLTGSP 386

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  462 bits (1190), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 222/351 (63%), Positives = 267/351 (76%), Gaps = 19/351 (5%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQ     + PG +L VGSH+ K++KYLTSGGFAQ+Y  E+   D     ++ACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPD-SKVKDVACLKRVHV 59

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK SLN  RAEV+AMKLLR NK++VSYIDSHA+KS     + NGSYEV LLMEYCS  G
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSV----LNNGSYEVVLLMEYCSRGG 115

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LI FMNTRLQ+RLKEFE+L IM+ V QG+ AMHALQPPL+HRDIKIENVLI+   + K+C
Sbjct: 116 LISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVC 175

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCGVIRPP N  EL +VQHDILKNTTAQYR+PEM+ L +   ++EKSDIWALGVFL
Sbjct: 176 DFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFL 235

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFEK GE AIL + +Q+P+YPQYS+ LKNLI VML  +P  RPN CQV+EEV
Sbjct: 236 YKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295

Query: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALS 351
            R+QG PCP+KNFYLER+++Q                P  L+HS+S P ++
Sbjct: 296 CRIQGQPCPVKNFYLERSLKQQI--------------PSQLRHSVSQPMIA 332

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  462 bits (1189), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 212/321 (66%), Positives = 253/321 (78%), Gaps = 10/321 (3%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSN----IACLK 56
           MNQPEIP Y  G +LP+G+HQ  I KYL  GGFAQVY V +   D  +  N    +ACLK
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV--IDSSNARNELGTMACLK 58

Query: 57  RVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYC 116
           RVIVPDK+ LN  RAEV+AMKLL+ NKY+VSYIDSHA +S     +  G YEVFLLMEYC
Sbjct: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSE----LKQGEYEVFLLMEYC 114

Query: 117 SGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNE 176
           S  G+IDF+NTRL +RL+EFEIL IMS V QGVAAMH LQPPL+HRDIKIENVLIS   +
Sbjct: 115 SRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGD 174

Query: 177 FKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWAL 236
           +K+CDFGS C V+RPP    E  F+ HDI+ NTTAQYRSPEM+      PI+EKSDIWAL
Sbjct: 175 YKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWAL 234

Query: 237 GVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQV 296
           GVFLYK+CYYTTPFEKEGENAIL+ ++Q+P+YPQYSD+++N+I +ML  DP KRPNICQV
Sbjct: 235 GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294

Query: 297 VEEVSRLQGVPCPLKNFYLER 317
           +E+VS+LQGVPCP++NF L R
Sbjct: 295 LEQVSKLQGVPCPIENFMLTR 315

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  438 bits (1126), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 212/328 (64%), Positives = 255/328 (77%), Gaps = 12/328 (3%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MNQP IP Y PG ++ VGSHQAKILKYLTSGGFAQ+Y VEISP D ++ SNIACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           P+K+ LNV R EV+AMKLL+NN++VVSYIDS+AAKS       NGSYEVFLLMEYC    
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSE----FGNGSYEVFLLMEYCERGS 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           L+DFMNT+L+ RL+E E+LNIM+ V QG+AAMH L PPL+HRDIKIENVLIS    FK+C
Sbjct: 117 LLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSVCG+IRPP N  EL +VQHD++KNTTAQYRSPEM+ L K  PI  K  I  LG + 
Sbjct: 177 DFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWC 234

Query: 241 YK----VCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQV 296
                 + +YT  F ++ E AIL+ RYQYPAYP YSD LKN++RV+L   P KRPNICQ+
Sbjct: 235 VALQIMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQL 292

Query: 297 VEEVSRLQGVPCPLKNFYLERAIRQTAV 324
           +EE+S++Q +PCP+ NFYLER+  Q AV
Sbjct: 293 LEEISKIQNIPCPIDNFYLERSRHQGAV 320

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 60/145 (41%), Gaps = 28/145 (19%)

Query: 571 TELKMELSKNDSKNAVDSRSSFNSNAEPSSELTNKTVKKNSITDRYLNSVGDNGVTSVKK 630
           +EL  E    D+ +  D ++SF S +     +  K   K SI  R LN + +   + VKK
Sbjct: 599 SELSDENELYDTLHLPDPKTSFQSPSPLKYAVDRKM--KASIEKRVLNLLKNAEDSPVKK 656

Query: 631 TAEGYGKYTK--------------VSDKEGSLTSVNTAKPLESGH---------KSENTN 667
           TA GYGKYTK              V     S T +  +    SGH         +  +  
Sbjct: 657 TAAGYGKYTKRPKMVSPTNPHYHLVRQNSVSQTPLILSARGSSGHPVVVPALINRDNDNG 716

Query: 668 KYIKGNTKQKVPPKLPTKPSYLGGK 692
           KY     K K PP +P KP +L  K
Sbjct: 717 KY---PAKSKAPPVVPKKPDHLRPK 738

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  430 bits (1105), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 207/349 (59%), Positives = 256/349 (73%), Gaps = 5/349 (1%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60
           MN P IP Y PG  + VGSH   ILKYLTSGG+AQ+Y  +I P D   G+N+A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PDK+ LN  RAEV+AMK L+++KY+VSYIDSHAAKS+      +G+YEVFL+MEYCS  G
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQ----YMDGTYEVFLIMEYCSRGG 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           LIDFMNTRLQNRL E EIL I  H+SQGVAAMH LQPPL+HRDIKIENVLISN +++KLC
Sbjct: 117 LIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLC 176

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240
           DFGSV G IRPP    EL +V+HDI+ +TTAQYR+PEML L+K   +N+KSDIWALGVFL
Sbjct: 177 DFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFL 236

Query: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           YK+CYYTTPFE+ GE  IL+   ++P YP YSD +K LI  ML  +P  RPNI Q+++ V
Sbjct: 237 YKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTV 296

Query: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQ-FPPLHLQHSISSP 348
           S+L  V CP+ N ++   I      +N  N  +   + P++    IS+P
Sbjct: 297 SKLLNVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYKPMNQNSGISTP 345

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  413 bits (1061), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 194/311 (62%), Positives = 238/311 (76%), Gaps = 4/311 (1%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNV 68
           Y  G  L V SH+  I  YLTSGGFAQVY   I+    +    + CLKRVIVP+K SLN+
Sbjct: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68

Query: 69  PRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTR 128
            RAEV+AMK+L+NNKY+VSYIDSHA + + +      SY V LLMEYCSG GL+DFMN R
Sbjct: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNS----EDSYVVLLLMEYCSGAGLLDFMNLR 124

Query: 129 LQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGV 188
           L+ RLKE EIL IM+ VSQGV  MH LQPPLLHRDIKIENVL+S    FKLCDFGSV GV
Sbjct: 125 LKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGV 184

Query: 189 IRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTT 248
           +R PT+  E  ++Q+DILKNTTAQYRSPEM++L+   PINEKSDIWALG+ LYK+CYYTT
Sbjct: 185 LRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTT 244

Query: 249 PFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPC 308
           PFE+ G  AI+  ++ YPAYPQY+D+LKN+IRV+L  +P +RPNICQ++EE+ R+Q    
Sbjct: 245 PFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSS 304

Query: 309 PLKNFYLERAI 319
           PL NFY++RA+
Sbjct: 305 PLPNFYVQRAM 315

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 46/96 (47%), Gaps = 12/96 (12%)

Query: 597 EPSSELTNKTVKKNSITDR---YLNSVGDNGVTSVKKTAEGYGKYTKVSDKEGSLTSVNT 653
           +P   +TN   KK SI DR    + S  DN V     +A GYGKYT   D + S+    +
Sbjct: 618 DPIILITNLEAKK-SIKDRVQALMKSSSDNHVII---SAHGYGKYT---DNKSSIKHFKS 670

Query: 654 AKPLESGHKSENTNKYIKGNTKQKVPPKLPTKPSYL 689
              +E      N N ++K     K  PK+PTKP +L
Sbjct: 671 N--IEHLTAYGNMNGHLKTAHHLKAKPKVPTKPVFL 704

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  306 bits (785), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 162/327 (49%), Positives = 214/327 (65%), Gaps = 26/327 (7%)

Query: 6   IPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPY-------DIHSG--------S 50
           I  ++ G  + VGSH  +I+KYLT GGFAQ+Y V+++ Y       DI +          
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 51  NIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVF 110
           ++ CLKRV+V D+  L+  + EV  MK LR    VV Y DS+A ++R A    NG +EVF
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGA----NGGFEVF 141

Query: 111 LLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVL 170
           LLMEYC  K L+D+MN RL  +L E EILNIM  ++ GV+ +H L  PL+HRDIKIENVL
Sbjct: 142 LLMEYCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVL 201

Query: 171 ISNKNEFKLCDFGSVCGVIRPP---TNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           + + N FKLCDFGS    I PP   TNQ ++  + HDI  +TT QYRSPEM+ L + +P+
Sbjct: 202 VDHNNRFKLCDFGSTN--ICPPIATTNQ-DISVLTHDIYVHTTPQYRSPEMIDLFRCLPV 258

Query: 228 NEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDP 287
           NEK+DIWALGVFLYK+ +YTTPFE  G+ AILHS+Y+ P    YS+ L NLI VML  +P
Sbjct: 259 NEKADIWALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQS-HYSERLLNLIVVMLAENP 317

Query: 288 SKRPNICQVVEEVSRLQGVPCPLKNFY 314
           + RPNI QV+ E+  +  V  P+ + Y
Sbjct: 318 NLRPNIYQVLSEICSILNVEVPIPDIY 344

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  297 bits (761), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 202/315 (64%), Gaps = 14/315 (4%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPY---------DIHSGSNIACLKRVI 59
           Y PG I+ VG H+ +++KYL  GGFA++Y V+   Y         ++    +  CLKRV+
Sbjct: 29  YVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKRVL 88

Query: 60  VPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGK 119
           V D   LN  R EVE M+ L+    VV Y DS+A  SR   G P   YEV LLME CS  
Sbjct: 89  VQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNA--SRRIDGAP--GYEVLLLMELCSNN 144

Query: 120 GLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKL 179
            L+D+MN RL  +L E EIL IM  V+  VA MH L  PL+HRDIKIENVL+ +KN FKL
Sbjct: 145 SLLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKL 204

Query: 180 CDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVF 239
           CDFGS    +   ++  ++  +  +I  +TT QYRSPEM+ L + +P+NEKSDIWALGVF
Sbjct: 205 CDFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVF 264

Query: 240 LYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEE 299
           LYK+ +YTTPFE+ G+ AILHS+Y++P    YS  L NLI VML  +P+ RPNI QV+ +
Sbjct: 265 LYKLMFYTTPFERTGQFAILHSKYEFPLN-NYSSKLINLIIVMLAENPNLRPNIYQVLNQ 323

Query: 300 VSRLQGVPCPLKNFY 314
           +  + G+  P+ + Y
Sbjct: 324 ICYISGIKNPMDDAY 338

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  296 bits (758), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 152/320 (47%), Positives = 206/320 (64%), Gaps = 15/320 (4%)

Query: 4   PEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEI--------SPYDIHSGSNIACL 55
           P +    PG ++ VGSH+ +I+KYL  GGFA +Y V+         +P       ++ACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 56  KRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRP-APGVPNGSYEVFLLME 114
           KRV+V D+  LN  R EVE MK L+N+  +V Y DS+A++ R  +PG     YEV LLME
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPG-----YEVLLLME 141

Query: 115 YCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNK 174
            C  K L+D+MN RL  +L E E+L IM  V++ VA MH L  PL+HRDIKIENVL+ ++
Sbjct: 142 LCPNKSLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSE 201

Query: 175 NEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIW 234
           N FKLCDFGS        T   ++  + ++I  +TT QYR+PEM+ L + +PI+EKSDIW
Sbjct: 202 NNFKLCDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIW 261

Query: 235 ALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNIC 294
           ALG+FLYK+ +YTTPFE  G+ AILHS+Y  PA   YS  L NLI +ML  +P+ RPNI 
Sbjct: 262 ALGIFLYKLLFYTTPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIY 320

Query: 295 QVVEEVSRLQGVPCPLKNFY 314
           QV+ +V  +  V  P ++ Y
Sbjct: 321 QVIYQVCAIMKVDVPFEDKY 340

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  293 bits (751), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 151/328 (46%), Positives = 202/328 (61%), Gaps = 28/328 (8%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQV----------------------EISPYDI 46
           + PG ++ VG H+ +I+KYL  GGFAQ+Y V                      E   + +
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 47  HSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGS 106
             G N+ACLKRV+VPD+  LN  R EV  M+ L+    +V Y DS+A++        N  
Sbjct: 79  EPG-NLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDG----NPG 133

Query: 107 YEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKI 166
           +EV LLME C    L+D+MN RL  +L E EIL IM  V+ G++ MH LQ PL+HRDIKI
Sbjct: 134 FEVLLLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKI 193

Query: 167 ENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIP 226
           ENVL+ + N FKLCDFGS        T+  E+  +  +I  +TT QYRSPEM+ L +++P
Sbjct: 194 ENVLVDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLP 253

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVD 286
           I+EKSDIWALGVFLYK+ +YTTPFE  G+ AILHS+Y+ P    YS  L NLI +ML  +
Sbjct: 254 IDEKSDIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLAEN 312

Query: 287 PSKRPNICQVVEEVSRLQGVPCPLKNFY 314
           P+ RPNI QV+ +V    G+  P+K+ Y
Sbjct: 313 PNLRPNIYQVMHQVCITIGIEPPIKDKY 340

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  292 bits (748), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 205/327 (62%), Gaps = 28/327 (8%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPY-------------DIHSGSNIACL 55
           Y PG ++ VGSH+ +IL+Y+  GGFAQ+Y V+   Y             D     ++ACL
Sbjct: 18  YQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDLACL 77

Query: 56  KRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGS--------Y 107
           KRVIV D+  LN  R EV  MK L     +V Y DS+A++ R      NG+        +
Sbjct: 78  KRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLR------NGTDSQPQENKF 131

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           EV LLME C  K L+D+MN RL  +L E EIL +M  VS  +A MH L+ PL+HRDIKIE
Sbjct: 132 EVLLLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIE 191

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           NVL+  KN FKLCDFGS            ++ ++  +I  +TT QYRSPEM+ L + +PI
Sbjct: 192 NVLVDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPI 251

Query: 228 NEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDP 287
           +EKSDIWALG+FLYK+ ++TTPFE+ G+ AILHS++++P    YS  L NLI VML  +P
Sbjct: 252 DEKSDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENP 310

Query: 288 SKRPNICQVVEEVSRLQGVPCPLKNFY 314
           + RPNI QV+ ++ +L+ VP P+ + Y
Sbjct: 311 NLRPNIYQVLHQICQLKQVPIPIADKY 337

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  294 bits (752), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 207/324 (63%), Gaps = 15/324 (4%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPY-----DIHSGS----- 50
           +N P    Y  G ++ VG+H+ +I+ YL  GGFAQ+Y V+   Y      + S S     
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVF 110
           +IACLKRVIV D+  LN  R EVE MK L+++  +V Y DS+A  SR   G P   +EV 
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNA--SRRTDGKP--GFEVL 127

Query: 111 LLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVL 170
           LLME C  K L+D+MN RL+ +L E EIL IM  VS G++ MH L  PL+HRDIKIENVL
Sbjct: 128 LLMELCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVL 187

Query: 171 ISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEK 230
           +   N FKLCD GS      P  +  ++  +  +I  +TT QYR+PEM+ L + +PINEK
Sbjct: 188 VDANNNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEK 247

Query: 231 SDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKR 290
           SDIWALG+FLYK+ +YTTPFE  G+ AILHS+Y +P   +YS  + NLI +ML  +P+ R
Sbjct: 248 SDIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLR 306

Query: 291 PNICQVVEEVSRLQGVPCPLKNFY 314
           PNI QVV  +  +  +P P+++ Y
Sbjct: 307 PNIFQVVYHICSIMNLPVPIEDRY 330

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  293 bits (750), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 208/327 (63%), Gaps = 14/327 (4%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVE----ISPYDIHSG-----SN 51
           M  P +  YTPG I+ VG+H+ +++ YL  GGFAQ+Y V+    ++ +D  +       +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  IACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFL 111
           +ACLKRV+V D+  LN  R EVE MK L+    +V Y DS+A++ R   GV    +EV L
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRD--GVQ--GFEVLL 129

Query: 112 LMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLI 171
           LME C  K L+D+MN RL  +L E EI+ IM  V+  ++ MH L   L+HRDIKIENVL+
Sbjct: 130 LMELCPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLV 189

Query: 172 SNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKS 231
             KN FKL DFGS        T   ++  +  +I  +TT QYRSPEM+ L + +PINEKS
Sbjct: 190 DAKNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKS 249

Query: 232 DIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRP 291
           DIWALGVFLYK+ ++TTPFE  G+ AILHS+Y++P   +YS  L NLI +ML  +P+ RP
Sbjct: 250 DIWALGVFLYKLLFFTTPFEMTGQFAILHSKYEFPV-NKYSSKLINLIIIMLAENPNLRP 308

Query: 292 NICQVVEEVSRLQGVPCPLKNFYLERA 318
           NI QV+  +  +  V  P+++ Y E A
Sbjct: 309 NIYQVLYHLCEILNVEVPIEDKYAEGA 335

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  293 bits (749), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 203/319 (63%), Gaps = 17/319 (5%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPY-----------DIHSGSNIACLKR 57
           YTPG  + VG+H+ +I+KY+  GGFAQ+Y V+   +            +  G ++ACLKR
Sbjct: 22  YTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMG-DVACLKR 80

Query: 58  VIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCS 117
           V+V D+  LN  R EVE MK L+    +V Y DS+A  SR   G P   +EV LLME C 
Sbjct: 81  VLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNA--SRRHNGFP--GFEVLLLMELCP 136

Query: 118 GKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEF 177
            K L+D+MN RL  +L E EIL IM  V+  V+ MH L  PLLHRDIKIENVL+  +N F
Sbjct: 137 NKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196

Query: 178 KLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALG 237
           KLCDFGS        T   ++  +  +I  +TT QYRSPEM+ L + +PI+EKSDIWALG
Sbjct: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256

Query: 238 VFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVV 297
           +FLYK+ ++TTPFE  G+ AILHS+Y++P    YS  L NLI +ML  +P+ RPNI QV+
Sbjct: 257 IFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQVL 315

Query: 298 EEVSRLQGVPCPLKNFYLE 316
             +  + G+  P+++ Y E
Sbjct: 316 HNICSISGMKVPIEDQYAE 334

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  293 bits (749), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 156/348 (44%), Positives = 216/348 (62%), Gaps = 17/348 (4%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPY--DIHSGS-------N 51
           M  P +  YTPG I+ VG+H+ +I+ YL  GGFAQ+Y V+   Y  +  + +       +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  IACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFL 111
           +ACLKRV+V D+  LN  R EVE MK L+    VV Y DS+A++ R   GV    +EV L
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRD--GV--QGFEVLL 129

Query: 112 LMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLI 171
           LME C  K L+D+MN RL  +L E EI+ IM  V+  ++ MH L  PL+HRDIKIENVL+
Sbjct: 130 LMELCPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLV 189

Query: 172 SNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKS 231
             K+ FKL DFGS        T   ++  +  +I  +TT QYRSPEM+ L + +PINEKS
Sbjct: 190 DAKDSFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKS 249

Query: 232 DIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRP 291
           DIWALG+FLYK+ ++TTPFE  G+ AILHS+Y++P   +YS  L NLI +ML  +P+ RP
Sbjct: 250 DIWALGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRP 308

Query: 292 NICQVVEEVSRLQGVPCPLKNFYLE---RAIRQTAVQDNHFNHQMEQF 336
           NI QV+  +  +  V  P+++ Y E      R T  Q+   N Q++ +
Sbjct: 309 NIYQVLCHLCDILNVEVPIEDKYAEGPYNFARYTQFQNKLQNVQLQMY 356

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  292 bits (747), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 208/327 (63%), Gaps = 14/327 (4%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVE----ISPYDIHSG-----SN 51
           M  P +  YTPG I+ VG+H+ +I+ YL  GGFAQ+Y V+    ++ +D  +       +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  IACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFL 111
           +ACLKRV+V D+  LN  R EVE MK L+    VV Y DS+A++ R   GV    +EV L
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRD--GVQ--GFEVLL 129

Query: 112 LMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLI 171
           LME C  K L+D+MN RL  +L E EI+ IM  V+  ++ MH L  PL+HRDIKIENVL+
Sbjct: 130 LMELCPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLV 189

Query: 172 SNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKS 231
             +N FKL DFGS        T   ++  +  +I  +TT QYRSPEM+ L + +PINEKS
Sbjct: 190 DAENNFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKS 249

Query: 232 DIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRP 291
           DIWALG+FLYK+ ++TTPFE  G+ AILHS+Y++P   +YS  L NLI +ML  +P+ RP
Sbjct: 250 DIWALGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRP 308

Query: 292 NICQVVEEVSRLQGVPCPLKNFYLERA 318
           NI QV+  +  +     P+++ Y E A
Sbjct: 309 NIYQVLYHICDILNAEVPIEDKYSEGA 335

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  291 bits (746), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 153/348 (43%), Positives = 215/348 (61%), Gaps = 17/348 (4%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPY--DIHSGS-------N 51
           M  P +  +TPG I+ VG+H+ +++ YL  GGFAQ+Y V+   Y  +  + +       +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  IACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFL 111
           +ACLKRV+V D+  LN  R EVE MK L+    VV Y DS+A++ R   GV    +EV L
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRD--GVQ--GFEVLL 129

Query: 112 LMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLI 171
           LME C  K L+D+MN RL  +L E EI+ IM  V   ++ MH L  PL+HRDIKIENVL+
Sbjct: 130 LMELCPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLV 189

Query: 172 SNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKS 231
              N FKL DFGS        T   ++  +  +I  +TT QYRSPEM+ L + +PINEKS
Sbjct: 190 DANNNFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKS 249

Query: 232 DIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRP 291
           DIWALG+FLYK+ ++TTPFE  G+ AILHS+Y++P   +YS  L NLI +ML  +P+ RP
Sbjct: 250 DIWALGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVN-KYSSKLINLIIIMLAENPNLRP 308

Query: 292 NICQVVEEVSRLQGVPCPLKNFYLERAI---RQTAVQDNHFNHQMEQF 336
           NI QV+  +  +  +  P+++ Y E A    + T  Q+   N Q++ +
Sbjct: 309 NIYQVLYHLCEILNIEVPIEDKYTEGAYNFSKYTQFQNKLQNVQLQMY 356

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  290 bits (743), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 202/316 (63%), Gaps = 15/316 (4%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEI----SPYDIHSGS------NIACLKRV 58
           +  G  + VG+ + +I+KYLT GGFAQ+Y V+     + +D ++ +      ++ACLKRV
Sbjct: 25  FANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACLKRV 84

Query: 59  IVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSG 118
           +V D+  LN  R EVE MKLL+    +V Y DS+A++ +      NG +EV LLME C  
Sbjct: 85  LVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGT---NG-FEVLLLMELCPN 140

Query: 119 KGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFK 178
           K L+DFMN RL  +L E EIL IM  V+  VA MH L PPL+HRDIKIENVL+ ++N FK
Sbjct: 141 KSLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFK 200

Query: 179 LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGV 238
           L DFGS        +   ++  +  DI  +TT QYRSPEM+ L K +PI+EKSDIWALG+
Sbjct: 201 LADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGI 260

Query: 239 FLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVE 298
           FLYK+ +Y TPFE  G+ AILHS+Y +P    YS  L NLI +ML  +P+ RPNI QV+ 
Sbjct: 261 FLYKLLFYITPFEMTGQFAILHSKYDFPQT-NYSSRLINLIIIMLSENPNLRPNIYQVLH 319

Query: 299 EVSRLQGVPCPLKNFY 314
           E+  + G    + + Y
Sbjct: 320 EICSISGTRLEITDKY 335

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  285 bits (728), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 200/318 (62%), Gaps = 14/318 (4%)

Query: 6   IPLYTPGIILPVGSHQAKILKYLTSGGFAQVY---------QVEISPYDIHSGSNIACLK 56
           I  Y PG I+ VG H+ +I+KYL  GGFA++Y         Q++I+   +    ++ CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYC 116
           RV+V D   LN  R EV  MK L     +V   DS+A  SR   G+    YEV LLME C
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNA--SRRTDGI--AGYEVLLLMELC 211

Query: 117 SGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNE 176
           S K L+D+MN RL  +L E EIL IM  V+  VA MH L  PL+HRDIKIENVL+ ++N 
Sbjct: 212 SNKSLLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNN 271

Query: 177 FKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWAL 236
           FKLCDFGS    +   T   ++  +  ++  +TT QYRSPEM+ + + I INEKSDIWAL
Sbjct: 272 FKLCDFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWAL 331

Query: 237 GVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQV 296
           G+FLYK+ +Y TPFE+ G+ AILHS+Y++P +  YS  L NLI +ML  +P+ RPNI QV
Sbjct: 332 GIFLYKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQV 390

Query: 297 VEEVSRLQGVPCPLKNFY 314
           +  + ++  +  P+ + Y
Sbjct: 391 LAYICKIINIKTPIDDIY 408

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  288 bits (738), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 201/321 (62%), Gaps = 21/321 (6%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVE----ISPYDIHSGSN----------IAC 54
           Y  G  + VGSH+ +++KY+  GGFAQ+Y V+    ++ +    G N          IAC
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 55  LKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAA-KSRPAPGVPNGSYEVFLLM 113
           LKRV+V D   LN  R EV  M+ L+    VV Y DS+A+ +S  APG     YEV LLM
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPG-----YEVLLLM 213

Query: 114 EYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISN 173
           E+C    L+D+MN RL  RL E EI+ IM   + G+A +H L+ PL+HRDIKIENVL+  
Sbjct: 214 EFCPNNSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQ 273

Query: 174 KNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDI 233
           +N FKLCDFGS        TN  ++     +I  NTT QYRSPEM+ L +  PI+EKSDI
Sbjct: 274 ENNFKLCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDI 333

Query: 234 WALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNI 293
           WALGVFLYK+ ++TTPFE+ G+ AILHS+Y++P    YS  L NLI +ML  +PS RPNI
Sbjct: 334 WALGVFLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNI 392

Query: 294 CQVVEEVSRLQGVPCPLKNFY 314
            QV++ +  + G   PL + Y
Sbjct: 393 YQVLQYLCSINGWKVPLNDKY 413

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  289 bits (739), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 147/323 (45%), Positives = 207/323 (64%), Gaps = 14/323 (4%)

Query: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPY--DIHSGS-------N 51
           + +P +  Y PG ++ VG+ Q +I+ ++  GGFAQ+Y V+   +  + ++GS       +
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 52  IACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFL 111
           IACLKRV+VPD+  L+  R EVE MK LR  K ++ Y DS+A++ R +  V    YEV L
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASR-RTSGQV---GYEVLL 129

Query: 112 LMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLI 171
           LME C    L+D+MN RL  RL E EIL +M   +  ++ MH L  PL+HRDIKIENVL+
Sbjct: 130 LMELCPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLV 189

Query: 172 SNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKS 231
             +N FKLCDFGS        T   ++  +  +I  NTT QYRSPEM+ L + +PINEKS
Sbjct: 190 DAQNNFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKS 249

Query: 232 DIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRP 291
           DIWALG+FLYK+ ++ TPFE  G+ +ILHS+Y++PA  +YS  L NLI +ML  +P  RP
Sbjct: 250 DIWALGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRP 308

Query: 292 NICQVVEEVSRLQGVPCPLKNFY 314
           NI QV+  +  + G   P+++ Y
Sbjct: 309 NIYQVMHHICSVIGCEVPIEDKY 331

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  283 bits (724), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 149/319 (46%), Positives = 201/319 (63%), Gaps = 19/319 (5%)

Query: 8   LYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPY--DIHSG--------SNIACLKR 57
           L +P   + VG+H+ +IL++L  GGFA +Y+V+      ++ +G         +IACLKR
Sbjct: 28  LLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKR 87

Query: 58  VIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGS--YEVFLLMEY 115
           VIVPD+  LN  R EVE MK LR +  +V Y DS+A++       P+GS  +E+ LLME 
Sbjct: 88  VIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRH------PDGSPGFEILLLMEL 141

Query: 116 CSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKN 175
           C  K L+D+MN +L  +L E EIL IM  VS  +A MH L  PL+HRDIKIENVL+   +
Sbjct: 142 CPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDD 201

Query: 176 EFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWA 235
            FKLCDFGS        +   ++  + ++I  +TT QYRSPEM+ L + +PINEKSDIWA
Sbjct: 202 NFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 261

Query: 236 LGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQ 295
           LG+FLYK+ +YTTPFE  G+ AILHS+Y+ P    YS  L NLI +ML  +PS RPNI Q
Sbjct: 262 LGIFLYKLLFYTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQ 320

Query: 296 VVEEVSRLQGVPCPLKNFY 314
           V+  V  +     P  + Y
Sbjct: 321 VMHHVCSILKCDVPFTDKY 339

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  286 bits (733), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 146/320 (45%), Positives = 200/320 (62%), Gaps = 14/320 (4%)

Query: 4   PEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPY--DIHSGS-------NIAC 54
           P +  + PG ++ VG+H+ +++ YL  GGFAQ+Y V+   Y  +  + S       ++AC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLME 114
           LKRV+V D+  L+  R EVE MK L   + +V Y DS+A +        N  +EV LLME
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNG----NAGFEVLLLME 132

Query: 115 YCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNK 174
            C  K L+D+MN RL  +L E EIL IM  VS  V+ MH L+ PL+HRDIKIENVL+  +
Sbjct: 133 LCPNKSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQ 192

Query: 175 NEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIW 234
           N FKLCDFGS        T   E+  +  +I  +TT QYR PEM+ L + +PINEKSDIW
Sbjct: 193 NSFKLCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIW 252

Query: 235 ALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNIC 294
           ALG+FLYK+ ++ TPFE  G+ AILHS+Y++P    YS  L NLI +ML  +P  RPNI 
Sbjct: 253 ALGIFLYKLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIY 311

Query: 295 QVVEEVSRLQGVPCPLKNFY 314
           QV+  +  + GV  P+++ Y
Sbjct: 312 QVLNHICTMIGVEVPIEDKY 331

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  285 bits (730), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 152/322 (47%), Positives = 199/322 (61%), Gaps = 17/322 (5%)

Query: 3   QPEIPLYTP-GIILPVGSHQAKILKYLTSGGFAQVYQVEISPYD--------------IH 47
           QP+I    P G ++ VGSH+ +++ YL  GGFAQ+Y V+   Y               + 
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 48  SGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSY 107
            GS  ACLKRV+V D+  LN  R+EVE MK L+    +V Y DS+A++ R   G     +
Sbjct: 149 PGS-PACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGF 207

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           EV LLME C  K L+D+MN RL  +L E EI  IM  ++  VA MH L  PL+HRDIKIE
Sbjct: 208 EVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIE 267

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           NVL+   N FKLCDFGS        T+  ++  +  D+  +TT QYRSPEM+ L K IPI
Sbjct: 268 NVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPI 327

Query: 228 NEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDP 287
           NEKSDIWALGVFLYK+ ++TTPFE+ G+ A+LHS++++P    YS  L NLI VML  +P
Sbjct: 328 NEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENP 386

Query: 288 SKRPNICQVVEEVSRLQGVPCP 309
           S RPNI QV+  +S +     P
Sbjct: 387 SLRPNIYQVLYYLSEVTNREVP 408

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  281 bits (720), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 149/313 (47%), Positives = 197/313 (62%), Gaps = 13/313 (4%)

Query: 10  TPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPY----DIHSG----SNIACLKRVIVP 61
           T G IL VG H+ +I++YL  GGFA +Y+V    Y    D H       +IACLKRV V 
Sbjct: 29  TAGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVN 88

Query: 62  DKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGL 121
           D+  LN  R EVE MK L+    VV Y DS+A  SR   G P   +EV LLME CS   L
Sbjct: 89  DENGLNELRNEVEVMKKLKGCGNVVQYYDSNA--SRHTDGTPG--FEVLLLMELCSNGSL 144

Query: 122 IDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCD 181
           +D+MN RL  +L E E+L IM  +++G++ MH L+ PL+HRDIKIENVL+ + N FKLCD
Sbjct: 145 LDYMNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCD 204

Query: 182 FGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLY 241
           FGS    +   +   E+  + ++I  +TT QYRSPEM+ L + + INEKSDIWALG+FLY
Sbjct: 205 FGSTSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLY 264

Query: 242 KVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVS 301
           K+ +YTTPFE  G+ AILHS+Y  P    +S  L NLI VML  +P  RPNI Q++  + 
Sbjct: 265 KLLFYTTPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHIC 323

Query: 302 RLQGVPCPLKNFY 314
            +     P+++ Y
Sbjct: 324 SIMECDVPIEDHY 336

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  283 bits (723), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 150/327 (45%), Positives = 200/327 (61%), Gaps = 24/327 (7%)

Query: 6   IPLYTPGIILPVGSHQAKILKYLTSGGFAQVY------------------QVEISPYDIH 47
           I  +  G  L VG+H+ +I+ YLT GGFAQ+Y                   V IS Y + 
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 48  SGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSY 107
            G ++ACLKRV+V D+  LN  R EV  MK LR    +V Y DS+A +S       N  Y
Sbjct: 88  LG-DVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNG----NPGY 142

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           EV LLME CS   L+++MN RL  +L E E+L IM  V+ GVA MH L+ PL+HRDIKIE
Sbjct: 143 EVLLLMELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIE 202

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           NVL+ + N FKLCDFGS        T   ++  +  ++  +TT QYRSPEM+ L + +PI
Sbjct: 203 NVLVDSNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPI 262

Query: 228 NEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDP 287
           NEKSDIWALGVFLYK+ +YTTPFE  G+ A+LHS++  PA  +YS  + NL+ +ML  + 
Sbjct: 263 NEKSDIWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSENL 321

Query: 288 SKRPNICQVVEEVSRLQGVPCPLKNFY 314
           + RPNI QV+  + +L  V  P+ + Y
Sbjct: 322 NLRPNIYQVMHYICQLIQVDTPILDIY 348

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  281 bits (718), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 145/307 (47%), Positives = 197/307 (64%), Gaps = 14/307 (4%)

Query: 17  VGSHQAKILKYLTSGGFAQVYQVEISPY--DIHSGSNI-------ACLKRVIVPDKTSLN 67
           VG+H+ +I+KYL  GGFA +Y V+   Y  ++    +I       ACLKRV+V D+  LN
Sbjct: 37  VGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETACLKRVLVTDENGLN 96

Query: 68  VPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNT 127
             R EV  MK L     +V Y DSHA++SR   GVP   +EV LLME C    L+D+MN 
Sbjct: 97  EMRNEVSVMKQLSGCPNIVQYYDSHASRSRD--GVP--GFEVMLLMELCPNNSLLDYMNQ 152

Query: 128 RLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCG 187
           RL  +L E EIL IM  V++ +A MH L  PL+HRD+KIENVL+   N FKLCDFGS   
Sbjct: 153 RLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFKLCDFGSTST 212

Query: 188 VIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYT 247
            +       E+  + ++I  +TT QYRSPEM+ L + +PI+EKSDIWALG+FLYK+ +YT
Sbjct: 213 CLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFYT 272

Query: 248 TPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVP 307
           TPFE  G+ AILHS+Y++P    YS  L NLI +ML  +P+ RPNI Q+++ +  +  V 
Sbjct: 273 TPFELTGQFAILHSKYEFPI-NNYSSKLINLIIIMLAENPNLRPNIYQIMDNLCSIMKVE 331

Query: 308 CPLKNFY 314
            P+++ Y
Sbjct: 332 NPIEDKY 338

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  282 bits (722), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 152/324 (46%), Positives = 196/324 (60%), Gaps = 30/324 (9%)

Query: 2   NQP-EIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPY---------------- 44
           N+P  I  Y  G IL VG  + +ILKYLT GGFAQ+Y V    Y                
Sbjct: 32  NRPGSIEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSR 91

Query: 45  DIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPN 104
           ++  G ++ACLKRV+VPD+  L+  R EV+ MK L N   +V Y DS+A+K +    +  
Sbjct: 92  NLKIG-DVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDT 150

Query: 105 G-----------SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMH 153
                        +E+ LLMEYC  K L+DFMN RL  +L E EIL  M+ ++  V  MH
Sbjct: 151 TNNNDNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMH 210

Query: 154 ALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
            L  PL+HRDIKIENVL+ + N FKL DFGS   +  P T   ++  +  DI  NTT QY
Sbjct: 211 YLAQPLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQY 270

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSD 273
           RSPEM+ L K +PI+EKSDIWALGV LYK+ +YTTPFE  G+ AILHS+Y++PA   YS 
Sbjct: 271 RSPEMIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSS 329

Query: 274 NLKNLIRVMLMVDPSKRPNICQVV 297
              NLI +ML  +P+ RPNI QV+
Sbjct: 330 KFINLIIIMLAENPNLRPNIFQVL 353

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  280 bits (717), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 147/333 (44%), Positives = 203/333 (60%), Gaps = 35/333 (10%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEI-------------------------SP 43
           +  G  + VGSH+ +I+KY+  GGFAQ+Y V+                          +P
Sbjct: 24  FPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNP 83

Query: 44  YDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVP 103
             +  G +IACLKRV+V D+  LN  R EVE MK L+    VV Y DS+A++        
Sbjct: 84  MILKLG-DIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRH------ 136

Query: 104 NGS--YEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLH 161
           NG+  +EV LLME C  K L+D+MN RL  +L E EIL IM  ++  V+ MH L+ PLLH
Sbjct: 137 NGASGFEVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLH 196

Query: 162 RDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSL 221
           RDIKIENVL+  +N FKLCDFGS    +   T   ++  +  +I  +TT QYRSPEM+ L
Sbjct: 197 RDIKIENVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDL 256

Query: 222 SKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRV 281
            + +PI+EKSDIWALG+FLYK+ ++ TPFE  G+ AILHS+Y++P    YS  L NLI +
Sbjct: 257 YRCLPIDEKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIII 315

Query: 282 MLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFY 314
           ML  +P+ RPNI QV++ +  +  V  P+++ Y
Sbjct: 316 MLAENPNLRPNIYQVLDNICSMMNVEVPIEDIY 348

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  276 bits (705), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 193/308 (62%), Gaps = 16/308 (5%)

Query: 17  VGSHQAKILKYLTSGGFAQVYQVEISPY----------DIHSGSNIACLKRVIVPDKTSL 66
           VG+H+ +I+KYL  GGFA +Y V    Y           +  G ++ACLKRV+V D+  L
Sbjct: 79  VGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVG-DLACLKRVLVTDENGL 137

Query: 67  NVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMN 126
           N  R EV  MK L     +V Y DSHA+++R      +  +EV LLME C    L+D+MN
Sbjct: 138 NEMRNEVSVMKQLSGCPNIVQYYDSHASRARDG----SSGFEVTLLMELCPNNSLLDYMN 193

Query: 127 TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVC 186
            RL  +L E EIL IM  V++ +A MH L  PL+HRD+KIENVL+   + FKLCDFGS  
Sbjct: 194 QRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTS 253

Query: 187 GVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYY 246
                     E+  + ++I  +TT QYRSPEM+ L + +PINEKSDIWALG+FLYK+ +Y
Sbjct: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313

Query: 247 TTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGV 306
           TTPFE  G+ AILHS+Y++P    YS  L NLI +ML  +P+ RPNI QV++ +  +  V
Sbjct: 314 TTPFELTGQFAILHSKYEFPVN-NYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKV 372

Query: 307 PCPLKNFY 314
             PL++ Y
Sbjct: 373 KNPLEDKY 380

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  277 bits (709), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 159/368 (43%), Positives = 220/368 (59%), Gaps = 31/368 (8%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPY------------DIHSGSNIACLK 56
           Y PG ++ VG+HQ KI  YL  GGFAQ+Y+V+   Y             + SG +IACLK
Sbjct: 35  YKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSG-DIACLK 93

Query: 57  RVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYC 116
           RV+V D+  LN  R EVE MKLL+    +V Y DS+A   R   G+ NG YE+ LLME C
Sbjct: 94  RVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNAL--RRNDGL-NG-YEILLLMELC 149

Query: 117 SGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNE 176
               L+D+MN RL+ +L E EI+ IM   +  V+ MH L  PL+H+DIK+EN+L+ + N 
Sbjct: 150 PNNSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNN 209

Query: 177 FKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWAL 236
           FKLCDFGS        T+  ++  +  +I  +TT QYRSPEM+ L + +PINE SDIWAL
Sbjct: 210 FKLCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWAL 269

Query: 237 GVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQV 296
           GVFLYK+ ++ TPFE+ G+ +ILH+++  P    Y   L NLI +ML  + + RPNI QV
Sbjct: 270 GVFLYKLLFFITPFERTGQFSILHAKFDIPVN-NYHPKLINLIIIMLSENLNLRPNIYQV 328

Query: 297 VEEVSRLQGVPCPLKNFYLERAI---RQTAVQDNHFNHQMEQFPPLHLQ----HSISSPA 349
           + E+  +   P P+++ Y        +    Q+N  N QM+ F    LQ    H+IS   
Sbjct: 329 MYEICSITNTPLPIEDKYGMGPYNFDKYATFQNNLQNIQMKMF---ELQNNHSHNIS--- 382

Query: 350 LSTVNNNI 357
           ++T N NI
Sbjct: 383 MTTENQNI 390

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  270 bits (689), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 141/311 (45%), Positives = 189/311 (60%), Gaps = 13/311 (4%)

Query: 12  GIILPVGSHQAKILKYLTSGGFAQVYQVEISPYD--------IHSGSNIACLKRVIVPDK 63
           G  + VG HQ ++++YL  GGFA +Y+V    Y         I    +  CLKRV V D+
Sbjct: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDE 91

Query: 64  TSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLID 123
             LN  R EVE MK LRN   +V Y DS+A  SR   G P   YEV LLME C    L+D
Sbjct: 92  NGLNELRNEVEVMKKLRNCSNIVQYYDSNA--SRLGDGKP--GYEVLLLMELCPNGSLLD 147

Query: 124 FMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFG 183
           +MN RL  +L E E+L IM  ++ G++ MH  + PL+HRDIKIENVL+   N FKLCDFG
Sbjct: 148 YMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFG 207

Query: 184 SVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKV 243
           S    +    +  E+  + ++I  +TT QYRSPEM+ L + +PINEKSDIWALG+FLYK+
Sbjct: 208 STSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 267

Query: 244 CYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRL 303
            +YTTPFE  G+ AILHS+Y+ P    +S  L NL+ +ML  +P  RPN+ QV+  +  +
Sbjct: 268 LFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHICSM 326

Query: 304 QGVPCPLKNFY 314
                 + + Y
Sbjct: 327 MECEVKIDDLY 337

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 88/339 (25%), Positives = 149/339 (43%), Gaps = 61/339 (17%)

Query: 14  ILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEV 73
            + +   + +I K L  GG + VY VE    ++ +      LK+   P  +  ++  A  
Sbjct: 18  FVSINGRKYRIQKLLGEGGLSFVYLVESKEGELFA------LKKTRCPFGSIGSISPAMK 71

Query: 74  EAMKLLR-NNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQN- 131
           E     R ++ Y+   +DS   + +      +GS  V++L+ Y +   L D +N  L + 
Sbjct: 72  EVANYQRFSSPYIAQIVDSQVVQEK------DGSKTVYVLLPYFAKGSLQDLINRHLLDC 125

Query: 132 -RLKEFEILNIMSHVSQGVAAMHALQP-------------------PLL----------- 160
            ++ E +IL +   +++G+  +H   P                    LL           
Sbjct: 126 TQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGES 185

Query: 161 -----HRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTN--QTELDFVQHDILKNTTAQY 213
                HRD+K  N++IS ++   + D GS C   R   N  Q  L F Q     N T  Y
Sbjct: 186 QQSYAHRDVKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRF-QEWSSDNCTLSY 243

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGE-------NAILHSRYQYP 266
            +PE+L +  +  I EK DIW+ G  +Y +C+  +PFE+E +        AI   +Y  P
Sbjct: 244 AAPEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVP 303

Query: 267 AYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQG 305
               YS +L  LI   L V+P +RP++ +++  +  LQG
Sbjct: 304 RGTSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 96.3 bits (238), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 92/356 (25%), Positives = 157/356 (44%), Gaps = 77/356 (21%)

Query: 14  ILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRA-- 71
           +L  G H A I + L  GGF+ VY V+         +++  LK++  P     +V  A  
Sbjct: 21  VLINGQHYA-IQRLLGEGGFSFVYLVQS-----RENNDLFALKKIHCPFGNIESVSEAMR 74

Query: 72  EVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQN 131
           EV + K  R+  Y+   + S   + +      +GS  VF+L+ Y     L+D +NT L +
Sbjct: 75  EVNSYKKFRS-PYITHCVSSQVLQEQ------DGSKTVFILLPYFPTGSLLDKINTHLLD 127

Query: 132 --RLKEFEILNIMSHVSQGVAAMH-------------ALQPPLLHRD------------- 163
              + E EI+ I+  V++G+  MH             ++   L +RD             
Sbjct: 128 GTTISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLL 187

Query: 164 ---------------------------IKIENVLISNKNEFKLCDFGSVCGVIRPPTNQT 196
                                      IK  N++ S+     +CD GS        ++++
Sbjct: 188 NDSLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRS 247

Query: 197 ELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGE- 255
           +L   Q    ++ T  +RSPE+L+++ +  I+EK DIW+LG  LY +C+  +PFE+E + 
Sbjct: 248 QLVEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQL 307

Query: 256 ------NAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQG 305
                  AI   ++  P    YS  L  +I+  + VD  KRP+I +++  +  LQG
Sbjct: 308 SGASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 93.6 bits (231), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 83/335 (24%), Positives = 150/335 (44%), Gaps = 61/335 (18%)

Query: 17  VGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKT--SLNVPRAEVE 74
           V  H+  I + L  GGF+ VY VE         + +  LK++  P  +  S++    EV+
Sbjct: 21  VNGHRYHIKRLLGEGGFSFVYLVE------SRENGLMALKKIRCPFGSIGSISPAMKEVD 74

Query: 75  AMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQN--R 132
             +  ++  Y+   IDS   + R      +GS  V++L+ Y S   L D +N  L +  +
Sbjct: 75  NYQKFKS-PYIAQIIDSQVVQER------DGSKTVYILLPYFSKGSLQDEINRHLLDCTQ 127

Query: 133 LKEFEILNIMSHVSQGVAAMHALQPP-------------------LL------------- 160
           + E E++ +   V++G+  +H   P                    LL             
Sbjct: 128 VPELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQ 187

Query: 161 ---HRDIKIENVLISNKNEFKLCDFGSVC-GVIRPPTNQTELDFVQHDILKNTTAQYRSP 216
              H DIK  N++IS++    + D GS     +   + Q  L F Q    ++ T  + +P
Sbjct: 188 AYAHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQF-QEWRSEHCTLTFMAP 246

Query: 217 EMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGE-------NAILHSRYQYPAYP 269
           E+L +  +  I EK D+W+ G  +Y +C+  +PFE+E +        ++   +Y  P+  
Sbjct: 247 EILDVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGT 306

Query: 270 QYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQ 304
            YS  L ++++  L VDP  RP++ +++  +  LQ
Sbjct: 307 NYSSGLIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 93.6 bits (231), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 85/333 (25%), Positives = 146/333 (43%), Gaps = 65/333 (19%)

Query: 17  VGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIA-----CLKRVIVPDKTSLNVPRA 71
           V   + +I + L  GG + VY V++S   +   + IA      LK++I P   S++    
Sbjct: 25  VNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNGMR 84

Query: 72  EVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRL-- 129
           E+E  K  ++  YV+  IDS   + +      +GS  +++++ Y S   L D +N RL  
Sbjct: 85  EIENYKRFQS-PYVIKSIDSQVMQEK------DGSKTIYIVLPYYSLGSLQDSINRRLLE 137

Query: 130 QNRLKEFEILNIMSHVSQGVAAMH---------------------------------ALQ 156
              + E E + IM  V++G+  +H                                  L+
Sbjct: 138 GTFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 157 PPLL-----------HRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDI 205
             +L           HRDI   N+L S+     + D GS         N+ +L  +Q  +
Sbjct: 198 MDMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWV 257

Query: 206 LKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGE-------NAI 258
             N T  Y  PE+L+L  +  ++ K DIW+LG   Y + +  +PFE+E +        AI
Sbjct: 258 NDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 259 LHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRP 291
              +Y +P   ++S+ L ++I+  + VDP +RP
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 83/354 (23%), Positives = 150/354 (42%), Gaps = 69/354 (19%)

Query: 8   LYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLN 67
            +  G+ + +      +   L  G    +YQV+  P   HSG   A LK+V  P   +  
Sbjct: 17  FWFDGVRISINGKSYLVTTLLREGELTALYQVK-CPKRSHSGGVYA-LKKVTCPIGRADF 74

Query: 68  VPRAEVEAMKLLR-NNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMN 126
           V RA  E     R N+ Y+ + +D   A+        NG+  +++L+ Y     L D +N
Sbjct: 75  VTRAMTEISNYQRFNSPYITNILDFQVAQHD------NGTKIIYMLLPYFPAGSLQDLIN 128

Query: 127 TRL--QNRLKEFEILNIMSHVSQGVAAMH------------------------------- 153
             +   + L E  ++ +M  + +GV  MH                               
Sbjct: 129 NMIIRGDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLV 188

Query: 154 ------ALQPPL--------LHRDIKIENVLISNKNEFKLCDFGSVCGVIRPP---TNQT 196
                  L PPL        +H  +  EN+++S++    + +  S    +R P   T+ +
Sbjct: 189 DAMELDLLSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNS 245

Query: 197 ELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGE- 255
           +L  +Q  + +N+   Y  PE+L L  +  I  + DIW+LG   Y + Y  + F +E + 
Sbjct: 246 KLLGLQEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQL 305

Query: 256 ------NAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRL 303
                 ++I    + +P  P+YS +LK +++  L++DP KRP+I + + +   L
Sbjct: 306 CGTPIKHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 84/346 (24%), Positives = 151/346 (43%), Gaps = 65/346 (18%)

Query: 17  VGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIAC-----LKRVIVPDKTSLNVPRA 71
           V   + KI + L  GG + VY V++    +   + +A      LK++I P+  S++    
Sbjct: 25  VNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESISNGMR 84

Query: 72  EVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRL-- 129
           E+E  K  ++  YV+  IDS   + +      +GS  +++++ + +   L D +N RL  
Sbjct: 85  EIENYKRFQS-PYVIQSIDSQVMQEK------DGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 130 QNRLKEFEILNIMSHVSQGVAAMHA---------------------------------LQ 156
              + E E + IM  V +G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 157 PPLL-----------HRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDI 205
             +L           HRDI   N+L S+     + D GS         N+ +L  +Q  +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 206 LKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGE-------NAI 258
             N T  Y +PE+L L  +  ++ K DIW+LG   Y + +  +PFE+E +        AI
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 259 LHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQ 304
              +Y +P   ++S+ L ++I+  + VDP +RP   Q++  +  L+
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLLNILQDLE 363

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 104/196 (53%), Gaps = 25/196 (12%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           +V++ +EYC GK L +++   +Q+R+   E   + + +   V   H+LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           N+L+  K   K+ DF    G  R    +T L+ V        T  Y +PE++        
Sbjct: 158 NILLDKKGRAKITDF----GFTRECATKTMLETVC------GTTVYMAPELIERKSYDGF 207

Query: 228 NEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQ-YPAYPQYSDNL-----KNLIRV 281
             K DIW+LGV LY + + T PF++E E     ++++     P Y+D++     K+LI  
Sbjct: 208 --KIDIWSLGVILYTMIHGTMPFDEEDETK---TKWKIINEEPFYNDDVVSKDAKDLISQ 262

Query: 282 MLMVDPSKRPNICQVV 297
           +L  DPS+RP + QV+
Sbjct: 263 LLCKDPSQRPQLSQVL 278

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 81/350 (23%), Positives = 156/350 (44%), Gaps = 69/350 (19%)

Query: 17  VGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGS-------NIACLKRVIVP--DKTSLN 67
           +   +  I + L  G  + VY V+       +GS        +  LKR+  P  +  S++
Sbjct: 28  INGRRYTIRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPFGNIESIS 87

Query: 68  VPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNT 127
               EV+  K  ++  Y+++ +DS   + +      +GS  + +L+ Y     L D +N 
Sbjct: 88  AAMKEVDNYKRFQS-PYIITLVDSQVVQEK------DGSKTLCILLPYFPLGSLQDMVNR 140

Query: 128 RL--QNRLKEFEILNIMSHVSQGVAAMH-------------------------------- 153
            L     + E E + IM  +++G+  +H                                
Sbjct: 141 NLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLLDDT 200

Query: 154 ALQPPLL------------HRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFV 201
            L+  +L            HRDI++ N+L S++    + D GS C      + + +L+ +
Sbjct: 201 PLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLNEL 260

Query: 202 QHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGE------ 255
           Q  +  N +  Y +PE+L++  +  I+ K+DIW++G   Y + +  +PFE+E +      
Sbjct: 261 QDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGASL 320

Query: 256 -NAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQ 304
             AI   +Y +P   +YS++L  +I+  L VDP+ RP+I ++++ +  LQ
Sbjct: 321 TYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 94.0 bits (232), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 116/242 (47%), Gaps = 42/242 (17%)

Query: 72  EVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQN 131
           E+E  KL+  +K ++S ID     +            +++++E C    L D +  R + 
Sbjct: 99  EIEIHKLVNGHKNIISMIDHFEIDA-----------TMYMVLELCGAGSLYDII-CRSKR 146

Query: 132 RLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRP 191
            L+E+E   +M  +   V  +H  +  ++H D+K+ N+LI + N  +LCDFG        
Sbjct: 147 SLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH------- 197

Query: 192 PTNQTELDFVQHDILKNT-----TAQYRSPE-----MLSLSKSIPINEKSDIWALGVFLY 241
                   FV  DI  N+     T  Y SPE     +LS  K +   ++SDIW++G+ LY
Sbjct: 198 -------SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKESDIWSIGIVLY 250

Query: 242 KVCYYTTPFE----KEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVV 297
            + +  TPFE    +     I+  +Y +    + S+ +K LI+ +L + P +R  I ++V
Sbjct: 251 AMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIV 310

Query: 298 EE 299
            +
Sbjct: 311 SD 312

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 82/333 (24%), Positives = 147/333 (44%), Gaps = 65/333 (19%)

Query: 17  VGSHQAKILKYLTSGGFAQVYQVEI-----SPYDIHSGSNIACLKRVIVPDKTSLNVPRA 71
           V   + KI + L  GG + VY V++     S  +  + + +  LK++I P   +++    
Sbjct: 25  VNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENISNGMR 84

Query: 72  EVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRL-- 129
           E+E  K  ++  YV+  IDS   + +      +GS  +++++ Y S   L D +N RL  
Sbjct: 85  EIENYKRFQS-PYVIQSIDSQVMQEK------DGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 130 QNRLKEFEILNIMSHVSQGVAAMHA---------------------------------LQ 156
              + E E + IM  V++G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 157 PPLL-----------HRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDI 205
             +L           HRDI   N+L S+     + D GS         N+ +L  +Q  +
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 206 LKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGE-------NAI 258
             N T  Y +PE+L+L  +  ++ K DIW++G   Y + +  +PFE+E +        AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 259 LHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRP 291
              +Y +P   ++S+ L ++I+  + VDP +RP
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/333 (25%), Positives = 146/333 (43%), Gaps = 65/333 (19%)

Query: 17  VGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIA-----CLKRVIVPDKTSLNVPRA 71
           V   + KI + L  GG + VY V++    +   + I       LK++I P   S++    
Sbjct: 25  VNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESISNGMR 84

Query: 72  EVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRL-- 129
           E+E  K  ++  YV+  IDS   + +      NGS  +++++ Y S   L D +N RL  
Sbjct: 85  EIENYKRFQS-PYVIQSIDSQVTQEK------NGSKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 130 QNRLKEFEILNIMSHVSQGVAAMH---------------------------------ALQ 156
              + E E + IM  V++G+  +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 157 PPLL-----------HRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDI 205
             +L           HRDI   N+L S++    + D GS         ++ +L  +Q  +
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWV 257

Query: 206 LKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGE-------NAI 258
             N T  Y +PE+L+L  +  ++ K DIW++G   Y + +  +PFE+E +        AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 259 LHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRP 291
              +Y +P   ++S+ L N+I+  + VDP +RP
Sbjct: 318 NTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 130/278 (46%), Gaps = 33/278 (11%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++     I +   +A   ++ +  + +     +E++  K +++   +V
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMKHPN-IV 152

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            ++D     +            V++L+E CS   L+D M  R    L E E+    + + 
Sbjct: 153 HFVDCFEDDT-----------NVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQIC 199

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             V  MH+ +  ++HRD+K+ N+        K+ DFG +  V+    N  E  +      
Sbjct: 200 GAVKYMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFG-LAAVL---ANNRERKYTV---- 249

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILH----SR 262
              T  Y +PE+L + K    + + DIW++GV +Y +     PF+ +  N I       +
Sbjct: 250 -CGTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQ 307

Query: 263 YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           Y YP     S   K LI  +L VDP +RP+I +++++V
Sbjct: 308 YGYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 106/227 (46%), Gaps = 44/227 (19%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY +G  L+D++       L+E         V+  +  +HA    ++HRD+K
Sbjct: 204 SNHFYMLFEYVAGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLK 259

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++ISN  E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 260 IENIMISNSGEIKIIDFGLSNVYDTRKQLHTFCG---------SLYFAAPELLK--AHPY 308

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYP--AYPQY 271
             PE+             D+W+ GV LY +     PF+ E  +++LH + +     YPQ+
Sbjct: 309 TGPEV-------------DVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKRGKVEYPQH 354

Query: 272 -SDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLER 317
            S  + +L+  ML+VDPS+R ++ QVVE     +G   P  ++   R
Sbjct: 355 LSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTKGYDTPAPSYVPNR 401

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 81/281 (28%), Positives = 129/281 (45%), Gaps = 46/281 (16%)

Query: 23  KILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV--PDKTSLNVPRAEVEAMKLLR 80
           KILK +  G F +VY     P            K+V++   DKT  NV R      ++  
Sbjct: 40  KILKQIGEGSFGKVYLALHKP----------THKKVVLKSSDKTDPNVVR------EIFY 83

Query: 81  NNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILN 140
           + ++   YI            V     +V++++EYC  K L D++ ++   R+   E   
Sbjct: 84  HRQFDFPYITKLYE-------VIITETKVWMVIEYCPNKELYDYLLSK--KRISLDESAR 134

Query: 141 IMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDF 200
           I + +   V   H+L    +HRD+K+EN+L+   N  KL DF    G  R  +  T+L+ 
Sbjct: 135 IFAQIVGAVYYAHSLS--CVHRDLKLENILLDKDNNAKLTDF----GFTRDFSKNTQLET 188

Query: 201 VQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFE----KEGEN 256
           +        T  Y +PE+L   K      K DIWALG+ LY +   T PF+    K+ E 
Sbjct: 189 I------CGTTVYMAPELLRREKYDGY--KIDIWALGILLYTIINGTMPFDEDDPKKTEL 240

Query: 257 AILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVV 297
            I+ +   Y     ++D+  +L+  +L  DPS RP I Q++
Sbjct: 241 KIISASPDYDN-KYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 109/215 (50%), Gaps = 20/215 (9%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       L+E         ++  +  +HA    ++HRD+K
Sbjct: 236 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHANN--IVHRDLK 291

Query: 166 IENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSI 225
           IEN++IS   E K+ DFG +  +  P   +T+L      +       + +PE+L  S   
Sbjct: 292 IENIMISTSGEIKIIDFG-LSNMFDP---RTQLHTFCGSLY------FAAPELLKASPY- 340

Query: 226 PINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPA--YPQY-SDNLKNLIRVM 282
            +  + D+W+ GV LY +     PF+ E  +++LH + +     YPQ+ S  + +L+  M
Sbjct: 341 -VGPEVDVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVDYPQHLSIEVISLLSKM 398

Query: 283 LMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLER 317
           L+VDP KR ++ QVVE    ++G   P  ++   R
Sbjct: 399 LVVDPRKRASLKQVVEHHWMIRGYDFPAPSYVPNR 433

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 111/245 (45%), Gaps = 48/245 (19%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       L+E         V+  +  +HA    ++HRD+K
Sbjct: 197 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLK 252

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS   E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 253 IENIMISTSGEIKIIDFGLSNVFDTRKQLHTFCG---------SLYFAAPELLKANP--Y 301

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILH-----SRYQYPAY 268
             PE+             DIW+ GV LY +     PF+ E  +++LH      + +YP +
Sbjct: 302 IGPEV-------------DIWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPNH 347

Query: 269 PQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLERAIRQTAVQDNH 328
              S  + +L+  ML+VDP KR N+ +V+E    ++G   P  ++  +R+     + D H
Sbjct: 348 --LSIEVISLLSKMLVVDPLKRANLTKVIEHPWMIRGYDFPPPSYLPKRSPMTPEIIDAH 405

Query: 329 FNHQM 333
              +M
Sbjct: 406 VIKEM 410

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 132/278 (47%), Gaps = 33/278 (11%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++    DI +   +A  K  I  +KT   +  +E++  K + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA--KASIKSEKTRKKL-LSEIQIHKSMAHPN-IV 142

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            +ID     S            V++L+E C    L++ +  R    L E E+    + + 
Sbjct: 143 QFIDCFEDDS-----------NVYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQIC 189

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             +  MH+ +  ++HRD+K+ N+   +    K+ DFG +  V+    N++E  +      
Sbjct: 190 GAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI---- 239

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHS----R 262
              T  Y +PE+L + K    + + DIW+LGV LY +     PF+    N I        
Sbjct: 240 -CGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRD 297

Query: 263 YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           + +P     SD  K LIR +L +DP +RP++ ++++ V
Sbjct: 298 FSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 106/218 (48%), Gaps = 34/218 (15%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E++L++EY  G  L D++  R   +L E E ++    + QGV+  H     + HRD+K E
Sbjct: 138 ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPE 193

Query: 168 NVLISNKNE-FKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTA--QYRSPEMLSLSKS 224
           N+L+  KN+  K+ DFG         TN+         +L+ +     Y SPE++   K 
Sbjct: 194 NLLLDKKNKTVKIADFGMAA---LETTNR---------LLETSCGSPHYASPEIVMGQKY 241

Query: 225 IPINEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLIR 280
                 SD+W+ G+ L+ +     PF  +    +L    H RYQ P+    S   K+LI 
Sbjct: 242 --HGSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPS--NVSKEAKDLIS 297

Query: 281 VMLMVDPSKRPNICQVVEEVSRLQ-------GVPCPLK 311
            +L+VDP KR  + +++E    ++       G+ CPL+
Sbjct: 298 KILVVDPEKRITVDKILEHPLLVKYDNPGKGGLACPLE 335

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 86.7 bits (213), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 103/196 (52%), Gaps = 25/196 (12%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           V++ +EYC GK L +++   ++ R+   E  ++ S +   V   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           +L+  K + KL DF    G  R    +  L+ V        T  Y +PE+  + +     
Sbjct: 159 ILLDKKGQAKLTDF----GFTRECATKGILETV------CGTTVYMAPEL--IERKPYEG 206

Query: 229 EKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYP-AYPQYSDNL-----KNLIRVM 282
            K D W+LG+ LY + +   PF++E +   + ++Y+     P Y DN      K+LI  +
Sbjct: 207 YKIDTWSLGIILYTMIHGAMPFDEEDD---IKTKYRIVNNEPFYDDNFIDANGKDLIMQL 263

Query: 283 LMVDPSKRPNICQVVE 298
           L  DPS+RP++ QV++
Sbjct: 264 LQKDPSQRPSLTQVLQ 279

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 103/219 (47%), Gaps = 44/219 (20%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       L+E         ++  +  +HA    ++HRD+K
Sbjct: 174 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHANN--IVHRDLK 229

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS   E K+ DFG            + CG          L F   ++LK   + Y
Sbjct: 230 IENIMISTSGEIKIIDFGLSNLFDKSKQLHTFCG---------SLYFAAPELLK--ASPY 278

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYP--AYPQY 271
             PE+             D+W+ GV LY +     PF+ E  +++LH + +     YPQ+
Sbjct: 279 TGPEV-------------DVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPQH 324

Query: 272 -SDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCP 309
            S  + +L+  ML+VDP +R ++ QVVE    ++G   P
Sbjct: 325 LSIEVISLLSKMLVVDPHRRASLKQVVEHHWMVRGYDGP 363

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 107/224 (47%), Gaps = 44/224 (19%)

Query: 110 FLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENV 169
           ++L EY SG  L+D++       ++E +       ++  +  +HA    ++HRD+KIEN+
Sbjct: 218 YMLFEYVSGGQLLDYIIQ--HGSIREHQARKFARGIASALMYLHANN--IVHRDLKIENI 273

Query: 170 LISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPE 217
           +IS+ +E K+ DFG            + CG          L F   ++LK     Y  PE
Sbjct: 274 MISDSSEIKIIDFGLSNLYDSRKQLHTFCG---------SLYFAAPELLK--AHPYTGPE 322

Query: 218 MLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYP--AYPQY-SDN 274
           +             D+W+ GV L+ +     PF+ E  +++LH + +     YPQ+ S  
Sbjct: 323 V-------------DVWSFGVVLFVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPQHLSIE 368

Query: 275 LKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLERA 318
           + +L+  ML+VDP +R  + QVVE    ++G   P  ++  +R 
Sbjct: 369 VISLLSKMLVVDPKRRATLKQVVEHHWMVRGFNAPPPSYLPKRV 412

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 85/342 (24%), Positives = 160/342 (46%), Gaps = 41/342 (11%)

Query: 26  KYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYV 85
           ++L  GGFA+ +Q++     I +   +A  K  I  +KT   +  +E++  K + +   +
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA--KISIKSEKTRKKL-LSEIQIHKSMSHTN-I 140

Query: 86  VSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHV 145
           V +ID               +  V++L+E C    L++ +  R    + E E+   M+ +
Sbjct: 141 VQFIDCF-----------EDNVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQI 187

Query: 146 SQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDI 205
             G+  MH+ +  ++HRD+K+ N+        K+ DFG +  V+    N  E  F     
Sbjct: 188 CGGIQYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFG-LAAVL---ANDRERKFTI--- 238

Query: 206 LKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HS 261
               T  Y +PE+L + K    + + DIW++GV LY +     PF+ +  N I       
Sbjct: 239 --CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQR 295

Query: 262 RYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLERAIRQ 321
            + YP   + S + K LI  +L ++P +RP+I ++++ V   +G   P    Y   ++  
Sbjct: 296 NFAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYVW-FRGTFPP----YTLNSVMT 350

Query: 322 TAVQDNHFNHQMEQFPPLHLQHSISSPALSTVNNNIGLSNIN 363
           T    +H   Q E F  ++ Q+ + +  L +V+ N  ++NI+
Sbjct: 351 TVPDYSHITPQ-ESF--MNFQNCLEASGLLSVHQNHMVANIS 389

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 108/227 (47%), Gaps = 44/227 (19%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       ++E +       ++  +  +HA    ++HRD+K
Sbjct: 227 SNHFYMLFEYVSGGQLLDYIIQ--HGSIREHQARKFARGIASALMYLHANN--IVHRDLK 282

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS+ +E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 283 IENIMISDSSEIKIIDFGLSNLYDSRKQLHTFCG---------SLYFAAPELLKANP--Y 331

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYP--AYPQY 271
             PE+             D+W+ GV L+ +     PF+ E  +++LH + +     YPQ+
Sbjct: 332 TGPEV-------------DVWSFGVVLFVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPQH 377

Query: 272 -SDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLER 317
            S  + +L+  ML+VDP +R  + QVVE    ++G   P  ++  +R
Sbjct: 378 LSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFDGPPPSYLPKR 424

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 104/227 (45%), Gaps = 44/227 (19%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       L+E         ++  +  +H+    ++HRD+K
Sbjct: 279 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHSNN--IVHRDLK 334

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS   E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 335 IENIMISTSGEIKIIDFGLSNLYDTTRQLHTFCG---------SLYFAAPELLK--AHPY 383

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPA--YPQY 271
             PE+             D+W+ GV LY +     PF+ E  +++LH + +     YPQ+
Sbjct: 384 TGPEV-------------DVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVDYPQH 429

Query: 272 -SDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLER 317
            S  + +L+  ML+VDP KR  + QVVE    ++G   P  ++   R
Sbjct: 430 LSIEVISLLSKMLVVDPKKRATLRQVVEHHWMVRGYDNPSSSYLPNR 476

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 134/278 (48%), Gaps = 39/278 (14%)

Query: 28  LTSGGFAQVYQVEISPYDIHSGSNIACL---KRVIVPDKTSLNVPRAEVEAMKLLRNNKY 84
           L  GGFA+ + ++        G + AC    K+ I  ++T   +  +E++  + LR + +
Sbjct: 99  LGEGGFARCFHIKDD-----VGISFACKIVSKKSIKTERTKFKL-LSEIQIHQNLRYS-H 151

Query: 85  VVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSH 144
           +V ++D                  V++L+E C    L+D +  R    L E E+  + + 
Sbjct: 152 IVKFMDCFE-----------DELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQ 198

Query: 145 VSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHD 204
           V   +  MH+    ++HRD+K+ NV        K+ DFG    +    +N +E  +    
Sbjct: 199 VCGAINYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG 252

Query: 205 ILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILH---- 260
                T  Y +PE++ LSK I  + ++DIW+LG+ +Y +     PF+ +    I      
Sbjct: 253 -----TPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKL 306

Query: 261 SRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVE 298
            +Y++P     ++++K LI+ +L++DPS+RP I  +++
Sbjct: 307 CQYEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 108/227 (47%), Gaps = 44/227 (19%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       ++E +       ++  +  +HA    ++HRD+K
Sbjct: 214 SNHFYMLFEYVSGGQLLDYIIQ--HGSIREHQAKKFARGIASALMYLHANN--IVHRDLK 269

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS+ +E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 270 IENIMISDSSEIKIIDFGLSNLYDSRKQLYTFCG---------SLYFAAPELLKANP--Y 318

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYP--AYPQY 271
             PE+             D+W+ GV L+ +     PF+ E  +++LH + +     YPQ+
Sbjct: 319 TGPEV-------------DVWSFGVVLFVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPQH 364

Query: 272 -SDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLER 317
            S  + +L+  ML+VDP +R  + QVVE    ++G   P  ++  +R
Sbjct: 365 LSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFSGPPPSYLPKR 411

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 133/278 (47%), Gaps = 33/278 (11%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++    +I +   +A  K  I  +KT   +  +E++  K + ++  +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA--KASIKSEKTRKKL-LSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            +ID     S            V++L+E C    L++ +  R    L E E+    + + 
Sbjct: 143 QFIDCFEDDS-----------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQIC 189

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             +  MH+ +  ++HRD+K+ N+   +    K+ DFG +  V+    N++E  +      
Sbjct: 190 GAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI---- 239

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHS----R 262
              T  Y +PE+L + K    + + DIW+LGV LY +     PF+    N I        
Sbjct: 240 -CGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRD 297

Query: 263 YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           + +P     SD  K LIR +L +DP +RP++ ++++ V
Sbjct: 298 FSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 108/227 (47%), Gaps = 44/227 (19%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       ++E +       ++  +  +HA    ++HRD+K
Sbjct: 216 SNHFYMLFEYVSGGQLLDYIIQ--HGSIREHQARKFARGIASALIYLHANN--IVHRDLK 271

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS+ +E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 272 IENIMISDSSEIKIIDFGLSNIYDSRKQLHTFCG---------SLYFAAPELLKANP--Y 320

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYP--AYPQY 271
             PE+             D+W+ GV L+ +     PF+ E  +++LH + +     YPQ+
Sbjct: 321 TGPEV-------------DVWSFGVVLFVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPQH 366

Query: 272 -SDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLER 317
            S  + +L+  ML+VDP +R  + QVVE    ++G   P  ++  +R
Sbjct: 367 LSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFNGPPPSYLPKR 413

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 133/278 (47%), Gaps = 33/278 (11%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++    +I +   +A  K  I  +KT   +  +E++  K + ++  +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA--KASIKSEKTRKKL-LSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            +ID     S            V++L+E C    L++ +  R    L E E+    + + 
Sbjct: 143 QFIDCFEDDS-----------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQIC 189

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             +  MH+ +  ++HRD+K+ N+   +    K+ DFG +  V+    N++E  +      
Sbjct: 190 GAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI---- 239

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHS----R 262
              T  Y +PE+L + K    + + DIW+LGV LY +     PF+    N I        
Sbjct: 240 -CGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRD 297

Query: 263 YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           + +P     SD  K LIR +L +DP +RP++ ++++ V
Sbjct: 298 FSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 116/237 (48%), Gaps = 28/237 (11%)

Query: 72  EVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQN 131
           E+  M LL++  Y+  YI +            N  Y ++++MEYC G    D + T  + 
Sbjct: 62  EMRLMSLLKS-PYIARYITTI-----------NEDYLMWIVMEYCGGGSARDLIKTCYRE 109

Query: 132 RLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRP 191
            L E ++  ++  V  G+  +HA     +HRDIK  N+L+++    K+ DFG V   +R 
Sbjct: 110 GLAENKVAFVVKSVLLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFG-VSAEMR- 165

Query: 192 PTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFE 251
            +      FV        T  + +PE++ +++ +  NEKSDIW+LG+  Y++     P  
Sbjct: 166 -STMKAKTFV-------GTPYWMAPEVV-MNEGMGYNEKSDIWSLGITTYELLKGVPPLA 216

Query: 252 KEGENAILHS---RYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQG 305
           K     ++ +   R     +  Y++ +K+ I   L+ DP KRP+  +++E    ++G
Sbjct: 217 KYDAIRVMRNIPKRKPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLEHDFMVKG 273

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 132/278 (47%), Gaps = 33/278 (11%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++    +I +   +A  K  I  +KT   +  +E++  K + +   +V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA--KASIKSEKTRKKL-LSEIQIHKSMAHPN-IV 142

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            ++D     S            V++L+E C    L++ +  R    L E E+    + + 
Sbjct: 143 QFVDCFEDDS-----------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQIC 189

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             +  MH+ +  ++HRD+K+ N+   +    K+ DFG +  V+    N++E  +      
Sbjct: 190 GAIKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYTI---- 239

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHS----R 262
              T  Y +PE+L + K    + + DIW+LGV LY +     PF+    N I        
Sbjct: 240 -CGTPNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRD 297

Query: 263 YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           + +P     SD  K LIR +L +DP +RP++ ++++ V
Sbjct: 298 FSFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 134/295 (45%), Gaps = 48/295 (16%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNV 68
           +T   +  VG++  KILK +  G F +VY     P   H      CLK     DK   N+
Sbjct: 30  FTSDELTEVGNY--KILKQVGEGSFGKVYLALHRP--THRK---VCLK---TSDKNDPNI 79

Query: 69  PRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTR 128
            R      ++  + ++   YI            V     +V++ +EYC GK L D + + 
Sbjct: 80  VR------EVFYHRQFDFPYITKLYE-------VIVTETKVWMALEYCPGKELYDHLLS- 125

Query: 129 LQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGV 188
             +R+   E   + + +S  V   H++    +HRD+K+EN+L+      KL DF    G 
Sbjct: 126 -LHRISLLECAELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDF----GF 178

Query: 189 IRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTT 248
            R    +T L+ V        T  Y +PE+  + +      K DIW+LGV LY +   + 
Sbjct: 179 TRECMTKTTLETV------CGTTVYMAPEL--IERRTYDGFKIDIWSLGVILYTLITGSL 230

Query: 249 PFEKEGENAILHSRYQYP-AYPQYS-----DNLKNLIRVMLMVDPSKRPNICQVV 297
           PF+ + E   + ++++     P Y      D+ K+LI  +L  +P +RP++ QV+
Sbjct: 231 PFDDDDE---VKTKWKIVNEEPNYDSTLIPDDAKDLISRLLAKNPKERPSLPQVL 282

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/220 (29%), Positives = 103/220 (46%), Gaps = 30/220 (13%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       LKE         +   +  +H+    ++HRD+K
Sbjct: 172 SNHFYMLFEYVSGGQLLDYIIQ--HGSLKESRARTFTRQICSALKYLHSHN--IVHRDLK 227

Query: 166 IENVLISNKNEFKLCDFG-----SVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLS 220
           IEN++IS     KL DFG       C  ++  T    L F   ++LK T   Y  PE+  
Sbjct: 228 IENIMISKDGNIKLIDFGLSNLYDKCNKLK--TYCGSLYFAAPELLKATP--YIGPEI-- 281

Query: 221 LSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPA--YPQY-SDNLKN 277
                      D+W+ GV LY +     PF+ E  N +LH + +     YPQ+ S  + +
Sbjct: 282 -----------DVWSFGVVLYVLVCGKVPFDDENSN-VLHEKIKQGKVFYPQFLSIEVIS 329

Query: 278 LIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLER 317
           L+  ML+VDP KR  + QV+     ++    P K++  +R
Sbjct: 330 LLSKMLVVDPFKRATLDQVMNHHWMVRDCDGPPKSYIPDR 369

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/264 (27%), Positives = 127/264 (48%), Gaps = 32/264 (12%)

Query: 31  GGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYID 90
           G F  VY+     +D  +G+ +A     +   +  +++   E+  +  LR+  Y+ +YI 
Sbjct: 24  GNFGDVYKA----FDKTNGAIVAVKVVNLEHTEEDIDLLAQEIFFLAELRS-PYITNYIT 78

Query: 91  SHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVA 150
           +                 ++++MEYC G    D + T   N L E ++  I   V +G+ 
Sbjct: 79  TMIE-----------DVSMWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLK 127

Query: 151 AMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTT 210
            +H  +   +HRDIK  N+L++++ + KL DFG V G IR    +    FV        T
Sbjct: 128 YLHDQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATMKRGT--FV-------GT 175

Query: 211 AQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHS--RYQYPA- 267
             + +PE+++  +S   NEK+DIW+LG+ +Y++     P  K     ++ S  R + P  
Sbjct: 176 PYWMAPEVVN-KESNGYNEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKL 234

Query: 268 YPQYSDNLKNLIRVMLMVDPSKRP 291
           + QYSD  K  +   L+ DP+ RP
Sbjct: 235 HGQYSDVAKGFVAACLVKDPNLRP 258

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 128/275 (46%), Gaps = 32/275 (11%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++     + +   +A   ++ +  + + N   +E++  K +R+   +V
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMRHQN-IV 158

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            +ID                  V++L+E C    L+D +  R    L E E+    + + 
Sbjct: 159 HFIDCFE-----------DDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQIC 205

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             +  MH+    ++HRD+K+ N+        K+ DFG +  +I    N+ E  +      
Sbjct: 206 GALDHMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAII---NNENERKYTIC--- 256

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HSR 262
              T  Y +PE++   K I  + + DIW+LGV ++ +     PF+ +  + I     H  
Sbjct: 257 --GTPNYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCN 314

Query: 263 YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVV 297
           Y +P     S ++K LI+ +L ++P +RP I +++
Sbjct: 315 YSFPTDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 141/300 (47%), Gaps = 56/300 (18%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPD--KTSL 66
           +T   +  VG++  KILK +  G F +VY        IH  ++    ++V++    KT  
Sbjct: 26  FTSNELYEVGNY--KILKQVGEGSFGKVYLA------IHRPTH----RKVVLKSSSKTDP 73

Query: 67  NVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMN 126
           NV R      +   ++ Y+    +    +++           V++ +EYC GK L D++ 
Sbjct: 74  NVVREVFYHRQF--DHPYITKLYEIIITETK-----------VWMSLEYCPGKELYDYL- 119

Query: 127 TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVC 186
             +  R+   E   + + +   V   H+L    +HRD+K+EN+L+  +   KL DF    
Sbjct: 120 -LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLENILLDMQGNAKLADF---- 172

Query: 187 GVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYY 246
           G  R    + +L+ +        T  Y +PE+  L +      K DIW+LGV LY +   
Sbjct: 173 GFTRECATKNQLETIC------GTTVYMAPEL--LRRDTYDGFKIDIWSLGVILYTLING 224

Query: 247 TTPFEKEGENAILHSRYQYPAY---PQYSDNLKN-----LIRVMLMVDPSKRPNICQVVE 298
           + PF++E E     +R ++      P Y++ + N     LI+ +L+ DP KRP++ ++++
Sbjct: 225 SMPFDEEDE-----TRTEWKIINEEPDYNEKIFNANSIELIKSLLIKDPKKRPSMTEILK 279

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 109/243 (44%), Gaps = 44/243 (18%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       L+E         ++  +  +HA    ++HRD+K
Sbjct: 258 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALEYIHANN--IVHRDLK 313

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS   E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 314 IENIMISTSGEIKIIDFGLSNVFDRKKQLHTFCG---------SLYFAAPELLK--AHPY 362

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPA--YPQY 271
             PE+             D+W+ GV LY +     PF+ E  +++LH + +     YP +
Sbjct: 363 TGPEV-------------DVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQGKVDYPNH 408

Query: 272 -SDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLERAIRQTAVQDNHFN 330
            S  + +L+  ML+VDP +R ++ QVVE     +G   P  ++   R      + DN+  
Sbjct: 409 LSIEVISLLSKMLVVDPLRRASLKQVVEHPWMTRGYDYPPPSYVPRRIPMTPEIIDNNVI 468

Query: 331 HQM 333
            +M
Sbjct: 469 REM 471

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 130/278 (46%), Gaps = 33/278 (11%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++     I +   +A L   I  +KT   +  +E++  K +++   VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS--IKSEKTRKKL-LSEIQIHKSMKHQN-VV 142

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            +ID     +            V++L+E C    L+D +  R    L E E+    + + 
Sbjct: 143 QFIDCFEDDT-----------NVYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQIC 189

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             +  MH+ +  ++HRD+K+ N+        K+ DFG +  V+    N  E  +      
Sbjct: 190 GAIKYMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVL---ANDRERKYTV---- 239

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILH----SR 262
              T  Y +PE+L + K    + + DIW++GV LY +     PF+ +  N I        
Sbjct: 240 -CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCD 297

Query: 263 YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           + +P     S+  K LI+ +L +DP +RP+I ++++ V
Sbjct: 298 FSFPKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 81/320 (25%), Positives = 143/320 (44%), Gaps = 35/320 (10%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++++MEYC G    D +       + E ++  I+    +G+  +H  +   +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQKK--IHRDIKAAN 143

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           +L+++  + KL DFG V G IR    +    FV        T  + +PE+++  +    N
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRATMKRGT--FV-------GTPYWMAPEVIN-KQCKGYN 192

Query: 229 EKSDIWALGVFLYKVCYYTTPFEKEGENAILHS---RYQYPAYPQYSDNLKNLIRVMLMV 285
           EK+DIW+LG+  Y++     P  K     ++ +   R     + QYS+  K  + + L+ 
Sbjct: 193 EKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEKAKYFVSLCLIK 252

Query: 286 DPSKRPNICQVVEEVSRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSI 345
           DP +RP+I  ++E    L      LK       I+   +++N+      + P   L   I
Sbjct: 253 DPKQRPSIEALLETDFLLPNTVLNLKEDV--DLIKSIKLKNNY-----SKTPKYQLNQKI 305

Query: 346 SSPALSTVNNNIGLS-NINFLQNVNNSAIQTANTTSRINNNPYSLHNSSTLQNTPQTIAA 404
              + + ++ N  +S N N +Q +  + IQT            +L   S L+ +P T   
Sbjct: 306 YDGSENIMSWNFDVSENNNSIQEIYENNIQTTEAA--------TLQKMSELEKSPTTPTL 357

Query: 405 DRRYPVSTAPKQQHNIPAYN 424
           D R   ++ P  Q   P  N
Sbjct: 358 DMR---TSKPSSQLETPMTN 374

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 106/231 (45%), Gaps = 49/231 (21%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       L+E         ++  +  +H     ++HRD+K
Sbjct: 260 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHLNN--IVHRDLK 315

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++ISN  E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 316 IENIMISNSGEIKIIDFGLSNVFDNRKQLHTFCG---------SLYFAAPELLK--AHPY 364

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILH-----SRYQYPAY 268
             PE+             D+W+ G+ LY +     PF+ E  +++LH      + +YP +
Sbjct: 365 TGPEV-------------DVWSFGIVLYVLVCGKVPFDDEN-SSVLHEKIRQGKVEYPNH 410

Query: 269 PQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLERAI 319
              S  + +L+  M++VDP+KR ++ QVVE     +G   P  + YL R I
Sbjct: 411 --LSIEVISLLSKMIVVDPAKRASLRQVVEHPWMTRGYDFPPLS-YLPRRI 458

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 102/227 (44%), Gaps = 44/227 (19%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       L+E         ++  +  +H     ++HRD+K
Sbjct: 280 SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHLNN--IVHRDLK 335

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS   E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 336 IENIMISTSGEIKIIDFGLSNMFNPKKQLHTFCG---------SLYFAAPELLK--ACPY 384

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPA--YPQY 271
             PE+             D+W+ GV LY +     PF+ E  +++LH + +     YPQ+
Sbjct: 385 TGPEV-------------DVWSFGVVLYVLVCGKVPFDDE-NSSVLHEKIKQGKVEYPQH 430

Query: 272 -SDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLER 317
            S  + +L+  ML+VDPSKR  + QVV      +G   P  ++   R
Sbjct: 431 LSIEVISLLSKMLVVDPSKRATLKQVVNHQWMQRGYDFPAPSYIPHR 477

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 95/198 (47%), Gaps = 28/198 (14%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++ ++E+ SG  L+  +  R   RL E     I S +   V  MHA    ++HRD+K EN
Sbjct: 87  LYYVLEFVSGGELLGLV--RRMGRLPEEWCRRIASQLVDTVDYMHAKG--VIHRDLKPEN 142

Query: 169 VLISNKNEFKLCDFGSVC----GVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKS 224
           VL+S +    + DFG+ C    G   P        FV        TA+Y SPE+L  S+ 
Sbjct: 143 VLLSQEGRIVITDFGAACCASEGGSAPGAADRAASFV-------GTAEYVSPELLLHSQ- 194

Query: 225 IPINEKSDIWALGVFLYKVCYYTTPFEKEGE------NAILHSRYQYPAYPQYSDNLKNL 278
              +  SD+WALG  +Y++     PF  + E         L  R+ Y A P     +  L
Sbjct: 195 --CSFGSDVWALGCIIYQLTQGAPPFRGDTELQSFEKIVALDYRWVYAAPPL----IVAL 248

Query: 279 IRVMLMVDPSKRPNICQV 296
           ++ +L++DP +RP+  Q+
Sbjct: 249 VQSILVLDPLQRPSAKQL 266

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/278 (24%), Positives = 131/278 (47%), Gaps = 33/278 (11%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++     I +   +A L   I  +KT   +  +E++  K +R+   +V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS--IKTEKTRKKL-LSEIQIHKSMRHAN-IV 161

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            +ID    ++            V++L+E C    L++ +  R    L E E+    + + 
Sbjct: 162 QFIDCFEDET-----------NVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQIC 208

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
            G+  MH+ +  ++HRD+K+ N+        K+ DFG +  V+    N  E  +      
Sbjct: 209 GGIKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVL---ANDRERKYTV---- 258

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILH----SR 262
              T  Y +PE+L + K    + + DIW++GV +Y +     PF+ +  N I        
Sbjct: 259 -CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCD 316

Query: 263 YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           + +P     S   + L++ +L +DP +RP+I +V++ V
Sbjct: 317 FVFPKEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 103/227 (45%), Gaps = 44/227 (19%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       L+E         ++  +  +H     ++HRD+K
Sbjct: 5   SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHMNN--IVHRDLK 60

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS   E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 61  IENIMISTSGEIKIIDFGLSNMYNPKKQLHTFCG---------SLYFAAPELLK--ACPY 109

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYP--AYPQY 271
             PE+             D+W+ GV L+ +     PF+ E  +++LH + +     YPQ+
Sbjct: 110 TGPEV-------------DVWSFGVVLFVLVCGKVPFDDEN-SSVLHEKIKQGKVEYPQH 155

Query: 272 -SDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLER 317
            S  + +L+  ML+VDP+KR ++ QVV      +G   P  ++   R
Sbjct: 156 LSIEVISLLSKMLVVDPTKRASLKQVVNHQWMQRGYDFPAPSYIPHR 202

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 132/284 (46%), Gaps = 34/284 (11%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++     I +   +A  K  I  +KT   +  +E++  K ++++  +V
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA--KISIKSEKTKRKL-LSEIQIHKSMKHSN-IV 155

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            +ID     +            V++L+E C    L+D +  R    L E E+    + + 
Sbjct: 156 QFIDCFEDDA-----------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQIC 202

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             +  +H+ +  ++HRD+K+ N+        K+ DFG +  V+    N  E  +      
Sbjct: 203 GAIKYLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFG-LAAVL---ANDRERKYTVCG-- 254

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILH----SR 262
              T  Y +PE+L + K    + + DIW++GV +Y +     PF+ +  N I       +
Sbjct: 255 ---TPNYIAPEVL-MGKHSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYERIKLCK 310

Query: 263 YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGV 306
           Y YP     S   + LI  +L ++P +RP I  ++++V   +GV
Sbjct: 311 YGYPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDVW-FRGV 353

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 100/216 (46%), Gaps = 46/216 (21%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       L+E         ++  +  +HA    ++HRD+K
Sbjct: 241 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARRFARGIASALQYLHANN--IVHRDLK 296

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS   E KL DFG            + CG          L F   ++LK     Y
Sbjct: 297 IENIMISTSGEIKLIDFGLSNLYDNRKQLHTFCG---------SLYFAAPELLKANP--Y 345

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSD 273
             PE+             D+W+ GV LY +     PF+ E  +++LH + +     +YS 
Sbjct: 346 TGPEV-------------DVWSFGVVLYVLVCGKVPFDDEN-SSVLHEKIKQ-GKVEYSQ 390

Query: 274 NLK----NLIRVMLMVDPSKRPNICQVVEEVSRLQG 305
           +L     +L+  ML+VDP +R ++ QVV+    ++G
Sbjct: 391 HLSIEVISLLSKMLVVDPKRRASLKQVVDHHWMVRG 426

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 112/229 (48%), Gaps = 29/229 (12%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           V++ +EYC GK L +++  +    L+E   L   S +   V   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECSEL--FSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           +L+  K   KL DFG         T +     +   I   T   Y +PE+  + +     
Sbjct: 159 ILLDKKGHAKLTDFGF--------TRECATKGILETICGTTV--YMAPEL--IERKPYEG 206

Query: 229 EKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAY-PQYSD-----NLKNLIRVM 282
            K D W+LG+ LY + + T PF++  E   + ++Y+   Y P Y +     N K LI  +
Sbjct: 207 YKIDTWSLGIILYTMIHGTMPFDEVDE---VKTKYKIVHYNPTYDNDYIDSNGKELISQL 263

Query: 283 LMVDPSKRPNICQVVEEVSRLQGVPCPLKNF-YLERAIRQTAVQDNHFN 330
           L  DP++RP++ QV++    LQ  P  LK     E+ IR  +    HF+
Sbjct: 264 LEKDPNQRPSLTQVLQH-PFLQ--PYGLKILERTEKVIRAQSHGTKHFH 309

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 122/236 (51%), Gaps = 31/236 (13%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           +V++ +EYC GK L + +      R+   E   + + +   +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEHLLA--LKRISLDECSRLFAQIVGAIYYAHSLN--CVHRDLKLE 157

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           N+L+  K   KL DF    G  R   ++++LD +        T  Y +PE L+  KS   
Sbjct: 158 NILLDKKGNAKLTDF----GFTRECVSKSQLDTI------CGTTVYMAPE-LTERKSYD- 205

Query: 228 NEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYP-AYPQYSDNL-----KNLIRV 281
             K DIWALGV LY +   + PF+++ E     ++++     P+ +++L     K+LI  
Sbjct: 206 GFKIDIWALGVILYTMINGSMPFDEDDE---AKTKWKIVNEMPEINEDLVSPDAKDLIEQ 262

Query: 282 MLMVDPSKRPNICQVVEEVSRLQ--GVPCPLKNFYLERAIRQTAVQDNHFNHQMEQ 335
           +L  DP++RP+I +++     LQ  G+P   K   + R  R+ +V   HF+ ++E+
Sbjct: 263 LLAKDPNERPSIEKILTH-PFLQPYGIPLMEKTQKILRKQRRGSV---HFHSKLER 314

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 104/225 (46%), Gaps = 45/225 (20%)

Query: 110 FLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENV 169
           ++  E+ SG  L+D++       LKE     +   +   +  +HA    ++HRD+KIEN+
Sbjct: 167 YMFFEFISGGQLLDYIIQ--HGSLKENHARKVSRGILSALQYLHANN--IVHRDLKIENI 222

Query: 170 LISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPE 217
           ++S   E KL DFG            + CG          L F   ++LK     Y  PE
Sbjct: 223 MLSKTGEIKLIDFGLSNMYDPRKSLQTFCG---------SLYFAAPELLK--AHPYLGPE 271

Query: 218 MLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYP--AYPQY-SDN 274
           +             D+W+ GV LY +     PF+ E  +A LH + +     YPQ+ S +
Sbjct: 272 V-------------DVWSFGVVLYVLVCGKVPFDDENSSA-LHEKIKKGKVTYPQFLSID 317

Query: 275 LKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLERAI 319
           + +L+  +L+VDP KR  + QVV     L+G   P ++ YL R +
Sbjct: 318 VISLLSKILVVDPQKRATLQQVVNHQWMLKGYDFPPQS-YLPRRV 361

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 101/200 (50%), Gaps = 31/200 (15%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           +V++ +EYC GK L D + +   +R+   E + + + +  GV   H+L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           N+L+    + KL DF    G  R    +T L+ +        T  Y +PE++        
Sbjct: 159 NILLDKSGDAKLTDF----GFTRECMTKTTLETI------CGTTVYMAPELIERKSYDGF 208

Query: 228 NEKSDIWALGVFLYKVCYYTTPFEKEGEN----AILHSRYQYPAYPQYSDNL-----KNL 278
             K DIW+LGV LY +   + PF+++ E      I+H        PQ ++N+     K+L
Sbjct: 209 --KIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQT------PQLNENIVTADAKDL 260

Query: 279 IRVMLMVDPSKRPNICQVVE 298
           I  +L  +P+ RP + Q+++
Sbjct: 261 ILRLLAKNPNDRPTVEQILK 280

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 99/219 (45%), Gaps = 44/219 (20%)

Query: 110 FLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENV 169
           ++L EY SG  L+D++       L+E         ++  +  +H     ++HRD+KIEN+
Sbjct: 179 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIENI 234

Query: 170 LISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPE 217
           +IS   E K+ DFG            + CG          L F   ++LK     Y  PE
Sbjct: 235 MISTSGEIKIIDFGLSNMYDPKKQLHTFCG---------SLYFAAPELLK--AHPYIGPE 283

Query: 218 MLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYP--AYPQY-SDN 274
           +             D+W+ GV LY +     PF+ E   ++LH + +     YPQ+ S  
Sbjct: 284 V-------------DVWSFGVVLYVLVCGKVPFDDENA-SVLHEKIKQGKVEYPQHLSIE 329

Query: 275 LKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNF 313
           + +L+  ML+VDPSKR  + QVV      +G   P  ++
Sbjct: 330 VISLLSKMLVVDPSKRATLKQVVSHQWMQRGYDFPAPSY 368

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 129/278 (46%), Gaps = 33/278 (11%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++     I +   +A  K  I  +KT   +  +E++  K +R+   VV
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA--KISIKSEKTRKKL-LSEIQIHKSMRHFN-VV 151

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            +ID     +            V++L+E C    L++ +  R    + E E+   M+ + 
Sbjct: 152 QFIDCFEDDT-----------NVYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQIC 198

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             +  MH+ +  ++HRD+K+ N+        K+ DFG +  V+    N  E  +      
Sbjct: 199 GAIKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVL---ANDRERKYTV---- 248

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHS----R 262
              T  Y +PE+L + K    + + DIW++GV +Y +     PF+ +  N I        
Sbjct: 249 -CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNMIYERIKNRD 306

Query: 263 YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           + +P     S+  K LI  +L  DP +RP+I ++++ V
Sbjct: 307 FAFPKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 88/179 (49%), Gaps = 20/179 (11%)

Query: 120  GLIDFMN-TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFK 178
            G ID  +   L+  + E+E   I   V   +  +H+    ++HRDIK ENV++ +K   K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVK 1151

Query: 179  LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEK-SDIWALG 237
            L DFGS   V   P +     FV        T  Y +PE+LS     P + K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVLS---GEPFDGKPQDIWAIG 1197

Query: 238  VFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQV 296
            V LY + +   PF    E  IL    ++      S+   NLI+++L  +PS+RP I +V
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 133/295 (45%), Gaps = 48/295 (16%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNV 68
           +T   +  VG++  KILK +  G F +VY     P   H      CLK     DK   N+
Sbjct: 30  FTSDELTEVGNY--KILKQIGEGSFGKVYLALHRP--THRK---VCLK---TSDKNDPNI 79

Query: 69  PRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTR 128
            R      ++  + ++   YI            V     +V++ +EYC GK L D + + 
Sbjct: 80  VR------EVFYHRQFDFPYITKLYE-------VIVTESKVWMALEYCPGKELYDHLLS- 125

Query: 129 LQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGV 188
             +R+   E   + + +S  V   H++    +HRD+K+EN+L+      KL DF    G 
Sbjct: 126 -LHRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDF----GF 178

Query: 189 IRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTT 248
            R    +T L+ V        T  Y +PE+  + +      K D W+LGV LY +   + 
Sbjct: 179 TRECMTKTTLETV------CGTTVYMAPEL--IGRKTYDGFKIDTWSLGVILYTLITGSL 230

Query: 249 PFEKEGENAILHSRYQYP-AYPQYS-----DNLKNLIRVMLMVDPSKRPNICQVV 297
           PF+ + E     ++++     P+Y      D+ K+LI  +L  +P +RP++ QV+
Sbjct: 231 PFDDDDE---AKTKWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 88/321 (27%), Positives = 149/321 (46%), Gaps = 57/321 (17%)

Query: 17  VGSHQAKILKYLTSGGFAQVYQVE-ISPYDIHSGSNIACLKRVIVPDKTSLN-VPRAEVE 74
           VGS +  + K +  G FA V++   I+P   H   ++     +  P   ++  VPR++++
Sbjct: 33  VGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPRSKLK 92

Query: 75  AMKLLRNNKYVVSYIDS----HAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQ 130
             KLL N +  ++ +      H  K          S + +L+MEYCS  G + F+  + Q
Sbjct: 93  NKKLLENLEIEIAILKKISHPHIVK---LIDFERTSKDFYLIMEYCSL-GDLTFLIKKRQ 148

Query: 131 NRLKEFEILN--------------------IMSHVSQGVAAMHALQPP-LLHRDIKIENV 169
             +K   +L                     I++++ Q  +A+  L+   L+HRDIK +N+
Sbjct: 149 QLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVHRDIKPQNL 208

Query: 170 LIS----NKNEFK-LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ--------YRSP 216
           L+S    N N+ K   D G V G+   P  +   DF     L NT+          Y +P
Sbjct: 209 LLSAPLINYNDPKSFHDLGFV-GIYNLPILKIA-DFGFARFLPNTSMAETLCGSPLYMAP 266

Query: 217 EMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQ-------YPAYP 269
           E+L+  K    N K+D+W++G  LY++CY   PF K   +  L+ + +       +P Y 
Sbjct: 267 EILNYQK---YNAKADLWSVGTVLYEMCYGNPPF-KASNHLELYKKIKKANDLIYFPTYI 322

Query: 270 QYSDNLKNLIRVMLMVDPSKR 290
           +  +NLK+LI  +L  DP +R
Sbjct: 323 EIDNNLKSLISKLLTFDPQER 343

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 96/195 (49%), Gaps = 23/195 (11%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E++L++EY  G  L D++ ++   +L E E ++    +  G++  H+    + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRDLKPE 264

Query: 168 NVLISNKNEF-KLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIP 226
           N+L+  K    K+ DFG     +     QT             +  Y SPE++ + K   
Sbjct: 265 NLLLDKKRRIIKIADFGMAALQVSNRLLQTSCG----------SPHYASPEIV-MGKCYN 313

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLIRVM 282
               SDIW+ G+ L+ +     PF  +    +L    + RYQ P+Y   S   KNLI  +
Sbjct: 314 -GAPSDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNLISRI 370

Query: 283 LMVDPSKRPNICQVV 297
           L+VDPSKR +  Q++
Sbjct: 371 LVVDPSKRISTEQIL 385

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 127/278 (45%), Gaps = 33/278 (11%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q       I +   +A L   I  +KT   +  +E++  K ++N   +V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVAKLS--IKSEKTRRKL-LSEIQIHKSMKNVN-IV 143

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            +ID     +            V++L+E C    L+D +  R    L E E+    + + 
Sbjct: 144 QFIDCFEDDT-----------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQIC 190

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             +  MH+ +  ++HRD+K+ N+        K+ DFG +  V+    N  E  +      
Sbjct: 191 GAIKYMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFG-LAAVL---ANDRERKYTV---- 240

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILH----SR 262
              T  Y +PE+L + K    + + DIW++GV LY +     PF+ +  N I        
Sbjct: 241 -CGTPNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCD 298

Query: 263 YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           + +P     S   K LI+ +L +DP +RP++ ++++ V
Sbjct: 299 FTFPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 96/210 (45%), Gaps = 48/210 (22%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       L+E         +   +  +HA    ++HRD+K
Sbjct: 205 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIGSALQYLHANN--IVHRDLK 260

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS   E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 261 IENIMISTSGEIKIIDFGLSNVYDPRKQLHTFCG---------SLYFAAPELLK--ARPY 309

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSR-----YQYPAY 268
             PE+             D+W+ GV LY +     PF+ E  +++LH +      +YP +
Sbjct: 310 LGPEV-------------DVWSFGVVLYVLVCGKVPFDDE-VSSVLHEKIKQGNVEYPNH 355

Query: 269 PQYSDNLKNLIRVMLMVDPSKRPNICQVVE 298
              S  + +L+  ML+VDP +R ++ QV+E
Sbjct: 356 --LSIEVLSLLSKMLVVDPERRASLKQVIE 383

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 94/201 (46%), Gaps = 35/201 (17%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           +V++ +EYC GK L D + ++  +RL   E   + + ++  V   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           NVL+      KL DF    G  R    +  L+ V        T  Y +PEM+   +  P 
Sbjct: 163 NVLLDKNGNAKLTDF----GFTRESMTKAVLETVCG------TTVYMAPEMI---QHKPY 209

Query: 228 NE-KSDIWALGVFLYKVCYYTTPFEKE----------GENAILHSRYQYPAYPQYSDNLK 276
           +  K DIW+LGV LY +     PF+++           +  ++  R   P         +
Sbjct: 210 DGFKVDIWSLGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIPE-------AQ 262

Query: 277 NLIRVMLMVDPSKRPNICQVV 297
           NLI  +L  DP++RPN   ++
Sbjct: 263 NLIEQLLSKDPTERPNTSAIL 283

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 97/210 (46%), Gaps = 48/210 (22%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       LKE         ++  +  +HA    ++HRD+K
Sbjct: 195 SNHFYMLFEYVSGGQLLDYIIQ--HGSLKEHHARKFARGIASALQYLHANN--IVHRDLK 250

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS+  E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 251 IENIMISSSGEIKIIDFGLSNIFDYRKQLHTFCG---------SLYFAAPELLK--AQPY 299

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQ-----YPAY 268
             PE+             DIW+ G+ LY +     PF+ E  ++ILH + +     YP++
Sbjct: 300 TGPEV-------------DIWSFGIVLYVLVCGKVPFDDEN-SSILHEKIKKGKVDYPSH 345

Query: 269 PQYSDNLKNLIRVMLMVDPSKRPNICQVVE 298
              S  + +L+  M++VDP +R  +  VVE
Sbjct: 346 --LSIEVISLLTRMIVVDPLRRATLKNVVE 373

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 85/180 (47%), Gaps = 18/180 (10%)

Query: 120  GLIDFMN-TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFK 178
            G ID  +    +  + EFE   I   +  G++ +H  +  ++HRDIK ENV++  K   K
Sbjct: 1094 GCIDLFDLIEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVK 1151

Query: 179  LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGV 238
            L DFGS   V   P +     FV        T  Y SPE+L   K     +  DIWALG+
Sbjct: 1152 LIDFGSAAYVKNGPFDV----FV-------GTIDYASPEVLRGEKY--EGKPQDIWALGI 1198

Query: 239  FLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVE 298
             LY + +   PF    E  IL    ++P     S N  +LI+++L     +RP+I  + E
Sbjct: 1199 LLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDISE 1256

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 98/215 (45%), Gaps = 44/215 (20%)

Query: 110 FLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENV 169
           ++L EY SG  L+D++       L+E         ++  +  +H     ++HRD+KIEN+
Sbjct: 217 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIENI 272

Query: 170 LISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPE 217
           +IS+  E ++ DFG            + CG          L F   ++LK     Y  PE
Sbjct: 273 MISSSGEIRIIDFGLSNLYDPKKQLHTFCG---------SLYFAAPELLK--AHPYTGPE 321

Query: 218 MLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPA--YPQY-SDN 274
           +             DIW+ GV LY +     PF+ E   ++LH + +     YPQ+ S +
Sbjct: 322 V-------------DIWSFGVVLYVLVCGKVPFDDENA-SVLHEKIKQGKVEYPQHLSID 367

Query: 275 LKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCP 309
           + +L+  ML+VDP KR  + QVV      +G   P
Sbjct: 368 VISLLSKMLVVDPLKRATLKQVVNHQWMQKGYDFP 402

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 79.3 bits (194), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 78/282 (27%), Positives = 125/282 (44%), Gaps = 43/282 (15%)

Query: 23  KILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRA---EVEAMKLL 79
           +I + L  G F +VY V   P  +     I  LK +   +  + NV +    E++    L
Sbjct: 119 EIGRKLGKGKFGKVYCVRHKPSGL-----ICALKVMNKMEIVNFNVQKQFKREIDIQYHL 173

Query: 80  RNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEIL 139
            +      Y   H +K+            V+L+MEY  G  L   +  +    + +    
Sbjct: 174 NHKNLTKLYAFFHDSKN------------VYLVMEYLIGGELYKLL--KKNGPMNDITAS 219

Query: 140 NIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELD 199
           N +  ++  +  MH  +  ++HRD+K EN+LI   N+ KL DFG     I  P NQ    
Sbjct: 220 NYVYQMTDALNYMHKRK--IIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNNQKRKT 274

Query: 200 FVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENA-- 257
                     T  Y SPE++S   S   +E  D+WALG+  Y++     PFE++ +    
Sbjct: 275 LC-------GTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTY 324

Query: 258 --ILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVV 297
             I  S  ++P  P  S   ++LI  +L V PS+R N+ QV+
Sbjct: 325 KRIAKSDLKFP--PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 80.1 bits (196), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 97/194 (50%), Gaps = 16/194 (8%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++++MEYC G    D +       L E ++  I  +V +G+  +H  +   +HRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHEQRK--IHRDVKAAN 149

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           VL+++    KL DFG V G +R    +    FV        T  + +PE++S S S   N
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLRSTAKRNT--FV-------GTPYWMAPEIISNS-SHGYN 198

Query: 229 EKSDIWALGVFLYKVCYYTTPFEKEGENAILHS---RYQYPAYPQYSDNLKNLIRVMLMV 285
           EK+DIW+LG+ +Y++     P+ K     ++ +   +        +SD  K  I   L+ 
Sbjct: 199 EKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQDCMVSFSDAAKLFISACLIK 258

Query: 286 DPSKRPNICQVVEE 299
           DP +RP   +++++
Sbjct: 259 DPDERPTATELLQQ 272

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 130/279 (46%), Gaps = 35/279 (12%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++     I +   +A  K  I  +KT   +  +E++  K +R+   +V
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA--KISIKSEKTRKKLL-SEIQIHKSMRHFN-IV 139

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            +ID     +            V++L+E C    L+D +  R    L E E+    + + 
Sbjct: 140 QFIDCFEDDT-----------NVYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIV 186

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             V  MH+ +  ++HRD+K+ N+        K+ DFG +  V+    N  E  +      
Sbjct: 187 GAVKYMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFG-LAAVL---ANDRERKYTV---- 236

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSR---- 262
              T  Y +PE+L+  K    + + DIW+ GV +Y +     PF+ +  N I++ R    
Sbjct: 237 -CGTPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVN-IIYERIKCG 293

Query: 263 -YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
            Y +P     S     LIR +L +DP +RP++ ++++ V
Sbjct: 294 DYVFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 138/297 (46%), Gaps = 52/297 (17%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV--PDKTSL 66
           +T   +  VG++  KILK +  G F +VY     P            ++V++   DK+  
Sbjct: 26  FTSDELSEVGNY--KILKQIGEGSFGKVYLASHKP----------THRKVVLKTSDKSDP 73

Query: 67  NVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMN 126
           N+ R      ++  + ++   YI            V     +V++ +EYC G+ L + + 
Sbjct: 74  NLVR------EVFYHRQFDFPYITKLYE-------VIVTETKVWMALEYCPGRELYEHL- 119

Query: 127 TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVC 186
             + +R+   E   + + +   V   H+L    +HRD+K+EN+L+      KL DF    
Sbjct: 120 -LMLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLENILLDKNGNAKLTDF---- 172

Query: 187 GVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYY 246
           G  R   +++ L+ +        T  Y +PE+  + +      K DIW+LGV LY +   
Sbjct: 173 GFTRECVSKSSLETI------CGTTVYMAPEL--IQRQAYDGFKIDIWSLGVILYTMING 224

Query: 247 TTPFEKEGENAILHSRYQYP-AYPQYSDNL-----KNLIRVMLMVDPSKRPNICQVV 297
           T PF+++ E     ++++    +P ++DN      K+LI+ +L   PS+RP + Q++
Sbjct: 225 TMPFDEDDETK---TKWKIVNDFPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 96/210 (45%), Gaps = 48/210 (22%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       LKE         ++  +  +HA    ++HRD+K
Sbjct: 203 SNHFYMLFEYVSGGQLLDYIIQ--HGSLKEHHARKFARGIASALQYLHANN--IVHRDLK 258

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++ISN  E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 259 IENIMISNSGEIKIIDFGLSNIFDSKKKLHTFCG---------SLYFAAPELLK--AQPY 307

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQ-----YPAY 268
             PE+             DIW+ G+ LY +     PF+ E  ++ILH + +     YP++
Sbjct: 308 TGPEV-------------DIWSFGIVLYVLVCGKVPFDDEN-SSILHEKIKKGKVDYPSH 353

Query: 269 PQYSDNLKNLIRVMLMVDPSKRPNICQVVE 298
              S +  +L+  M++VDP KR  +  V +
Sbjct: 354 --LSIDAVSLLTRMIVVDPLKRATLKNVTD 381

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 91/197 (46%), Gaps = 21/197 (10%)

Query: 110  FLLMEYCSGKGLIDFMN-TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
            +L  E     G ID  +   L+  + EFE   +   V+ G+  +H     ++HRDIK EN
Sbjct: 1051 YLETEMHGETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDEN 1108

Query: 169  VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
            V++ NK   KL DFGS   V   P +     FV        T  Y +PE+L      P  
Sbjct: 1109 VIVDNKGFVKLIDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVLG---GEPYE 1154

Query: 229  EK-SDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDP 287
             K  DIWA+GV LY + Y   PF    E  IL    +  +  + S     LIR +L    
Sbjct: 1155 GKPQDIWAIGVLLYTIIYKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRSV 1212

Query: 288  SKRPNICQVVEEVSRLQ 304
            SKRP I  ++E+ S LQ
Sbjct: 1213 SKRPTIDDIMED-SWLQ 1228

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 98/215 (45%), Gaps = 44/215 (20%)

Query: 110 FLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENV 169
           ++L EY SG  L+D++       L+E         ++  +  +H     ++HRD+KIEN+
Sbjct: 156 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHLNN--IVHRDLKIENI 211

Query: 170 LISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPE 217
           +IS+  E ++ DFG            + CG          L F   ++LK     Y  PE
Sbjct: 212 MISSSGEIRIIDFGLSNMYDPKKQLHTFCG---------SLYFAAPELLK--AHPYTGPE 260

Query: 218 MLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYP--AYPQY-SDN 274
           +             DIW+ GV LY +     PF+ E   ++LH + +     YPQ+ S +
Sbjct: 261 V-------------DIWSFGVVLYVLVCGKVPFDDENA-SVLHEKIKQGKVEYPQHLSID 306

Query: 275 LKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCP 309
           + +L+  ML+VDP KR  + QVV      +G   P
Sbjct: 307 VISLLSKMLVVDPYKRATLKQVVHHQWMQKGYDFP 341

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 104/213 (48%), Gaps = 35/213 (16%)

Query: 102 VPN-----GSY----EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAM 152
           VPN     GSY    E++++MEYC+G  L   +      ++ E  I  IM  +   +A M
Sbjct: 75  VPNITHYYGSYLNNTELWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALM 129

Query: 153 HALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ 212
           H  +  ++HRDIK  NVLI+N    KLCDFG                  Q  I + T A 
Sbjct: 130 HIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAA------------QLSQTKIRRQTMAG 177

Query: 213 ---YRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPF-EKEGENAI-LHSRYQYPA 267
              + +PE+  + + +  + K DIW+LG+  Y++     P+ + E   A+ L ++ + P 
Sbjct: 178 TPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPR 235

Query: 268 YP--QYSDNLKNLIRVMLMVDPSKRPNICQVVE 298
               Q+S  LK  I + L  DP +RP+  ++++
Sbjct: 236 LEGRQHSSALKEFIALCLDEDPKERPSAEELLK 268

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 96/208 (46%), Gaps = 44/208 (21%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       LKE    N    +   +  +HA    ++HRD+K
Sbjct: 199 SNHFYMLFEYVSGGQLLDYIIQ--HGSLKESHARNFARQILSALKYLHANN--IVHRDLK 254

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS+    K+ DFG            + CG          L F   ++L+     Y
Sbjct: 255 IENIMISSNGNIKIIDFGLSNLYDKSKKLKTYCG---------SLYFAAPELLR--ANPY 303

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPA--YPQY 271
             PE+             D+W+ GV LY +     PF+ E  N +LH + +     YPQ+
Sbjct: 304 IGPEI-------------DVWSFGVVLYVLVCGKVPFDDENSN-VLHEKIKQGRVFYPQF 349

Query: 272 -SDNLKNLIRVMLMVDPSKRPNICQVVE 298
            S  + +L+  ML+VDP KR  + QV++
Sbjct: 350 LSIEVISLLSTMLVVDPFKRATLDQVMK 377

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 81/338 (23%), Positives = 143/338 (42%), Gaps = 66/338 (19%)

Query: 15  LPVGSHQAKILKYLTSGGFAQVYQVE-ISPYDIHSG--SNIACLKRVIVP--DKTSLNVP 69
           L +   +  I K L    F+ +Y V+ I      S   +N+  LKR+  P  +  S++  
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESISGA 85

Query: 70  RAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRL 129
             EV+  K  ++  Y++  +DS  A+ R      +GS  V++L+ Y     L D  +  L
Sbjct: 86  MKEVDNYKRFQS-PYIIHLVDSQVAQQR------DGSKTVYILLPYFPLGSLQDSTSRNL 138

Query: 130 QNR--LKEFEILNIMSHVSQGVAAMH---------------------------------A 154
            N   + E E + I+  +++G+  +H                                  
Sbjct: 139 LNGTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTP 198

Query: 155 LQPPLL------------HRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQ 202
           L+  +L            HRDIK  N+L S+     + + GS            +L  +Q
Sbjct: 199 LELDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQ 258

Query: 203 HDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGE------- 255
             +  + T  Y +PE+L ++ +  ++ K DIW+LG   Y + +  +PFE+E +       
Sbjct: 259 AWVSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLK 318

Query: 256 NAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNI 293
            AI    + +P+  +YS+ L  LI   L V+P+ RP+I
Sbjct: 319 YAIGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 96/207 (46%), Gaps = 44/207 (21%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       L+E         ++  +  +H     ++HRD+K
Sbjct: 250 SNHFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHGNN--IVHRDLK 305

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS   + K+ DFG            + CG          L F   ++LK     Y
Sbjct: 306 IENIMISTSGDIKIIDFGLSNLYDSKKQLNTFCG---------SLYFAAPELLKANP--Y 354

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPA--YPQY 271
             PE+             DIW+ GV LY +     PF+ E  +++LH + +     YPQ+
Sbjct: 355 VGPEV-------------DIWSFGVVLYVLACGKVPFDDEN-SSVLHEKIKQGKVDYPQH 400

Query: 272 -SDNLKNLIRVMLMVDPSKRPNICQVV 297
            S  + +L+  ML+VDP KR ++ Q+V
Sbjct: 401 LSIEVISLLSKMLVVDPKKRASLQQIV 427

>KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {ON}
           weakly similar to uniprot|Q03306 YDR466W Saccharomyces
           cerevisiae YDR466W Protein kinase with similarity to
           mammalian phosphoinositide-dependent kinase 1 (PDK1) and
           yeast Pkh1p and Pkh2p, two redundant upstream activators
           of Pkc1p; identified as a multicopy suppressor of a pkh1
           pkh2 double mutant
          Length = 647

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 105/227 (46%), Gaps = 18/227 (7%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S  ++ ++++  G  L+  + T  Q R  E    + M  +   +  +H  +  ++HRD+K
Sbjct: 83  SENLYFVLDFAPGGELLQLLQT--QGRFNEAWTKHFMCQLIDALEYIHGCK--VVHRDLK 138

Query: 166 IENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSI 225
            EN+L+S++ +  + DFG    +       +   FV        TA+Y SPE+L  +KS 
Sbjct: 139 PENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFV-------GTAEYVSPELLLQNKS- 190

Query: 226 PINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHS--RYQYPAYPQYSDNLKNLIRVML 283
             N  SDIWA+G  LY+    T PF  E E A         Y      S ++ +L+  +L
Sbjct: 191 --NFCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYHWIYMVSQHITDLVSKIL 248

Query: 284 MVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLERAIRQTAVQDNHFN 330
           ++DP  R  + Q ++  +  QG+    K   + + I Q     NH N
Sbjct: 249 VLDPDSRYTLPQ-IKNHAWFQGIDWTNKEL-IWKGIWQLFGNRNHNN 293

>Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {ON}
           complement(67104..68684) [1581 nt, 527 aa]
          Length = 526

 Score = 79.3 bits (194), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 124/277 (44%), Gaps = 56/277 (20%)

Query: 46  IHSGSNIACLKRVIVPDKTSLNV-PRAEVEAMKLLRNNK-----YVVSYIDSHAAKSRPA 99
           + SGS I  LK +      +LN  P  + +  + L+ NK     Y+V Y      +S  +
Sbjct: 255 LKSGSKIFALKTI-----NTLNTDPEYQKQIFRELQFNKSFKSDYIVRYYGMFTDESNSS 309

Query: 100 PGVPNGSYEVFLLMEYCSGKGL----IDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHAL 155
                    +F+ MEY  G+ L    ++ +N  L  R+ E  +  I   V +G++ +H  
Sbjct: 310 ---------IFIAMEYMGGRSLDAIYLNLLN--LGGRIGEKVLGKIAESVLRGLSYLHER 358

Query: 156 QPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRS 215
           +  ++HRDIK +N+L++ K + KLCDF    GV     N     F         T+ Y +
Sbjct: 359 K--VIHRDIKPQNILLNEKGQVKLCDF----GVSGEAVNSLATTFT-------GTSFYMA 405

Query: 216 PEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENA----------ILHSRYQY 265
           PE +   +  P +   D+W+LG+ L +V     PF  +   A          IL    Q 
Sbjct: 406 PERI---QGQPYSVTCDVWSLGLTLLEVAQAKFPFGSDKMTATIAPIELLMLILTFSPQL 462

Query: 266 PAYPQ----YSDNLKNLIRVMLMVDPSKRPNICQVVE 298
              P+    +S + K+ I   L  DPS+RP+  Q+++
Sbjct: 463 KDEPELNIVWSKSFKSFIEYCLKKDPSERPSPRQMIQ 499

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 131/293 (44%), Gaps = 44/293 (15%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNV 68
           +T   +  VG++  KILK +  G F +VY     P   H      CLK     DK   N+
Sbjct: 30  FTSDELTEVGNY--KILKQIGEGSFGKVYLALHRP--THRK---VCLK---TSDKNDPNI 79

Query: 69  PRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTR 128
            R EV   +   +  Y+    +    +S+           V++ +EYC GK L D  +  
Sbjct: 80  VR-EVFYHRQF-DFPYITKLYEVIVTESK-----------VWMALEYCPGKELYD--HLL 124

Query: 129 LQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGV 188
              R+   E   + + +S  V   H++    +HRD+K+EN+L+      KL DF    G 
Sbjct: 125 SLRRISLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDF----GF 178

Query: 189 IRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTT 248
            R    +T L+ V        T  Y +PE+  + +      K DIW+LGV LY +     
Sbjct: 179 TRECMTKTTLETV------CGTTVYMAPEL--IERRTYDGFKIDIWSLGVILYTLITGYL 230

Query: 249 PFEKEGEN----AILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVV 297
           PF+ + E      I++   +Y A     D+ ++LI  +L  +P +RP++ QV+
Sbjct: 231 PFDDDDEAKTKWKIVNEEPKYDA-KVIPDDARDLISRLLAKNPGERPSLSQVL 282

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/278 (24%), Positives = 129/278 (46%), Gaps = 33/278 (11%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++     I +   +A  K  I  +KT   +  +E++  K +R+   +V
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA--KISIKSEKTRKKL-LSEIQIHKSMRHPN-IV 133

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            + D     +            V++L+E C    L+D +  R Q  L E E+    + + 
Sbjct: 134 QFTDCFEDDT-----------NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIV 180

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             +  MH+ +  ++HRD+K+ N+        K+ DFG +  V+    N  E  +      
Sbjct: 181 GAIKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVL---ANDRERKYTI---- 230

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILH----SR 262
              T  Y +PE+L+  K    + + D+W++GV +Y +     PF+ +  N I        
Sbjct: 231 -CGTPNYIAPEVLT-GKHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCD 288

Query: 263 YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           + +P     S   K LI+ +L +DP +RP++ +++E V
Sbjct: 289 FNFPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 129/278 (46%), Gaps = 33/278 (11%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q+      + +   +A L   I  +KT   +  +E++  K +++   +V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVAKLS--IKTEKTRKKL-LSEIQIHKSMKHQN-IV 205

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            +ID     +            V++L+E C    L++ +  R Q  L E E+    + + 
Sbjct: 206 QFIDCFEDDT-----------NVYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQIC 252

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             +  MH+ +  ++HRD+K+ N+        K+ DFG +  V+    N  E  F      
Sbjct: 253 GAIKYMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVL---ANDRERKFTV---- 302

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILH----SR 262
              T  Y +PE+L + K    + + D+W++GV +Y +     PF+ +  N I        
Sbjct: 303 -CGTPNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCD 360

Query: 263 YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           + +P     S   K L++ +L +DP +RP+I ++++ V
Sbjct: 361 FIFPKEKPISHEAKVLVQDLLSLDPLERPSISEIMDYV 398

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 98/197 (49%), Gaps = 27/197 (13%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E++L++EY  G  L D++ +R   +L E E ++    + QGVA  HA    + HRD+K E
Sbjct: 173 ELYLVLEYVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAFN--ICHRDLKPE 228

Query: 168 NVLISNKNE-FKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTA---QYRSPEMLSLSK 223
           N+L+  KN+  K+ DFG     +              D L +T+     Y SPE++ + K
Sbjct: 229 NLLLDKKNKIIKIADFGMAALEVS-------------DKLLSTSCGSPHYASPEIV-MGK 274

Query: 224 SIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSD---NLKNLIR 280
           S      +D+W+ G+ L+ +     PF  +    +L  + Q   Y   SD   + K+LI 
Sbjct: 275 SYH-GSPTDVWSCGIILFALLTGHLPFNHDNIKKLLL-KVQSGVYHMPSDLSPDAKDLIS 332

Query: 281 VMLMVDPSKRPNICQVV 297
            +L+VDP KR    +++
Sbjct: 333 KILVVDPDKRLTTTEIL 349

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 98/202 (48%), Gaps = 29/202 (14%)

Query: 102 VPN-----GSY----EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAM 152
           VPN     GSY     ++++MEYC+G  L   +   +   + E  I  IM  +   +  +
Sbjct: 100 VPNITRYYGSYLQDTNLWIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCI 156

Query: 153 HALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ 212
           H  +  ++HRDIK  NVLI+N+ + KLCDFG    +     NQT L   +   +   T  
Sbjct: 157 H--KDNVIHRDIKAANVLITNEGKVKLCDFGVAAQL-----NQTSL---RRQTMAG-TPY 205

Query: 213 YRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPF-EKEGENAILHSRYQYPAY--- 268
           + +PE+  + + +  + K DIW+LG+  Y++     P+ E E   A+       PA    
Sbjct: 206 WMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEG 263

Query: 269 PQYSDNLKNLIRVMLMVDPSKR 290
            QYS  LK  I + L  DP +R
Sbjct: 264 RQYSSGLKEFIALCLDEDPKER 285

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 94/199 (47%), Gaps = 29/199 (14%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E++L++EY  G  L D++ +R   +L E E ++    + QGV+  H     + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPE 196

Query: 168 NVLISNKN-EFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTA---QYRSPEMLSLSK 223
           N+L+  KN   K+ DFG                    D L  T+     Y SPE++   K
Sbjct: 197 NLLLDKKNLSVKIADFGMAA-------------LETTDKLLETSCGSPHYASPEIVMGQK 243

Query: 224 SIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLI 279
                  SD+W+ G+ L+ +     PF  +    +L      +YQ P     S+  K+LI
Sbjct: 244 Y--HGSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQ--NISNEAKDLI 299

Query: 280 RVMLMVDPSKRPNICQVVE 298
             +L+VDP+ R  I +V+E
Sbjct: 300 AKILIVDPAMRITIDEVLE 318

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/282 (23%), Positives = 125/282 (44%), Gaps = 41/282 (14%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++     + +   +A +                   ++K  +  K ++
Sbjct: 78  FLGEGGFARCFQMKDDSGKVFAAKTVAKI-------------------SIKSEKTRKKLL 118

Query: 87  SYIDSHAAKSRPAPGVPNGSYE----VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIM 142
           S I  H +   P        +E    V++L+E C    L+D +  R Q  L E E+    
Sbjct: 119 SEIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFT 176

Query: 143 SHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQ 202
           + +   +  MH+ +  ++HRD+K+ N+        K+ DFG +  V+    N  E  +  
Sbjct: 177 TQIVGAIKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVL---ANDRERKYTI 230

Query: 203 HDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILH-- 260
                  T  Y +PE+L+  K    + + DIW++GV +Y +     PF+ +  N I    
Sbjct: 231 -----CGTPNYIAPEVLT-GKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNTIYERI 284

Query: 261 --SRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
               + +P     S   K LI+ +L +DP +RP++ +++E V
Sbjct: 285 KVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 127/278 (45%), Gaps = 33/278 (11%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q+      I +   +A  K  I  +KT   +  +E++  K +++   +V
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA--KISIKSEKTRKKL-LSEIQIHKSMKHVN-IV 155

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            +ID     +            V++L+E C    L+D +  R    L E E+    + + 
Sbjct: 156 QFIDCFEDDT-----------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQIC 202

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             +  MH+ +  ++HRD+K+ N+    K   K+ DFG    +     N  E  +      
Sbjct: 203 GAIKYMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATL----ANDRERKYTV---- 252

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILH----SR 262
              T  Y +PE+L + K    + + DIW++GV +Y +     PF+ +  N I        
Sbjct: 253 -CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRD 310

Query: 263 YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
           + +P     S   K LI+ +L +DP +RP++ ++++ +
Sbjct: 311 FSFPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/207 (30%), Positives = 100/207 (48%), Gaps = 35/207 (16%)

Query: 102 VPN-----GSY----EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAM 152
           VPN     GSY    +++++MEYC+G  L   +      ++ E  I  IM  +    A M
Sbjct: 75  VPNITHYYGSYLNDTKLWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--TALM 129

Query: 153 HALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ 212
           H  +  ++HRDIK  NVLI+N    KLCDFG                  Q  I + T A 
Sbjct: 130 HIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAA------------QLSQTKIRRQTMAG 177

Query: 213 ---YRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPF-EKEGENAI-LHSRYQYPA 267
              + +PE+  + + +  + K DIW+LG+  Y++     P+ E E   A+ L ++ + P 
Sbjct: 178 TPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPR 235

Query: 268 YP--QYSDNLKNLIRVMLMVDPSKRPN 292
               Q+S  LK +I + L  DP +RP+
Sbjct: 236 LEGRQHSSALKEIIALCLDEDPKERPS 262

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 82/295 (27%), Positives = 133/295 (45%), Gaps = 48/295 (16%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNV 68
           +T   +  VG++  KILK +  G F +VY     P   H      CLK     DK   N+
Sbjct: 30  FTSDELTEVGNY--KILKQIGEGSFGKVYLALHRP--THRK---VCLK---TSDKNDPNI 79

Query: 69  PRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTR 128
            R EV   +   +  Y+    +    +S+           V++ +EYC GK L D  +  
Sbjct: 80  VR-EVFYHRQF-DFPYITKLYEVIVTESK-----------VWMALEYCPGKELYD--HLL 124

Query: 129 LQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGV 188
              RL   E   + + +S  V   H++    +HRD+K+EN+L+      KL DF    G 
Sbjct: 125 SLRRLSLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDF----GF 178

Query: 189 IRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTT 248
            R    +T L+ V        T  Y +PE+  + +      K DIW+LGV LY +     
Sbjct: 179 TRECMTKTTLETV------CGTTVYMAPEL--IERKTYDGFKIDIWSLGVILYTLITGYL 230

Query: 249 PFEKEGENAILHSRYQYP-AYPQYS-----DNLKNLIRVMLMVDPSKRPNICQVV 297
           PF+ + E   + ++++     P+Y      D+ K+LI  +L  +P +RP++ QV+
Sbjct: 231 PFDDDDE---VKTKWKIVNEEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVL 282

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 131/293 (44%), Gaps = 43/293 (14%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++     + +   +A L                   ++K  +  + ++
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVAKL-------------------SIKSEKTRRKLL 135

Query: 87  SYIDSHAAKSRPAPGVPNGSYE----VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIM 142
           S I  H +   P        +E    V++L+E C    +++ +  R    L E E+   M
Sbjct: 136 SEIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQR--KHLTEPEVRFCM 193

Query: 143 SHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQ 202
             +   +  MH+ +  ++HRD+K+ N+    +   K+ DFG +  V+    N  E  +  
Sbjct: 194 IQIIGAIRYMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFG-LAAVL---ANDKERKYTI 247

Query: 203 HDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSR 262
                  T  Y +PE+L+  K    + + DIW++GV LY + +   PF+ + E   ++ R
Sbjct: 248 -----CGTPNYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQAK-EVETIYER 300

Query: 263 -----YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPL 310
                + +PA    S + KNLI  +L ++P+ RP++ ++ + V      P  L
Sbjct: 301 IKCRDFIFPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRL 353

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 95/194 (48%), Gaps = 24/194 (12%)

Query: 105 GSY----EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLL 160
           GSY     ++++MEYC+G  L   +      ++ E  I  IM  V   +  +H  +  ++
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMREVLVALKCIH--KDNVI 141

Query: 161 HRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLS 220
           HRDIK  NVLI+N+   KLCDFG    V     NQT L   +   +   T  + +PE+  
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQV-----NQTSL---RRQTMAG-TPYWMAPEV-- 190

Query: 221 LSKSIPINEKSDIWALGVFLYKVCYYTTPF-EKEGENA---ILHSRYQYPAYPQYSDNLK 276
           + + +  + K DIW+LG+  Y++     P+ E E   A   I+ S+        YS +LK
Sbjct: 191 IMEGVYYDTKVDIWSLGITTYEIATGNPPYCEVEALRAMQLIIKSKPPRLEGRSYSPSLK 250

Query: 277 NLIRVMLMVDPSKR 290
             I + L  DP +R
Sbjct: 251 EFIALCLDEDPKER 264

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 96/210 (45%), Gaps = 48/210 (22%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       LKE         ++  +  +HA    ++HRD+K
Sbjct: 202 SNHFYMLFEYVSGGQLLDYIIQ--HGSLKEHHARKFARGIASALQYLHANN--IVHRDLK 257

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS+  E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 258 IENIMISSSGEIKIIDFGLSNIFDYRKQLHTFCG---------SLYFAAPELLK--AQPY 306

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQ-----YPAY 268
             PE+             DIW+ G+ LY +     PF+ E  ++ILH + +     YP++
Sbjct: 307 TGPEV-------------DIWSFGIVLYVLVCGKVPFDDEN-SSILHEKIKKGKVDYPSH 352

Query: 269 PQYSDNLKNLIRVMLMVDPSKRPNICQVVE 298
              S    +L+  M+++DP KR  +  VV+
Sbjct: 353 --LSIEAISLLTRMIVIDPLKRATLKNVVD 380

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 96/195 (49%), Gaps = 23/195 (11%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E+FL++EY  G  L D++ +R   RL E E ++    + +G A  H     + HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICHRDLKPE 186

Query: 168 NVLISNKNE-FKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIP 226
           N+L+  KN+  K+ DFG           QT    ++       +  Y SPE++ + K+  
Sbjct: 187 NLLLDKKNKRIKIADFGMAA-------LQTSNKLLETSC---GSPHYASPEIV-MGKNYN 235

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLIRVM 282
               SD+W+ G+ L+ +     PF  +    +L      +YQ P     S   ++LI  +
Sbjct: 236 -GGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--SVSSGAQDLISRI 292

Query: 283 LMVDPSKRPNICQVV 297
           L+VDP KR +I +++
Sbjct: 293 LVVDPDKRISINEIL 307

>TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.262
           YPL236C
          Length = 413

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 80/153 (52%), Gaps = 7/153 (4%)

Query: 158 PLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPE 217
           P  HRD+   N+L ++     L D GS        T  ++L   +  I ++ T  Y +PE
Sbjct: 257 PYAHRDLTPSNILFASDGYPILSDLGSCIPANVSITTNSQLIKWKDWIAESCTLPYTAPE 316

Query: 218 MLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGE-------NAILHSRYQYPAYPQ 270
           +L++  +  I  KSDIW++G   Y + +  +PFE+E +        A+    Y +P+  +
Sbjct: 317 ILNIRLNSHITTKSDIWSVGCIFYCILFGISPFEREEQLRGASITYALSTGHYSFPSQNR 376

Query: 271 YSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRL 303
           YS++L N+I+  L +DP+ RP+   + +++  L
Sbjct: 377 YSNDLLNVIKACLQIDPTARPSADTLFQQLETL 409

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 128/279 (45%), Gaps = 33/279 (11%)

Query: 26  KYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYV 85
           ++L  GGFA+ +Q++     I +   +A  K  I  +KT   +  +E++  K +++   +
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVA--KISIKTEKTRRKL-LSEIQIHKSMKHQN-I 201

Query: 86  VSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHV 145
           V ++D                  V++L+  C    L++ +  R    L E E+      +
Sbjct: 202 VQFVDCF-----------EDHINVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQI 248

Query: 146 SQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDI 205
              +  MH+ +  ++HRD+K+ N+        K+ DFG +  V+    N  E  +     
Sbjct: 249 CGAIKYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFG-LAAVL---ANDRERKYTVCG- 301

Query: 206 LKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HS 261
               T  Y +PE+L L K    + + DIW++GV ++ +     PF+ +  N I     +S
Sbjct: 302 ----TPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNS 356

Query: 262 RYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
            Y +P     S   K LI+ +L+ DP  RP+I +++E V
Sbjct: 357 EYTFPINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 112/234 (47%), Gaps = 27/234 (11%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           +V++  EYC GK L D +   LQ R+     + + + +   V   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           N+L+      KL DF    G  R    +T L+ +        T  Y +PE++        
Sbjct: 159 NILLDKNGNAKLTDF----GFTRECMTKTSLETICG------TTVYMAPELIKRESYDGF 208

Query: 228 NEKSDIWALGVFLYKVCYYTTPFEKEGENAI-LHSRYQYPAYPQ--YSDNLKNLIRVMLM 284
             K DIW+LGV LY +   + PF+++ E         + P +     S++ K+L+  +L 
Sbjct: 209 --KIDIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAKDLLIKLLS 266

Query: 285 VDPSKRPNICQVVEEVSRLQGVPCPLKNFYLERAIRQTAVQDN---HFNHQMEQ 335
            DP++RP++ +++     LQ    P  +  LE+  R    Q N   HF+ ++E+
Sbjct: 267 KDPNERPSMQEILHH-PFLQ----PYGSLLLEKTDRLLRKQRNGTIHFHSKLER 315

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 97/198 (48%), Gaps = 27/198 (13%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E++L++EY  G  L D++ ++   +L E E +     + +GV   H+    + HRD+K E
Sbjct: 234 ELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSFN--ICHRDLKPE 289

Query: 168 NVLISNKNEF-KLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTA--QYRSPEMLSLSKS 224
           N+L+  K +  K+ DFG                 V + +LK +     Y SPE++ + K+
Sbjct: 290 NLLLDKKRKLIKIADFGMAALQ------------VSNTLLKTSCGSPHYASPEIV-MGKT 336

Query: 225 IPINEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLIR 280
                 SD+W+ G+ L+ +     PF  +    +L    + RYQ P Y   S + K+LI 
Sbjct: 337 YN-GGPSDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--LSKDAKDLIS 393

Query: 281 VMLMVDPSKRPNICQVVE 298
            +L+V+P  R    Q++E
Sbjct: 394 RILLVNPKARLTTEQILE 411

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 96/195 (49%), Gaps = 23/195 (11%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E+FL++EY  G  L D++ +R   RL E E ++    + +G A  H+    + HRD+K E
Sbjct: 131 ELFLVLEYVDGGELFDYLVSR--GRLSEKEAIHYFRQIIEGTAYCHSFN--ICHRDLKPE 186

Query: 168 NVLISNKNE-FKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIP 226
           N+L+  KN+  K+ DFG           QT    ++       +  Y SPE++ + K+  
Sbjct: 187 NLLLDKKNKRIKIADFGMAA-------LQTSNKLLETSC---GSPHYASPEIV-MGKTYN 235

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLIRVM 282
               SD+W+ G+ L+ +     PF  +    +L      +YQ P     S   ++LI  +
Sbjct: 236 -GGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--AISLEAQDLISRI 292

Query: 283 LMVDPSKRPNICQVV 297
           L+VDP+KR  I  ++
Sbjct: 293 LVVDPNKRITINDIL 307

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/187 (29%), Positives = 93/187 (49%), Gaps = 16/187 (8%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++++MEYC G    D +    +  L E +   I   V +G+  +H  +   +HRDIK  N
Sbjct: 86  IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKGLRYLHEQKK--IHRDIKAAN 143

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           +L+++    KL DFG V G I+    +    FV        T  + +PE++   +S   N
Sbjct: 144 ILLTDDGMVKLGDFG-VSGQIKATLKKDT--FV-------GTPYWMAPEVVKKDES-GYN 192

Query: 229 EKSDIWALGVFLYKVCYYTTPFEKEGENAILHS---RYQYPAYPQYSDNLKNLIRVMLMV 285
           EK+DIW+LG+ +Y++     P  K     ++ S   R     +  YS++ K+ I   L+ 
Sbjct: 193 EKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRAPKLHGHYSEDAKSFISHCLIK 252

Query: 286 DPSKRPN 292
           DP+ RPN
Sbjct: 253 DPNARPN 259

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 102/210 (48%), Gaps = 25/210 (11%)

Query: 110 FLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENV 169
           +++ EY SG  L+D++       L+E    +    ++ G+A +HA    ++HRD+KIEN+
Sbjct: 218 YMMFEYVSGGQLLDYIIQ--HGSLREPLARSFARAIASGLAYLHANN--VVHRDLKIENI 273

Query: 170 LISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIP-IN 228
           +++   E K+ DFG +  +  P    T             +  + +PE+L   ++ P I 
Sbjct: 274 MLTAAGEIKIIDFG-LSNLFDPRAKLTTY---------CGSLYFAAPELL---RAKPYIG 320

Query: 229 EKSDIWALGVFLYKVCYYTTPFEKEGENA----ILHSRYQYPAYPQYSDNLKNLIRVMLM 284
            + DIW+ GV LY +     PF+ E  NA    I   +  YPA    S    +L+  ML 
Sbjct: 321 PEIDIWSFGVILYVLVVGKVPFDDENSNALHEKIKRGKVSYPA--TLSIECISLLTKMLT 378

Query: 285 VDPSKRPNICQVVEEVSRLQGVP-CPLKNF 313
           V+P +R  + ++V     ++G    P K+F
Sbjct: 379 VNPKRRATLKEIVTHHWMVRGYGNIPAKSF 408

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 86/334 (25%), Positives = 148/334 (44%), Gaps = 51/334 (15%)

Query: 9   YTPGIILPVGSHQAKIL--KYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSL 66
           +  G IL  GS   K+L  ++ T+G  A V  V  S +   + +N + +     PD    
Sbjct: 26  WKLGSILGAGS-AGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIVGSNDPDLLPY 84

Query: 67  NVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMN 126
            + R E+  MKLL N+  V+   D    KS            +++++EY     L + + 
Sbjct: 85  GIER-EIIIMKLL-NHTNVLRLYDVWETKS-----------NLYMVLEYVEKGELFNLLV 131

Query: 127 TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVC 186
            R    L E E +     +  G++  HAL   ++HRD+K EN+L+ +K   K+ DFG   
Sbjct: 132 ER--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA 187

Query: 187 GVIRPPTNQTELDFVQHDILKNTTA---QYRSPEMLSLSKSIPINE-KSDIWALGVFLYK 242
                            D L  T+     Y +PE++S    +P +  +SD+W+ GV LY 
Sbjct: 188 -------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYA 231

Query: 243 VCYYTTPFEKEGEN------AILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQV 296
           +     PF+++  N       +    Y+ P   + S   ++LI  +L VDP +R    ++
Sbjct: 232 LLTGRLPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREI 291

Query: 297 VEEVSRLQGVPCPLKNFYLERAIRQTAVQDNHFN 330
           ++    LQ  P  +K+    ++IR    +D + N
Sbjct: 292 LKH-PLLQKYPS-IKD---SKSIRNLPREDTYLN 320

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 84/283 (29%), Positives = 117/283 (41%), Gaps = 47/283 (16%)

Query: 23  KILKYLTSGGFAQVYQVEISPYDIHSGSNIAC-LKRVIVPDKTSLNVP---RAEVEAMKL 78
           +I K L  G F +VY V       H  S   C LK +   D    N+    R EVE    
Sbjct: 110 EIGKVLGKGKFGRVYCVR------HIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSS 163

Query: 79  LRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEI 138
           LR+      Y   H  K             V+LLMEY     L   +  R       F  
Sbjct: 164 LRHPNLTQLYGYFHDEK------------RVYLLMEYLVNGELYKHLKGR-----SHFND 206

Query: 139 LNIMSHVSQGVAAMHALQPP-LLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTE 197
           +    +V Q   A+  +    +LHRDIK EN++I   N  KL DFG    VI P  ++ +
Sbjct: 207 VVASYYVYQMADALDYMHERNILHRDIKPENIIIGFNNTIKLTDFG--WSVITPKGSKRK 264

Query: 198 LDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGE-- 255
                       T  Y SPE++   +S   NEK D+WALGV  Y++   + PFE+E +  
Sbjct: 265 T--------LCGTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFEEESKEL 313

Query: 256 --NAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQV 296
               IL     +P +       ++LI  +L  DP  R  + +V
Sbjct: 314 TYKRILKRNLIFPDH--VDTEARHLISRLLEYDPGDRIPLKEV 354

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 87/183 (47%), Gaps = 20/183 (10%)

Query: 120  GLIDFMN-TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFK 178
            G ID  +   L+  + EFE   I   V  G+  +H  +  ++HRDIK ENV++ +K   K
Sbjct: 1069 GSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVK 1126

Query: 179  LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEK-SDIWALG 237
            L DFGS   V   P +     FV        T  Y +PE+L      P   K  DIWA+G
Sbjct: 1127 LIDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVLG---GEPYEGKPQDIWAVG 1172

Query: 238  VFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVV 297
            + LY + +   PF    E  I+    ++    + S+   NLI+ +L  +  KRP I  + 
Sbjct: 1173 ILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDIY 1230

Query: 298  EEV 300
            ++V
Sbjct: 1231 DDV 1233

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 97/193 (50%), Gaps = 16/193 (8%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++++MEYC G    D +    +  L E ++  I   + +G+  +H+ +   +HRDIK  N
Sbjct: 105 MWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHSQRK--IHRDIKAAN 162

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           +L+++  + KL DFG    ++      T   FV        T  + +PE+++ S+    N
Sbjct: 163 ILLTDDGKVKLGDFGVSGQMMATRRRDT---FV-------GTPFWMAPEVIARSEQ-GYN 211

Query: 229 EKSDIWALGVFLYKVCYYTTPFEKEGENAILH---SRYQYPAYPQYSDNLKNLIRVMLMV 285
           EK+DIW+LG+ ++++     P  +     +L    SR       +YS  ++  + + L  
Sbjct: 212 EKADIWSLGITVFELLKGQPPLSQHDPMKVLMSIPSRRPPKLEDRYSHAIREFVSLCLNK 271

Query: 286 DPSKRPNICQVVE 298
           DP+KRP   ++++
Sbjct: 272 DPAKRPTASELLK 284

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 98/199 (49%), Gaps = 29/199 (14%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E++L++EY  G  L D++ +R   +L E E ++    + +GV+  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 168 NVLISNKN-EFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTA--QYRSPEMLSLSKS 224
           N+L+  KN + K+ DFG     +  P          + +LK +     Y SPE++     
Sbjct: 244 NLLLDKKNKKIKIADFG--MAALELP----------NKLLKTSCGSPHYASPEIV---MG 288

Query: 225 IPINEK-SDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLI 279
            P +   SD+W+ G+ L+ +     PF  +    +L      +YQ P     S   +NLI
Sbjct: 289 RPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPM--NLSLEARNLI 346

Query: 280 RVMLMVDPSKRPNICQVVE 298
             +L++DP KR    +++E
Sbjct: 347 SKILVIDPEKRITTQEILE 365

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 93/199 (46%), Gaps = 29/199 (14%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E++L++EY  G  L D++ ++   +L E E ++    + Q VA  H     + HRD+K E
Sbjct: 148 ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--ICHRDLKPE 203

Query: 168 NVLISNKNE-FKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTA---QYRSPEMLSLSK 223
           N+L+  K    K+ DFG                    D L  T+     Y SPE++   K
Sbjct: 204 NLLLDKKKRSIKIADFGMAA-------------LETSDKLLETSCGSPHYASPEIVLGRK 250

Query: 224 SIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLI 279
                  SD+W+ G+ L+ +     PF  +    +L      +YQ P +   S   K+LI
Sbjct: 251 YH--GSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW--LSVEAKDLI 306

Query: 280 RVMLMVDPSKRPNICQVVE 298
             +L+VDP++R  I Q+++
Sbjct: 307 SRILVVDPNRRITIDQILQ 325

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 90/188 (47%), Gaps = 23/188 (12%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E++L++EY  G  L D++ +R   RL E E ++    + QGV+  HA    + HRD+K E
Sbjct: 190 ELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAFN--ICHRDLKPE 245

Query: 168 NVLISNKNE-FKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIP 226
           N+L+  KN   K+ DFG     +     QT             +  Y SPE++ + K   
Sbjct: 246 NLLLDKKNSTIKIADFGMAALEVSNKLLQTSCG----------SPHYASPEIV-MGKQYH 294

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLIRVM 282
               SD+W+ G+ L+ +     PF  +    +L      +YQ P     S   ++LI  +
Sbjct: 295 -GGPSDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMPQ--NLSKEAQDLIAKI 351

Query: 283 LMVDPSKR 290
           L V+P+KR
Sbjct: 352 LTVNPAKR 359

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 99/192 (51%), Gaps = 16/192 (8%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++++ME+C G    D +    ++RL E ++  I+  V  G+  +H+ +   +HRDIK  N
Sbjct: 110 MWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAAN 167

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           +L+++  E KL DFG V G I     +T   FV        T  + +PE+++  K    N
Sbjct: 168 ILLTDDGEVKLGDFG-VSGQIMATLKRT--TFV-------GTPYWMAPEIIA-KKDNGYN 216

Query: 229 EKSDIWALGVFLYKVCYYTTPFEKEGENAILHS---RYQYPAYPQYSDNLKNLIRVMLMV 285
           EK+DIW+LG+   ++     P+ K     +L +   R       +++ + ++ I + L+ 
Sbjct: 217 EKADIWSLGITAIELLTGQPPYAKHDPMKVLVNIPLRKPPKLQGRFTGSARDFIALCLIK 276

Query: 286 DPSKRPNICQVV 297
           DP  RP+  +++
Sbjct: 277 DPDLRPSAAELL 288

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 98/201 (48%), Gaps = 31/201 (15%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           + +++EY SG     ++  + + RLKE     + + +  GV  MH+    L+HRD+K+EN
Sbjct: 124 IGIVLEYASGGEFYRYI--QRKRRLKETAGCRLFTQLVSGVNYMHS--KGLVHRDLKLEN 179

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ--YRSPEMLSLSKSIP 226
           +L+       + DFG V   ++            +D++K +     Y +PE++  +K   
Sbjct: 180 LLLDKHENLVITDFGFVNEFLK-----------DNDLMKTSCGSPCYAAPELVISTKPYE 228

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEGENA-----------ILHSRYQYPAYPQYSDNL 275
              K+DIW+ G+ LY +     P++ + +N            I  +  ++P Y   S   
Sbjct: 229 A-RKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFITRTSLKFPEY--ISPIP 285

Query: 276 KNLIRVMLMVDPSKRPNICQV 296
           ++L+R +L+ DP KR NI Q+
Sbjct: 286 RDLLRRLLVSDPRKRLNIRQI 306

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 128/297 (43%), Gaps = 47/297 (15%)

Query: 5   EIPLYTPGIILPVGSHQAKILKY-LTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDK 63
           +I  +  G  L +GS     L Y  T+G  A +   ++    I   SN+  +     PD 
Sbjct: 14  QIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAI---KVISKTIFQDSNVTSMVDNTTPDA 70

Query: 64  TSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLID 123
               + R E+  MKLL N+  V+   D     S            +++++EY     L +
Sbjct: 71  LPYGIER-EIVIMKLL-NHANVLRLYDVWETNS-----------NLYMVLEYAEKGELFN 117

Query: 124 FMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFG 183
            +  R    L E E +     +  G++  HAL   ++HRD+K EN+L+  K   K+ DFG
Sbjct: 118 LLVER--GPLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDTKYNIKIADFG 173

Query: 184 SVCGVIRPPTNQTELDFVQHDILKNTTA---QYRSPEMLSLSKSIPINE-KSDIWALGVF 239
                               D L  T+     Y +PE++S    IP +   SD+W+ GV 
Sbjct: 174 MAA-------------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVI 217

Query: 240 LYKVCYYTTPFEKEGEN------AILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKR 290
           LY +     PF++E  N       +   +++ P   + S   +NLI  +L+V+P++R
Sbjct: 218 LYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAER 274

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 100/196 (51%), Gaps = 25/196 (12%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E++L++EY  G  L D++ ++   +L E E ++  + + QGV+  H+    + HRD+K E
Sbjct: 200 ELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPE 255

Query: 168 NVLISNKNE-FKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIP 226
           N+L+  KN+  K+ DFG     +  P    E            +  Y SPE++ + K  P
Sbjct: 256 NLLLDKKNKVIKIADFG--MAALELPNKLLETSC--------GSPHYASPEIV-MGK--P 302

Query: 227 INEK-SDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLIRV 281
            +   SD+W+ G+ L+ +     PF  +    +L      R+Q P Y   +++ K+LI  
Sbjct: 303 YHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPY--LTNDAKDLITR 360

Query: 282 MLMVDPSKRPNICQVV 297
           +L+ +P KR  I +++
Sbjct: 361 ILVTNPEKRLTINEIL 376

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 94/194 (48%), Gaps = 24/194 (12%)

Query: 105 GSY----EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLL 160
           GSY     +++LMEYC+G  L   +      ++ E  I  IM  +   +  +H     ++
Sbjct: 87  GSYLKDTSLWILMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKCIHKDN--VI 141

Query: 161 HRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLS 220
           HRDIK  NVLI+N+   KLCDFG    V     NQT L   +   +   T  + +PE+  
Sbjct: 142 HRDIKAANVLITNEGSVKLCDFGVAAQV-----NQTSL---RRQTMAG-TPYWMAPEV-- 190

Query: 221 LSKSIPINEKSDIWALGVFLYKVCYYTTPF-EKEGENA---ILHSRYQYPAYPQYSDNLK 276
           + + +  + K DIW+LG+  Y++     P+ + E   A   I+ S+        YS +LK
Sbjct: 191 IMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEGRSYSSSLK 250

Query: 277 NLIRVMLMVDPSKR 290
             I + L  DP +R
Sbjct: 251 EFIALCLDEDPKER 264

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 96/210 (45%), Gaps = 48/210 (22%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       LKE         ++  +  +H+    ++HRD+K
Sbjct: 203 SNHFYMLFEYVSGGQLLDYIIQ--HGSLKEHHARKFARGIASALQYLHSNN--IVHRDLK 258

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS+  E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 259 IENIMISSSGEIKIIDFGLSNIFDYRKQLHTFCG---------SLYFAAPELLK--AQPY 307

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQ-----YPAY 268
             PE+             DIW+ G+ LY +     PF+ E  ++ILH + +     YP++
Sbjct: 308 TGPEV-------------DIWSFGIVLYVLVCGKVPFDDEN-SSILHEKIKKGKVDYPSH 353

Query: 269 PQYSDNLKNLIRVMLMVDPSKRPNICQVVE 298
              S    +L+  M++VDP +R  +  VV+
Sbjct: 354 --LSIEAISLLTKMIVVDPLRRATLKTVVD 381

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 101/193 (52%), Gaps = 16/193 (8%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++++MEYC G    D +     N + E ++  I S V +G+  +H  +   +HRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLHEQKK--IHRDIKAAN 143

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           +L++++   KL DFG V G IR    +    FV        T  + +PE++S  ++   +
Sbjct: 144 ILLTDEGTVKLGDFG-VSGQIRATLKRGT--FV-------GTPYWMAPEVVS-KENDGYD 192

Query: 229 EKSDIWALGVFLYKVCYYTTPFEKEGENAILHS--RYQYPA-YPQYSDNLKNLIRVMLMV 285
           EK+DIW+LG+ +Y++     P  K     ++ +  + + PA +  YS + KN +   L+ 
Sbjct: 193 EKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPALHGHYSHSAKNFVSSCLVK 252

Query: 286 DPSKRPNICQVVE 298
           +P  R +  ++VE
Sbjct: 253 NPVGRASAYEMVE 265

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 106/202 (52%), Gaps = 25/202 (12%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           + +++EY SG     ++  + + RLKE +   I + +  GV+ +H+    L+HRD+K+EN
Sbjct: 151 IGIVLEYASGGEFYKYI--KFKKRLKESKACTIFAQLISGVSYIHS--KGLVHRDLKLEN 206

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           +L+       + DFG V  V       T+ + + H    +    Y +PE+++  +  P N
Sbjct: 207 LLLDKAGNLLITDFGFVNEV-------TKTNKLMHTPCGSPC--YAAPELVTSVE--PYN 255

Query: 229 -EKSDIWALGVFLYKVCYYTTPFEKE-----GENAILHSRY---QYPAYPQYSDNL-KNL 278
             K+DIW+ GV LY +     P++ +     G + +   +Y   Q   +P+Y + + ++L
Sbjct: 256 ARKADIWSCGVILYAMLAGYLPWDDDPKNINGTDIVKLYKYIENQPLKFPEYINMVPRDL 315

Query: 279 IRVMLMVDPSKRPNICQVVEEV 300
           +R ML +DP+KR ++  +++  
Sbjct: 316 LRRMLEIDPAKRMSMKHILQHA 337

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 100/227 (44%), Gaps = 44/227 (19%)

Query: 106 SYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIK 165
           S   ++L EY SG  L+D++       L+E      +  ++  +  +H     ++HRD+K
Sbjct: 194 SNHFYMLFEYVSGGQLLDYIIQ--HGSLRERHARKFVRGIASALQYLHLNN--IVHRDLK 249

Query: 166 IENVLISNKNEFKLCDFG------------SVCGVIRPPTNQTELDFVQHDILKNTTAQY 213
           IEN++IS   E K+ DFG            + CG          L F   ++LK     Y
Sbjct: 250 IENIMISTSGEIKIIDFGLSNLYDNKKQLHTFCG---------SLYFAAPELLKANP--Y 298

Query: 214 RSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYP--AYPQY 271
             PE+             DIW+ GV +Y +     PF+ E   ++LH + +     YPQ+
Sbjct: 299 IGPEV-------------DIWSFGVVIYVLVCGKVPFDDENA-SVLHEKIKKGKVEYPQH 344

Query: 272 -SDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLER 317
            S    +L+  ML+VDP KR ++ QV       +G   P  ++   R
Sbjct: 345 LSIECISLLSKMLVVDPLKRASLKQVCNHQWMQRGFDFPPPSYIPHR 391

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 95/200 (47%), Gaps = 29/200 (14%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           + +++EY SG     ++  +   RLKE     + S +  GV  MH+    L+HRD+K+EN
Sbjct: 135 IGIVLEYASGGEFYKYIQRK--RRLKEVNASRLFSQLVSGVHYMHSKG--LVHRDLKLEN 190

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ---YRSPEMLSLSKSI 225
           +L+       + DFG V             +F   ++L  T+     Y +PE++ +S+  
Sbjct: 191 LLLDKNENLMITDFGFVN------------EFSNENVLMKTSCGSPCYAAPELV-VSREA 237

Query: 226 PINEKSDIWALGVFLYKVCYYTTPFEKEGENA---ILHSRYQYPA-----YPQYSDNL-K 276
            +  K DIW+ GV LY +     P++ +  N     +   Y Y       +P Y + L +
Sbjct: 238 YVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGDDISKLYSYITATPLKFPDYVNPLPR 297

Query: 277 NLIRVMLMVDPSKRPNICQV 296
           +L+R +L+ DP +R  +  +
Sbjct: 298 DLLRRILVADPRRRYTLGHI 317

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/196 (30%), Positives = 96/196 (48%), Gaps = 26/196 (13%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++ ++EY SG  L+  +  RL  RL E    +I + +   V  MH+    ++HRD+K EN
Sbjct: 87  LYFVLEYVSGGELLALIQ-RL-GRLTEDLSRHITAQLVDTVDYMHS--KGVIHRDLKPEN 142

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTE--LDFVQHDILKNTTAQYRSPEMLSLSKSIP 226
           VL+S +    + DFG+ C         T+    FV        TA+Y SPE+L  S+   
Sbjct: 143 VLLSQEGRVVITDFGAACTAADRKFENTKRTASFV-------GTAEYVSPELLLHSQ--- 192

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEGE------NAILHSRYQYPAYPQYSDNLKNLIR 280
               SDIWALG  +Y++     PF  E E         L  ++ +   PQ    + ++++
Sbjct: 193 CGFSSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKWLFSNSPQ----VVSIVQ 248

Query: 281 VMLMVDPSKRPNICQV 296
            +L+ DP KRP+  Q+
Sbjct: 249 SILVTDPLKRPSAAQL 264

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 107/213 (50%), Gaps = 29/213 (13%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           + +++EY SG     ++  +   RLKE     + + +  GV  MH+    L+HRD+K+EN
Sbjct: 123 IGIVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHSKG--LVHRDLKLEN 178

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ--YRSPEMLSLSKSIP 226
           +L+       + DFG V           E +  +++++K +     Y +PE++  +K   
Sbjct: 179 LLLDKNENLLITDFGFV----------NEFNH-KNELMKTSCGSPCYAAPELVVTTKPYE 227

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEGEN-------AILHSRYQYP-AYPQYSDNL-KN 277
              K+DIW+ GV +Y +     P++ + EN        + H   + P  +P+Y + + ++
Sbjct: 228 A-RKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPEYINPVPRD 286

Query: 278 LIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPL 310
           L+R +L+ +P KR N+ Q VE+   LQ   CP 
Sbjct: 287 LLRRILVSNPKKRLNLRQ-VEQHQWLQPH-CPF 317

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/253 (28%), Positives = 120/253 (47%), Gaps = 46/253 (18%)

Query: 64  TSLNVPRAEVEAMKLLRNN-------KYVVSYIDSHAAKSRPAPGV-------PNGSYEV 109
           +SL VP+    A+KL+R +       K V  Y + +A K    P +        N  Y +
Sbjct: 63  SSLEVPKQV--AIKLIRRDSIPKNSEKEVKIYREINALKHLSHPNIVKLEEVLQNSKY-I 119

Query: 110 FLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENV 169
            +++EY SG     ++  +   RLKE     + + +  GV  MH+    L+HRD+K+EN+
Sbjct: 120 GIVLEYASGGEFYKYIQRK--RRLKEAIACRLFAQLVSGVNYMHSKG--LVHRDLKLENL 175

Query: 170 LISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ---YRSPEMLSLSKSIP 226
           L+       + DFG V             +FV H+ L  T+     Y +PE++  +K   
Sbjct: 176 LLDKHENLVITDFGFVN------------EFVSHNELMKTSCGSPCYAAPELVVSTKPYE 223

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEGENA----ILHSRY---QYP-AYPQYSDNL-KN 277
              KSD+W+ GV LY +     P++ + +N     I+   Y   + P  +P+Y   L ++
Sbjct: 224 A-RKSDVWSCGVILYAMLAGYLPWDDDPKNPDGNDIVRLYYYITRTPLKFPEYITPLSRD 282

Query: 278 LIRVMLMVDPSKR 290
           L+R +L+ DP KR
Sbjct: 283 LLRRILVSDPKKR 295

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 92/190 (48%), Gaps = 24/190 (12%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           +++L++EY     L + +  R    L E E +     +  GV+  HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPEHEAIRFFRQIIIGVSYCHAL--GIVHRDLKPE 160

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           N+L+ +K   K+ DFG           +TE   ++       +  Y +PE++S    IP 
Sbjct: 161 NLLLDHKYNIKIADFGMAAL-------ETEGKLLETSC---GSPHYAAPEIVS---GIPY 207

Query: 228 NE-KSDIWALGVFLYKVCYYTTPFEKEGEN------AILHSRYQYPAYPQYSDNLKNLIR 280
               SD+W+ GV L+ +     PF++E  N       +    ++ P+  + S   ++LIR
Sbjct: 208 QGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIR 267

Query: 281 VMLMVDPSKR 290
            +L VDP +R
Sbjct: 268 KILTVDPERR 277

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 97/200 (48%), Gaps = 27/200 (13%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           + +++EY SG     ++  +   RLKE     + + +  GV  MH+    L+HRD+K+EN
Sbjct: 120 IGIVLEYASGGEFYKYIQKK--RRLKESAACRLFAQLISGVYYMHSKG--LVHRDLKLEN 175

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ--YRSPEMLSLSKSIP 226
           +L+       + DFG V   +  P N         +++K +     Y +PE++  ++   
Sbjct: 176 LLLDKNENLLITDFGFVNEFL--PEN---------ELMKTSCGSPCYAAPELVVTARPYE 224

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEGENA---ILHSRYQYPA-----YPQYSDNL-KN 277
              K+DIW+ GV +Y +     P++ + EN     +   Y+Y       +P Y   + ++
Sbjct: 225 A-RKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPDYIAPVPRD 283

Query: 278 LIRVMLMVDPSKRPNICQVV 297
           L+R +L+ DP KR  I Q +
Sbjct: 284 LLRAILVADPKKRITIAQTL 303

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 80/179 (44%), Gaps = 20/179 (11%)

Query: 120  GLIDFMN-TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFK 178
            G ID  +   L+N + E E+  I   +  G+  +H     ++HRDIK ENV++      K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 179  LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEK-SDIWALG 237
            L DFGS   V   P +     FV        T  Y +PE+LS     P   K  DIWA+G
Sbjct: 1330 LIDFGSAAHVKSGPFDV----FV-------GTIDYAAPEVLS---GDPYEGKPQDIWAIG 1375

Query: 238  VFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQV 296
            + LY + +   PF    E  IL     +      S   K LI ++L  +  KRP I  +
Sbjct: 1376 ILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTIDDI 1432

>TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.92
           YDR490C
          Length = 819

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 111/234 (47%), Gaps = 28/234 (11%)

Query: 78  LLRNNKYVVSYIDSHA-AKSRPAPGVP--NGSYE----VFLLMEYCSGKGLIDFMNTRLQ 130
           LLR  K   + ++  A  + R  PGV   + +++    ++ ++EY     L+  +  R  
Sbjct: 181 LLRERKAKYAALEKAALVRLRDCPGVVRLHATFQDRESLYFVLEYAPHGDLLALL--RRH 238

Query: 131 NRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIR 190
             L      +  + +   + A+H++   ++HRDIK ENVL+ +    KL DFG+   +  
Sbjct: 239 GSLSRAVTCHYAAQLLSAIGALHSVG--VIHRDIKPENVLLDSHYRAKLTDFGTAALL-- 294

Query: 191 PPTNQTELDFVQHDILKN--TTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTT 248
            P   + L+ V   +  +   TA+Y  PE+L+   +   +   D+WA    ++++     
Sbjct: 295 -PQTHSNLEQVSRHVTTSFVGTAEYVPPELLAAGHA---DGTCDLWAWACVVFQLIAGRP 350

Query: 249 PFEKEGE----NAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKR---PNICQ 295
           PF+   E      ++  RY YP  P +  +LK+L+R +L  +P +R   P I Q
Sbjct: 351 PFQARNEFLTFQNVMAVRYTYP--PGFPSDLKDLLRRVLRHEPRQRLLQPQITQ 402

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/301 (25%), Positives = 131/301 (43%), Gaps = 48/301 (15%)

Query: 9   YTPGIILPVGSHQAKILKY-LTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLN 67
           +  G  L VGS    ++ Y  T G  A V  +  S ++    + I        PD     
Sbjct: 17  WKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGND----PDVLPYG 72

Query: 68  VPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNT 127
           + R E+  MKLL N+  V+   D           V   S ++++++EY     L + +  
Sbjct: 73  IER-EIIIMKLL-NHPNVLRLYD-----------VWETSKDLYMVLEYVEKGELFNLLVE 119

Query: 128 RLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCG 187
           R    L E E +     +  G++  HAL   ++HRD+K EN+L+ +K   KL DFG    
Sbjct: 120 R--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNVKLADFGMAA- 174

Query: 188 VIRPPTNQTELDFVQHDILKNTTA---QYRSPEMLSLSKSIPINE-KSDIWALGVFLYKV 243
                           D L  T+     Y +PE++S    +P +  +SD+W+ GV LY +
Sbjct: 175 ------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYAL 219

Query: 244 CYYTTPFEKEGEN------AILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVV 297
                PF++E  N       +   +++ P   + S   ++LI  +L VDP +R    +++
Sbjct: 220 LTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREIL 279

Query: 298 E 298
           +
Sbjct: 280 K 280

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 130/279 (46%), Gaps = 35/279 (12%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++     I +   +A  K  I  +KT   +  +E++  K +R+   +V
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVA--KISIKSEKTRKKL-LSEIQIHKSMRHTN-IV 139

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            ++D     +            V++L+E C    L+D +  R    L E E+    + + 
Sbjct: 140 QFVDCFEDDT-----------NVYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIV 186

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             V  MH+ +  ++HRD+K+ N+        K+ DFG +  V+    N  E  +      
Sbjct: 187 GAVKYMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFG-LAAVL---ANDRERKYTV---- 236

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSR---- 262
              T  Y +PE+L+  K    + + DIW+ GV +Y +     PF+ +  N I++ R    
Sbjct: 237 -CGTPNYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVN-IIYERIKCG 293

Query: 263 -YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
            + +P     S     LI+ +L +DP +RP++ ++++ V
Sbjct: 294 DFVFPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 88/193 (45%), Gaps = 33/193 (17%)

Query: 105  GSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDI 164
            GS ++F L+E+ S               + EFEI  +   V  GV  +H     ++HRDI
Sbjct: 1213 GSIDLFDLIEFTSN--------------MTEFEIKLLFKQVVSGVKHLH--DQGIVHRDI 1256

Query: 165  KIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKS 224
            K EN+++ NK   K+ DFGS   V   P +     FV        T  Y +PE+L  +  
Sbjct: 1257 KDENIIVDNKGFIKIIDFGSAAYVKSGPFDV----FVG-------TIDYAAPEVLGGN-- 1303

Query: 225  IPINEK-SDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVML 283
             P   K  DIWALG+ LY + +   PF    E  IL    ++      S +   LI+++L
Sbjct: 1304 -PYEGKPQDIWALGILLYTIVFKENPFYNIDE--ILEGDLKFNDPENISQDCIELIKLIL 1360

Query: 284  MVDPSKRPNICQV 296
              +  KRP I  +
Sbjct: 1361 NRNVFKRPTIDDI 1373

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 86/182 (47%), Gaps = 20/182 (10%)

Query: 120  GLIDFMN-TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFK 178
            G ID  +    +  + EFE   I   V  G+  +H     ++HRDIK ENV++ +K   K
Sbjct: 1243 GCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVK 1300

Query: 179  LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEK-SDIWALG 237
            + DFGS   V   P +     FV        T  Y +PE+LS     P   K  DIWALG
Sbjct: 1301 IIDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVLS---GEPYEGKPQDIWALG 1346

Query: 238  VFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVV 297
            + LY + +   PF    E  IL    ++ +  + +++   LI+ +L+     RP I ++ 
Sbjct: 1347 ILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEIF 1404

Query: 298  EE 299
            ++
Sbjct: 1405 DD 1406

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 110/235 (46%), Gaps = 47/235 (20%)

Query: 78  LLRNNKY--VVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKE 135
           ++R +K+  +V++IDS+ AK            +++++MEY  G  L D +   L   L E
Sbjct: 668 VMRESKHSNIVNFIDSYLAKG-----------DLWIVMEYMEGGSLTDVVTHCL---LSE 713

Query: 136 FEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQ 195
            +I  +     +G+  +H+    +LHRDIK +N+L+S K   KL DFG  C  I      
Sbjct: 714 GQIGAVCRETLKGLQFLHSKG--VLHRDIKSDNILLSLKGNIKLTDFG-FCAQI------ 764

Query: 196 TELDFVQHDILKNTTA----QYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFE 251
                   + LK TT      + +PE++S  +  P   K DIW+LG+ + ++     P+ 
Sbjct: 765 ------NENNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYL 815

Query: 252 KEGENAILH-------SRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEE 299
            E     L+        + + P     SD L   +   L VDPS+R    +++++
Sbjct: 816 NETPLRALYLIATNGTPKLKEPE--ALSDTLTKFLDWCLKVDPSERATATELLDD 868

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 122/279 (43%), Gaps = 45/279 (16%)

Query: 28  LTSGGFAQV---YQVEISPYDIHSGSNIACLKRVIVPDKTSLNVP-RAEVEAMKLLRNNK 83
           L  G F +V   +    SP ++     I  ++R  +P  +   +    E+ A+K L    
Sbjct: 50  LGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRRDTIPKNSDKEIKIYREINALKHL---- 105

Query: 84  YVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMS 143
                  SH    +    + N  Y + +++EY SG     ++  +   RLKE     + +
Sbjct: 106 -------SHPNIVKLEEVLQNSKY-IGIVLEYASGGEFYKYIQKK--RRLKEAVACRLFA 155

Query: 144 HVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQH 203
            +  GV  MH+    L+HRD+K+EN+L+       + DFG V             +F  H
Sbjct: 156 QLISGVQYMHSKG--LVHRDLKLENLLLDKHENLVITDFGFVN------------EFFAH 201

Query: 204 DILKNTTAQ---YRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENA--- 257
             L  T+     Y +PE++  SK      K+DIW+ GV LY +     P++ + +N    
Sbjct: 202 SELMKTSCGSPCYAAPELVVSSKPYEA-RKADIWSCGVILYAMLAGYLPWDDDTKNPDGN 260

Query: 258 ILHSRYQYPA-----YPQYSDNL-KNLIRVMLMVDPSKR 290
            +   YQY       +P+Y   L ++L+R +L  DP +R
Sbjct: 261 DIGKLYQYITRTPLKFPEYITPLPRDLLRRILYPDPKRR 299

>TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.591
           YDR466W
          Length = 694

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 94/197 (47%), Gaps = 29/197 (14%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPP-LLHRDIKIE 167
           ++ +++Y  G  L+  ++     R+K F  +       Q + +M  L    ++HRD+K E
Sbjct: 89  LYFVLDYAPGGELLSLLH-----RMKTFSEMWACHFTCQLIDSMQFLHSQGIIHRDLKPE 143

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           N+L++N+    + DFG+  G     T+     FV        TA+Y SPE+L  ++    
Sbjct: 144 NLLLNNEGRLMITDFGTATG-----TDSRGSSFV-------GTAEYVSPELLLHNQC--- 188

Query: 228 NEKSDIWALGVFLYKVCYYTTPFEKEGENAILHS--RYQYPA-YPQYSDN-----LKNLI 279
           +  SDIWALG  +Y+    + PF  E E           YP   PQ +       + +L 
Sbjct: 189 DVSSDIWALGCMIYQFLQGSPPFRGENELQTFEKTVSLDYPWNNPQVTPKGINPVVVDLT 248

Query: 280 RVMLMVDPSKRPNICQV 296
           R +L++DPS RP + Q+
Sbjct: 249 RRILVLDPSVRPTLQQI 265

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 133/297 (44%), Gaps = 38/297 (12%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNV 68
           +  G  L +GS     L Y +S G     +V IS    ++ +  A    ++ PD     +
Sbjct: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKV-ISKAVFNNDNANASDSALLTPDSLPYGI 78

Query: 69  PRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTR 128
            R E+  MKLL N+  V+   D     S            +++++EY     L + +  R
Sbjct: 79  ER-EIIIMKLL-NHPNVLRLYDVWETDS-----------NLYMVLEYAEKGELFNLLVER 125

Query: 129 LQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGV 188
               L E E +     +  G++  HAL   ++HRD+K EN+L+ +K   K+ DFG     
Sbjct: 126 --GPLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAAL- 180

Query: 189 IRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINE-KSDIWALGVFLYKVCYYT 247
                 +TE   ++       +  Y +PE++S    +P +  ++D+W+ G+ L+ +    
Sbjct: 181 ------ETEDKLLETSC---GSPHYAAPEIIS---GLPYHGLETDVWSCGIILFALLTGR 228

Query: 248 TPFEKEGEN------AILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVE 298
            PF++E  N       +   +++ P   + S   ++LI  +L VDP KR    ++++
Sbjct: 229 LPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 95/194 (48%), Gaps = 24/194 (12%)

Query: 105 GSY----EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLL 160
           GSY     ++++MEYC+G  L   +      ++ E  I  IM  +   +  +H  +  ++
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKCIH--KDNVI 141

Query: 161 HRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLS 220
           HRDIK  NVLI+N+   KLCDFG    V     NQT L   +   +   T  + +PE+  
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQV-----NQTSL---RRQTMAG-TPYWMAPEV-- 190

Query: 221 LSKSIPINEKSDIWALGVFLYKVCYYTTPF-EKEGENA---ILHSRYQYPAYPQYSDNLK 276
           + + +  + K DIW+LG+  Y++     P+ + E   A   I+ S+        YS +LK
Sbjct: 191 IMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEGRSYSPSLK 250

Query: 277 NLIRVMLMVDPSKR 290
             I + L  DP +R
Sbjct: 251 EFIALCLDEDPKER 264

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 93/190 (48%), Gaps = 11/190 (5%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++ L+EYC     +  M  +    L E       + V   +  +H     ++HRDIK EN
Sbjct: 253 LYFLLEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDYLHT--NGIIHRDIKPEN 308

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           +L+  + + KL DFG+   ++   TN  + D +        TA+Y +PE+L+ S    ++
Sbjct: 309 ILLDKEFKIKLTDFGT-AKILDSSTNN-KFDLLTRSKSFVGTAEYVAPELLNDSF---VD 363

Query: 229 EKSDIWALGVFLYKVCYYTTPFEKEGENAILHS--RYQYPAYPQYSDNLKNLIRVMLMVD 286
            + D+WA G  LY++     PF+   E        + QY     +   +++L++ +L+ D
Sbjct: 364 YRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLIIRDLVKKILVKD 423

Query: 287 PSKRPNICQV 296
            ++RP+I Q+
Sbjct: 424 LNQRPSISQI 433

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 97/201 (48%), Gaps = 19/201 (9%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++ L+EY      +  +  +    L E       S +   V ++H++   ++HRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNEICARYYASQIIDAVDSLHSIG--IIHRDIKPEN 254

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTE----LDFVQHDILKNTTAQYRSPEMLSLSKS 224
           +L+    + KL DFG+   +   P+N  +     D          TA+Y SPE+L+ S +
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSKSFVGTAEYVSPELLNDSYT 314

Query: 225 IPINEKSDIWALGVFLYKVCYYTTPFEKEGE----NAILHSRYQYPA-YPQYSDNLKNLI 279
              + + DIWA G  LY++     PF+   E      ++  +Y + A +PQ    +K+L+
Sbjct: 315 ---DSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQI---VKDLV 368

Query: 280 RVMLMVDPSKRPNICQVVEEV 300
           + +L+ DP+ R  I Q+   V
Sbjct: 369 KKLLVRDPNDRLAIEQIKAHV 389

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 96/193 (49%), Gaps = 19/193 (9%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           V++ +EYC G  L D++   L+ R+   E   + + +   V   H+LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           +L+       L DF    G  R    +T+L+ V        T  Y +PE+  + +     
Sbjct: 159 ILLDKNGYAMLTDF----GFTRECATKTQLETV------CGTTVYMAPEL--IKREAYDG 206

Query: 229 EKSDIWALGVFLYKVCYYTTPF-EKEGENAILHSRYQYPA-YPQY-SDNLKNLIRVMLMV 285
            K D W+LG+ LY + +   PF E +     L   ++ PA   +Y S   K+LI  +L  
Sbjct: 207 YKVDTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLLDK 266

Query: 286 DPSKRPNICQVVE 298
           + ++RPN+ +V++
Sbjct: 267 NAAQRPNLNEVLQ 279

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 89/192 (46%), Gaps = 30/192 (15%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           +++++EY     L + +  R    L E E +     +  G++  HAL   ++HRD+K EN
Sbjct: 107 LYMVLEYAQKGELFNLLVER--GPLPEKEAIRFFRQIVIGISYCHALG--IVHRDLKPEN 162

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTA---QYRSPEMLSLSKSI 225
           +L+ +K   K+ DFG                    D L  T+     Y +PE++S    I
Sbjct: 163 LLLDHKFNIKIADFGMAA-------------LETEDKLLETSCGSPHYAAPEIVS---GI 206

Query: 226 PINE-KSDIWALGVFLYKVCYYTTPFEKEGEN------AILHSRYQYPAYPQYSDNLKNL 278
           P +   SD+W+ GV L+ +     PF+ E  N       +   RY+ P   + S + ++L
Sbjct: 207 PYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMPGDDEISPDAQDL 266

Query: 279 IRVMLMVDPSKR 290
           I  +L VDP +R
Sbjct: 267 IARILTVDPEQR 278

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 97/193 (50%), Gaps = 21/193 (10%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           V++++EYCSG  L + +    + RL   E   + S ++  V   H L+   +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLK--EQRLSLEESKKLFSQIASAVYYAHELK--CVHRDLKLEN 158

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           VL+      KL DF    G  R    +++L+ +        T  Y +PE+  + +     
Sbjct: 159 VLLDGNGHAKLTDF----GFTREMATRSQLETI------CGTTVYMAPEL--IERKCYDG 206

Query: 229 EKSDIWALGVFLYKVCYYTTPFEKEGEN----AILHSRYQYPAYPQYSDNLKNLIRVMLM 284
            K DIW+LG+ LY +     PF+++ +      I++    +      SD+  +LI+ ML 
Sbjct: 207 FKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQ-EWISDDAIDLIQGMLR 265

Query: 285 VDPSKRPNICQVV 297
            +P++R ++ QV+
Sbjct: 266 KNPNERISLAQVL 278

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 94/195 (48%), Gaps = 23/195 (11%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E+FL++EY  G  L D++ +R   +L E E ++    + +GV+  H+    + HRD+K E
Sbjct: 193 ELFLVLEYVDGGELFDYLVSR--GKLSEREAVHYFKQIIEGVSYCHSFN--ICHRDLKPE 248

Query: 168 NVLISNK-NEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIP 226
           N+L+  K N  K+ DFG     +  P            +    +  Y SPE++ + KS  
Sbjct: 249 NLLLDKKINTIKIADFG--MAALELPNKLL--------VTSCGSPHYASPEIV-MGKSYH 297

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLIRVM 282
               SD+W+ G+ L+ +     PF  +    +L      ++Q P     S   ++LI  +
Sbjct: 298 -GSPSDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKFQMPQ--NISLEAEDLISRI 354

Query: 283 LMVDPSKRPNICQVV 297
           L+VDP KR  I  ++
Sbjct: 355 LVVDPEKRIQINDIL 369

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 90/202 (44%), Gaps = 33/202 (16%)

Query: 100  PGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPL 159
            P    GS ++F ++E+ S               + EFE   I   +  G+  +H     +
Sbjct: 1033 PHGQTGSVDLFDIIEFKSN--------------MTEFEAKLIFKQIVSGIKHLH--DQGI 1076

Query: 160  LHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEML 219
            +HRDIK ENV++ +K   KL DFGS   V   P +     FV        T  Y +PE+L
Sbjct: 1077 VHRDIKDENVIVDSKGFVKLIDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVL 1125

Query: 220  SLSKSIPINEKS-DIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNL 278
              +   P   KS DIWA+G+ LY + Y   PF    E  IL    ++      S   K L
Sbjct: 1126 GGN---PYEGKSQDIWAIGILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKAL 1180

Query: 279  IRVMLMVDPSKRPNICQVVEEV 300
            I  +L     KRP I ++ ++V
Sbjct: 1181 ITKILNRCVRKRPTIDEICQDV 1202

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 101/197 (51%), Gaps = 25/197 (12%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQ-NRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKI 166
           +V++ +EYC G+ L D +   LQ  R+   E + + S +   V   H+L    +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKL 165

Query: 167 ENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIP 226
           EN+L+      KL DF    G  R    +  L+ +        T  Y +PE   L++  P
Sbjct: 166 ENILLDKDGNAKLTDF----GFTRECMEKVNLETI------CGTTVYMAPE---LTERKP 212

Query: 227 INE-KSDIWALGVFLYKVCYYTTPFEKEGEN----AILHSRYQYPAYPQYSDNLKNLIRV 281
            +  K DIW+LGV LY +   + PF+++ E      I++   +Y +    ++  ++L+R 
Sbjct: 213 YDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEYNSKFMTAEG-EDLVRK 271

Query: 282 MLMVDPSKRPNICQVVE 298
           +L  D + RP++ ++++
Sbjct: 272 LLQKDSNLRPSVREILQ 288

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 95/194 (48%), Gaps = 24/194 (12%)

Query: 105 GSY----EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLL 160
           GSY     ++++MEYC+G  L   +      ++ E  I  IM  +   +  +H  +  ++
Sbjct: 80  GSYLRGTSLWIIMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKVIH--KDNVI 134

Query: 161 HRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLS 220
           HRDIK  NVLI+N+ + KLCDFG    +     NQT L   +   +   T  + +PE+  
Sbjct: 135 HRDIKAANVLITNEGQVKLCDFGVAAQL-----NQTSL---RRQTMAG-TPYWMAPEV-- 183

Query: 221 LSKSIPINEKSDIWALGVFLYKVCYYTTPF-EKEGENA---ILHSRYQYPAYPQYSDNLK 276
           + + +  + K DIW+LG+  Y++     P+ + E   A   I+ S+        Y+  LK
Sbjct: 184 IMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLK 243

Query: 277 NLIRVMLMVDPSKR 290
             I + L  DP +R
Sbjct: 244 EFIALCLDEDPQER 257

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 105/217 (48%), Gaps = 18/217 (8%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQP-PLLHRDIKIE 167
           ++ L+EY S   L+  +      +   F+  + +   +Q + ++H +    ++HRDIK E
Sbjct: 334 LYFLLEYASNGDLLTLLK-----KYGSFDETSTIYFTAQIIDSIHYIHSMGIIHRDIKPE 388

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNT-----TAQYRSPEMLSLS 222
           N+L++   + KL DFG+   ++ P            ++L+ +     TA+Y SPE+L+ S
Sbjct: 389 NILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDS 447

Query: 223 KSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHS--RYQYPAYPQYSDNLKNLIR 280
            +   + + DIWA G  L+++     PF+   E        + QY     +   L++LI+
Sbjct: 448 YT---DSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILRDLIK 504

Query: 281 VMLMVDPSKRPNICQVVEEV-SRLQGVPCPLKNFYLE 316
            +L+ +P+ R  I Q+   +  R +    P   +YL+
Sbjct: 505 KILIKNPNNRLTIHQIKSHLFYRSKDFSNPWNIWYLD 541

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 113/236 (47%), Gaps = 39/236 (16%)

Query: 72  EVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQN 131
           E+ A+KLL           SH    +    + N  Y + +++EY SG     ++  +   
Sbjct: 112 EINALKLL-----------SHPNIVKLEDVLQNSKY-IGIVLEYASGGEFYKYLQRK--K 157

Query: 132 RLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRP 191
           RLKE    +  + +  GVA +H+    L+HRD+K+EN+L+   +   + DFG V  +   
Sbjct: 158 RLKEPLACSTFAQLISGVAYIHS--KGLVHRDLKLENLLLDKHSNLVITDFGFVNEI--- 212

Query: 192 PTNQTELDFVQHDILKNTTAQ--YRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTP 249
            TN        + ++K       Y +PE++ LS       K+DIW+ GV LY +     P
Sbjct: 213 STN--------NKLMKTPCGSPCYAAPELV-LSTKPYDARKADIWSAGVILYAMLAGYLP 263

Query: 250 FEKEGEN---AILHSRYQYPA-----YPQYSDNL-KNLIRVMLMVDPSKRPNICQV 296
           ++ + EN   + +   Y+Y       +P Y + L ++LIR +L++ P  R NI QV
Sbjct: 264 WDDDPENPDGSNIMRLYEYITKNNLKFPDYIEPLARDLIRKILVIQPKSRLNIVQV 319

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 115/246 (46%), Gaps = 37/246 (15%)

Query: 60  VPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGK 119
            PD     + R E+  MKLLR+   V+S  D     S            +++++EY    
Sbjct: 73  TPDSLPYGIER-EIIIMKLLRHAN-VLSLYDVWETNS-----------NLYMILEYAEKG 119

Query: 120 GLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKL 179
            L + +  +    L E E +     +  G++  HAL   ++HRD+K EN+L+ +K   K+
Sbjct: 120 ELFNLLVEK--GPLPEKEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKI 175

Query: 180 CDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINE-KSDIWALGV 238
            DFG           +TE   ++       +  Y +PE++S    IP +  +SD+W+ GV
Sbjct: 176 ADFGMAAL-------ETEDKLLETSC---GSPHYAAPEIVS---GIPYHGFESDVWSCGV 222

Query: 239 FLYKVCYYTTPFEKEGEN------AILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPN 292
            L+ +     PF++E  N       +   +++ P   + S + ++LI  +L VDP+KR  
Sbjct: 223 ILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIK 282

Query: 293 ICQVVE 298
             ++++
Sbjct: 283 TREILK 288

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 95/196 (48%), Gaps = 24/196 (12%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++L++EY     L + +  R    L E E +     +   ++  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVDR--GPLPEREAIKCFKQIIIAISYCHALG--IVHRDLKPEN 157

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           +L+ N    K+ DFG           QT+   ++       +  Y +PE++S    +P  
Sbjct: 158 LLLDNSYNIKIADFGMAAL-------QTDAGMLETSC---GSPHYAAPEIVS---GLPYE 204

Query: 229 E-KSDIWALGVFLYKVCYYTTPFEKEGENA------ILHSRYQYPAYPQYSDNLKNLIRV 281
              SD+W+ GV L+ +     PF++E  N       +   +++ P   + S + ++LIR 
Sbjct: 205 GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRR 264

Query: 282 MLMVDPSKRPNICQVV 297
           +L+VDP++R  I  ++
Sbjct: 265 ILVVDPTQRIKIRDIL 280

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 96/225 (42%), Gaps = 42/225 (18%)

Query: 74   EAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRL 133
            + M    ++ Y    ++SH            GS ++F L+E              L+  +
Sbjct: 865  QIMDFFEDDDYYYIELESHGE---------TGSIDLFDLIE--------------LKTNM 901

Query: 134  KEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPT 193
             EFE   I   +  G+  +H     ++HRDIK ENV++ +    KL DFGS       P 
Sbjct: 902  TEFEAKLIFKQIVSGIKYLH--DQGIVHRDIKDENVIVDSNGFVKLIDFGSAAYTKTGPF 959

Query: 194  NQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEK-SDIWALGVFLYKVCYYTTPFEK 252
                  FV        T  Y +PE+L  +   P   K  DIWALGV LY + Y   PF  
Sbjct: 960  EV----FVG-------TIDYAAPEILGGN---PYKGKPQDIWALGVLLYTLIYKENPFYN 1005

Query: 253  EGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVV 297
              E  IL  + ++      + +  +LIR +L    + RP+I ++V
Sbjct: 1006 VDE--ILEGQLRFDGTCNVTQDCIDLIRWILTKSVNDRPSIDEIV 1048

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 93/188 (49%), Gaps = 15/188 (7%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++++M+YC G    D +     N + E ++  I+ +V  G+  +H  +   +HRDIK  N
Sbjct: 87  MWIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLLGLQYLHEQKK--IHRDIKAAN 144

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           +L+++  + KL DFG V G I+    +    FV        T  + +PE+++   +   +
Sbjct: 145 ILLTDDGQVKLGDFG-VSGQIKATLKRDT--FV-------GTPYWMAPEVINKEINNGYD 194

Query: 229 EKSDIWALGVFLYKVCYYTTPFEKEGENAILHS---RYQYPAYPQYSDNLKNLIRVMLMV 285
           EK DIW+LG+  Y++     P  K     ++ S   R     +  Y+D  K+ I   L+ 
Sbjct: 195 EKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRKPPKLHGPYNDFTKSFISFCLIK 254

Query: 286 DPSKRPNI 293
           DP  RPN+
Sbjct: 255 DPKLRPNV 262

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 109/240 (45%), Gaps = 43/240 (17%)

Query: 72  EVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQN 131
           E+ A+KLL           +H    R    + N  Y + +++E+ SG     ++  +   
Sbjct: 103 EINALKLL-----------THPNIVRLEEVLQNSKY-IGIVLEFASGGEFYKYLQRK--R 148

Query: 132 RLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRP 191
           RLKE     + + +  GV  MH+    L+HRD+K+EN+L+       + DFG V      
Sbjct: 149 RLKEPHACQLFAQLISGVTYMHS--KGLVHRDLKLENLLLDKNENLIITDFGFVNEF--- 203

Query: 192 PTNQTELDFVQHDILKNTTAQ--YRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTP 249
                   F  ++++K +     Y +PE++ LS       K DIW+ G+ LY +     P
Sbjct: 204 --------FGSNELMKRSCGSPCYAAPELV-LSTEPYRARKVDIWSCGIILYAMLAGYLP 254

Query: 250 FEKEGENA-----------ILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVE 298
           ++ + +N            I  +  ++PAY   S   ++LIR +L  +PS+R +I  + +
Sbjct: 255 WDDDSQNPNGDDIGKLYQYITKTALKFPAY--ISPLARDLIRKILTANPSRRISISYICK 312

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 98/199 (49%), Gaps = 29/199 (14%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E++L++EY  G  L D++ ++   +L E E ++    + +GV+  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 168 NVLISNKN-EFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTA--QYRSPEMLSLSKS 224
           N+L+  KN   K+ DFG     +  P          + +LK +     Y SPE++     
Sbjct: 244 NLLLDKKNRRIKIADFG--MAALELP----------NKLLKTSCGSPHYASPEIV---MG 288

Query: 225 IPINEK-SDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLI 279
            P +   SD+W+ G+ L+ +     PF  +    +L      +YQ P+    S   ++LI
Sbjct: 289 RPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPS--NLSSEARDLI 346

Query: 280 RVMLMVDPSKRPNICQVVE 298
             +L++DP KR    ++++
Sbjct: 347 SKILVIDPEKRITTQEILK 365

>ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {ON}
           some similarities with uniprot|Q03306 Saccharomyces
           cerevisiae YDR466W
          Length = 890

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 123/280 (43%), Gaps = 46/280 (16%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPP-LLHRDIKIE 167
           ++ ++++ +G  L+  +N     R+ +F        ++Q +     +    ++HRD+K E
Sbjct: 89  LYFVLDFAAGGELLSLLN-----RVGKFTEPCARHFIAQLIDTTEFIHSQGVIHRDLKPE 143

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           NVL+       + DFG+   + +  T +    FV        TA+Y SPE+L  ++    
Sbjct: 144 NVLLHRDGRLMVTDFGTATNITKENT-EGGASFV-------GTAEYVSPELLLYNQ---C 192

Query: 228 NEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSRYQYPA--YPQYSDN---LKNLIRVM 282
              SD+WALG  LY+      PF  E E   LH+  +  A  YP  ++N   + +L+R +
Sbjct: 193 QFASDVWALGCMLYQFIEGVPPFRGENE---LHTFEKIVALEYPWANNNKGGVVSLVRRI 249

Query: 283 LMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQ 342
           L +DPS+RP++  + ++           K F       + A+    +  Q ++  PL  Q
Sbjct: 250 LTLDPSQRPSLTSIKQD-----------KWFEQVDWRNREALWKGIWQVQPQRQQPLEYQ 298

Query: 343 HSISSPALSTVNNNIGLSNINFLQNVNNSAIQTANTTSRI 382
           +           NNI   N+   +       +  NTTS I
Sbjct: 299 Y----------RNNISNPNLPLAKQKRRKPAKVGNTTSSI 328

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 94/188 (50%), Gaps = 23/188 (12%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E++L++EY  G  L D++ ++   +L E E ++    + QGV+  H+    + HRD+K E
Sbjct: 210 ELYLVLEYVDGGELFDYLVSK--GKLSEKEAVHYFKQIIQGVSYCHSFN--ICHRDLKPE 265

Query: 168 NVLISNKNE-FKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIP 226
           N+L+  KN+  K+ DFG     +     QT             +  Y SPE++ + KS  
Sbjct: 266 NLLLDKKNKSIKIADFGMAALELPNKLLQTSCG----------SPHYASPEIV-MGKSYH 314

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLIRVM 282
               SD+W+ G+ L+ +     PF  +    +L      +++ P+    S   ++LI  +
Sbjct: 315 -GGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMPS--TLSPEAQDLISRI 371

Query: 283 LMVDPSKR 290
           L++DPSKR
Sbjct: 372 LVIDPSKR 379

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 98/196 (50%), Gaps = 27/196 (13%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           + +++EY SG     ++  + + RLKE     + + +  GV  MH+    L+HRD+K+EN
Sbjct: 128 IGIVLEYASGGEFYKYI--QRKRRLKESTACRLFAQLISGVTYMHSKN--LVHRDLKLEN 183

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ--YRSPEMLSLSKSIP 226
           +L+       + DFG V   +  P N+          +K +     Y +PE++ +S    
Sbjct: 184 LLLDKNENLVITDFGFVNEFL--PDNE---------YMKTSCGSPCYAAPELV-ISTRPY 231

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEG---ENAILHSRYQYPA-----YPQYSDNL-KN 277
           +  K+D+W+ G+ LY +     P++ +    E   +   YQY       +P+Y   + ++
Sbjct: 232 VARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFPEYITPIPRD 291

Query: 278 LIRVMLMVDPSKRPNI 293
           L+R +L+ DP+KR N+
Sbjct: 292 LLRKILVPDPNKRVNM 307

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 132/279 (47%), Gaps = 35/279 (12%)

Query: 27  YLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVV 86
           +L  GGFA+ +Q++     I +   +A  K  I  +KT   +  +E++  K +++   +V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA--KISIKSEKTRKKL-LSEIQIHKSMKHPN-IV 137

Query: 87  SYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVS 146
            +ID     +            V++L+E C    L+D +  R    L E E+    + + 
Sbjct: 138 QFIDCFEDDT-----------NVYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIV 184

Query: 147 QGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDIL 206
             +  MH  +  ++HRD+K+ N+   +    K+ DFG +  V+    N  E  +      
Sbjct: 185 GAIKYMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANDRERKYTV---- 234

Query: 207 KNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHSR---- 262
              T  Y +PE+L+  K    + + DIW++GV +Y +     PF+ +  N I++ R    
Sbjct: 235 -CGTPNYIAPEVLA-GKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVN-IIYERIKSG 291

Query: 263 -YQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300
            Y +P     S  +  LI+ +L +DP +RP++ ++++ V
Sbjct: 292 DYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 103/200 (51%), Gaps = 29/200 (14%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           + +++EY +G     F+  +   RLKE     + S +   V  +H+    L+HRD+K+EN
Sbjct: 142 IGIVLEYAAGGEFYKFIQRK--RRLKENHACRLFSQLISAVHYIHS--KGLVHRDLKLEN 197

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ--YRSPEMLSLSKSIP 226
           +L+ N+    + DFG V   +R           Q+ ++K +     Y +PE++  ++  P
Sbjct: 198 LLLDNEENLIITDFGFVNEFLR-----------QNGMMKTSCGSPCYAAPELVVSNR--P 244

Query: 227 IN-EKSDIWALGVFLYKVCYYTTPFEKEGENAILH--SR-YQYP-----AYPQYSDNL-K 276
            +  K+D W+ G+ L+ +     P++ + +N   H  SR Y Y       +P+Y + + +
Sbjct: 245 YDARKADTWSCGIILFAMLAGYLPWDDDPKNPDGHDISRLYNYILNTPLKFPEYINPVPR 304

Query: 277 NLIRVMLMVDPSKRPNICQV 296
           +L+R +L++DP KR NI  +
Sbjct: 305 DLLRKILVIDPKKRINIRSI 324

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 94/194 (48%), Gaps = 24/194 (12%)

Query: 105 GSY----EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLL 160
           GSY     ++++ME+C+G  L   +      ++ E  I  IM  +   +  +H     ++
Sbjct: 87  GSYLKDTSLWIIMEHCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKCIHKDN--VI 141

Query: 161 HRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLS 220
           HRDIK  NVLI+N+   KLCDFG    V     NQT L   +   +   T  + +PE+  
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFGVAAQV-----NQTSL---RRQTMAG-TPYWMAPEV-- 190

Query: 221 LSKSIPINEKSDIWALGVFLYKVCYYTTPF-EKEGENA---ILHSRYQYPAYPQYSDNLK 276
           + + +  + K DIW+LG+  Y++     P+ + E   A   I+ S+        YS +LK
Sbjct: 191 IMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLK 250

Query: 277 NLIRVMLMVDPSKR 290
             I + L  DP +R
Sbjct: 251 EFIALCLDEDPKER 264

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 115/250 (46%), Gaps = 40/250 (16%)

Query: 48  SGSNIACLKRVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSY 107
           SG++I      I PD     + R E+  MKLL N+  V+   D           V   + 
Sbjct: 61  SGTSIVG---SITPDALPYGIER-EIIIMKLL-NHPNVLRLYD-----------VWETNT 104

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           +++L++EY     L + +  R    L E E +     +  GV+  HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPE 160

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           N+L+ +K   K+ DFG           +TE   ++       +  Y +PE++S    IP 
Sbjct: 161 NLLLDHKYNIKIADFGMAAL-------ETEGKLLETSC---GSPHYAAPEIVS---GIPY 207

Query: 228 NE-KSDIWALGVFLYKVCYYTTPFEKEGEN------AILHSRYQYPAYPQYSDNLKNLIR 280
               SD+W+ GV L+ +     PF++E  N       +   +++ P+  + S   ++LI 
Sbjct: 208 QGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLIC 267

Query: 281 VMLMVDPSKR 290
            +L VDP +R
Sbjct: 268 KILTVDPKRR 277

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 99/205 (48%), Gaps = 35/205 (17%)

Query: 102 VPN-----GSY----EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAM 152
           VPN     GSY    +++++MEYC+G  L   +      ++ E  I  IM  +   VA +
Sbjct: 82  VPNITHYYGSYLYDTKLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVIMRELL--VALL 136

Query: 153 HALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ 212
           +  +  ++HRDIK  NVLI+N    KLCDFG                  Q ++ + T A 
Sbjct: 137 YIHKDNVIHRDIKAANVLITNDGRVKLCDFGVAA------------QLTQSNVRRQTMAG 184

Query: 213 ---YRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPF-EKEGENAI-LHSRYQYPA 267
              + +PE+  + + +  + K DIW+LG+  Y++     P+ + E   A+ L ++ + P 
Sbjct: 185 TPYWMAPEV--IMEGVYYDTKVDIWSLGITTYEITTGNPPYCDVEALRAMQLITKSKPPR 242

Query: 268 YP--QYSDNLKNLIRVMLMVDPSKR 290
               QYS  LK  I + L  DP +R
Sbjct: 243 LEGRQYSPLLKEFIALCLDEDPKER 267

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 105/226 (46%), Gaps = 31/226 (13%)

Query: 70  RAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRL 129
           R E++ +  L+    +  Y  S+   ++           ++++MEYC+G  L   +   +
Sbjct: 60  RKEIQFLSSLKQTPNITHYYGSYLIDTK-----------LWVIMEYCAGGSLRTLLRPGI 108

Query: 130 QNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVI 189
              ++E  I  IM  +   + ++H  +  ++HRDIK  N+LI+N    KLCDFG      
Sbjct: 109 ---IEEKYIGVIMREILVALISIH--RDNVIHRDIKAANILIANNGSVKLCDFGVAA--- 160

Query: 190 RPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTP 249
                Q     ++   +   T  + +PE+  + + +  + K DIW+LG+  Y++     P
Sbjct: 161 -----QLSQSMLKRQTMAG-TPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPP 212

Query: 250 F-EKEGENAI-LHSRYQYPAYP--QYSDNLKNLIRVMLMVDPSKRP 291
           +   E   A+ + ++ + P     +YS  LK  I + L  DP +RP
Sbjct: 213 YCHMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 86/181 (47%), Gaps = 18/181 (9%)

Query: 120  GLIDFMN-TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFK 178
            G ID  +    ++ + E E   I   V  G+  +H     ++HRD+K ENV++  K   K
Sbjct: 1199 GCIDLFDLIEFKSNMTESEARLIFIQVVLGIKHLH--DSNIVHRDVKDENVIVDAKGFVK 1256

Query: 179  LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGV 238
            L DFGS   V   P +     FV        T  Y +PE+  LS    + +  DIWA+G+
Sbjct: 1257 LIDFGSAAYVNSGPFDV----FV-------GTIDYAAPEV--LSGEPYLGKPQDIWAIGI 1303

Query: 239  FLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVE 298
             LY + +   PF    E  IL +  +       S +  +LI+ +L  +P+KRP I ++V 
Sbjct: 1304 LLYTIMFKENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDEIVN 1361

Query: 299  E 299
            +
Sbjct: 1362 D 1362

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 85/179 (47%), Gaps = 20/179 (11%)

Query: 120  GLIDFMN-TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFK 178
            G ID  +   ++  + E E + I   ++ G+  +H     ++HRDIK ENV++      K
Sbjct: 1045 GSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVK 1102

Query: 179  LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEK-SDIWALG 237
            + DFGS   V   P +     FV        T  Y +PE+L      P   K  DIWA+G
Sbjct: 1103 IVDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVLG---GEPYEGKPQDIWAIG 1148

Query: 238  VFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQV 296
            V LY + Y   PF    E  IL +  +  +  + SD+   LIR +L    SKRP+I ++
Sbjct: 1149 VLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEI 1205

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 97/198 (48%), Gaps = 27/198 (13%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E+FL++EY  G  L D++ ++   +L E E ++    + QGVA  H     + HRD+K E
Sbjct: 144 ELFLVLEYVEGGELFDYLVSK--GKLPEQEAVHYFRQIIQGVAYCHNYN--ICHRDLKPE 199

Query: 168 NVLISNKN-EFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTA--QYRSPEMLSLSKS 224
           N+L+  KN + K+ DFG         TN+         +L+ +     Y SPE++ + K+
Sbjct: 200 NLLVDKKNHQIKIADFGMAA---LETTNK---------LLETSCGSPHYASPEIV-MGKN 246

Query: 225 IPINEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLIR 280
                 SD+W+ G+ L+ +     PF  +    +L      +Y  P     S   ++LI 
Sbjct: 247 YH-GSPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKYHMPQ--NISSEAQDLIS 303

Query: 281 VMLMVDPSKRPNICQVVE 298
            +L+VDP  R  I +V++
Sbjct: 304 KILIVDPRGRITINEVLQ 321

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 98/199 (49%), Gaps = 29/199 (14%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E++L++EY  G  L D++ ++   +L E E ++    + +GV+  H+    + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 168 NVLISNKN-EFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTA--QYRSPEMLSLSKS 224
           N+L+  KN   K+ DFG     +  P          + +LK +     Y SPE++     
Sbjct: 244 NLLLDKKNRRIKIADFG--MAALELP----------NKLLKTSCGSPHYASPEIV---MG 288

Query: 225 IPINEK-SDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLI 279
            P +   SD+W+ G+ L+ +     PF  +    +L      +YQ P     S   ++LI
Sbjct: 289 RPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPM--NLSAEARDLI 346

Query: 280 RVMLMVDPSKRPNICQVVE 298
             +L++DP+KR    ++++
Sbjct: 347 SKILVIDPAKRITTQEILK 365

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 89/198 (44%), Gaps = 21/198 (10%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           V+L MEYC G      + TR    + E +     S V+  +  +H L    ++RD+K EN
Sbjct: 509 VYLCMEYCMGGEFFRALQTRKAKSISEDDARFYASEVTAALEYLHLLG--FIYRDLKPEN 566

Query: 169 VLISNKNEFKLCDFG-------SVCGVIRPPTNQTELD--FVQHDILKNT---TAQYRSP 216
           +L+       L DF        +   V R  T  + +D          N+   T +Y +P
Sbjct: 567 ILLHKSGHIMLSDFDLSVQANDAAKPVKRVATQSSMVDTKVFSEGFRTNSFVGTEEYIAP 626

Query: 217 EMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENA----ILHSRYQYPAYPQYS 272
           E++   +        D W LG+ +Y++ +  TPF+ E  N     IL +   +P + + S
Sbjct: 627 EVI---RGNGHTAAVDWWTLGILIYEMLFGCTPFKGENTNETFCNILKNEVTFPEHHEIS 683

Query: 273 DNLKNLIRVMLMVDPSKR 290
            + K+LIR +L  + SKR
Sbjct: 684 RHCKDLIRKLLSKNESKR 701

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 95/194 (48%), Gaps = 19/194 (9%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           +V++ +EYC G  L D++  +   R+   E   + + +   V   H+LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGNELYDYLLQK--QRIPLDETSKLFAQIVGAVFYAHSLQ--CVHRDLKLE 157

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           N+L+  +    L DF    G  R    +T+L+ +        T  Y +PE+  + +    
Sbjct: 158 NILLDKQGYAMLTDF----GFTRECATKTQLETI------CGTTVYMAPEL--IKRESYD 205

Query: 228 NEKSDIWALGVFLYKVCYYTTPFEKEGENAI-LHSRYQYPAYPQYSDNL--KNLIRVMLM 284
             K D W+LG+ LY + +   PF++E      L    + P       N+  K+LI  +L 
Sbjct: 206 GYKVDTWSLGIILYTMLHGFMPFDEEDPTLTGLKIMNEMPPIVDAYTNVHAKDLILKLLR 265

Query: 285 VDPSKRPNICQVVE 298
             PS+RP++ +V+E
Sbjct: 266 KTPSERPSLNKVLE 279

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 95/196 (48%), Gaps = 24/196 (12%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++L++EY     L + +       L E E +N    +  G++  HAL   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVD--HGPLPEREAINCFRQIIIGISYCHALG--IVHRDLKPEN 157

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           +L+ +    K+ DFG           QT+ D ++       +  Y +PE++S    +P  
Sbjct: 158 LLLDSFYNIKIADFGMAAL-------QTDADLLETSC---GSPHYAAPEIVS---GLPYE 204

Query: 229 E-KSDIWALGVFLYKVCYYTTPFEKEGENA------ILHSRYQYPAYPQYSDNLKNLIRV 281
              SD+W+ GV L+ +     PF++E  N       +   +++ P   + S + ++LI  
Sbjct: 205 GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGK 264

Query: 282 MLMVDPSKRPNICQVV 297
           +L+VDP +R  I  ++
Sbjct: 265 ILVVDPRQRIKIRDIL 280

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 94/201 (46%), Gaps = 30/201 (14%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           +++L++EY     L + +  R    L E E +     +  G++  H+L   ++HRD+K E
Sbjct: 103 DLYLVLEYAEKGELFNMLVER--GPLPENEAVRAFRQIIIGISYCHSL--GVVHRDLKPE 158

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTA---QYRSPEMLSLSKS 224
           N+L+ NK   K+ DFG                    D L  T+     Y +PE++S    
Sbjct: 159 NLLLDNKLNIKIADFGMAA-------------LESEDKLLETSCGSPHYAAPEIIS---G 202

Query: 225 IPINE-KSDIWALGVFLYKVCYYTTPFEKEGEN------AILHSRYQYPAYPQYSDNLKN 277
           +P     SD+W+ GV L+ +     PF++E  N       +    ++ P   + +   ++
Sbjct: 203 LPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQD 262

Query: 278 LIRVMLMVDPSKRPNICQVVE 298
           L+  +L VDPSKR  I ++++
Sbjct: 263 LLARLLTVDPSKRITIREILK 283

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 96/204 (47%), Gaps = 25/204 (12%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILN------IMSHVSQGVAAMHALQPPLLHR 162
           ++ L+EY S     DF+       +K++  LN        S +   V ++HA+   ++HR
Sbjct: 199 LYFLLEYASHG---DFLGL-----IKKYGSLNEKCARYYASQIIDAVDSLHAIG--IIHR 248

Query: 163 DIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTE----LDFVQHDILKNTTAQYRSPEM 218
           DIK EN+L+    + KL DFG+   +   P+N  +     D          TA+Y SPE+
Sbjct: 249 DIKPENILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARSKSFVGTAEYVSPEL 308

Query: 219 LSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHS--RYQYPAYPQYSDNLK 276
           L+ S +   + + DIWA G  LY++     PF+   E        + QY     +    K
Sbjct: 309 LNDSYT---DSRCDIWAFGCILYQMVAGKPPFKAANEYLTFQKVMKIQYAFTAGFPLIAK 365

Query: 277 NLIRVMLMVDPSKRPNICQVVEEV 300
           +L++ +L+ +P+ R  + Q+   V
Sbjct: 366 DLVKKLLVREPNDRLTVEQIKAHV 389

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 97/194 (50%), Gaps = 24/194 (12%)

Query: 105 GSY----EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLL 160
           GSY     ++++M+YC+G  +   +      ++ E  I  IM  +   +  +H  +  ++
Sbjct: 110 GSYLKDTNLWIIMDYCAGGSIRTLLR---PGKIDEKYIGIIMREILIALQYIH--KDNVI 164

Query: 161 HRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLS 220
           HRDIK  NVL++N+ + KLCDFG    +     NQT+L   +   +   T  + +PE+  
Sbjct: 165 HRDIKAANVLVTNEGKVKLCDFGVAAQL-----NQTKL---RRQTMAG-TPYWMAPEV-- 213

Query: 221 LSKSIPINEKSDIWALGVFLYKVCYYTTPF-EKEGENAILHSRYQYPAYPQ---YSDNLK 276
           + +    + K+DIW+LG+  Y++     P+ E E   A+       PA  +   YS +LK
Sbjct: 214 IMEGAYYDTKADIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGRSYSTSLK 273

Query: 277 NLIRVMLMVDPSKR 290
             I + L  DP +R
Sbjct: 274 EFIALCLDEDPKER 287

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 93/190 (48%), Gaps = 24/190 (12%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           +++L++EY     L + +  R    L E E +     +  GV+  HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPE 160

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           N+L+ +K   K+ DFG           +TE   ++       +  Y +PE++S    IP 
Sbjct: 161 NLLLDHKYNIKIADFGMAAL-------ETEGKLLETSC---GSPHYAAPEIVS---GIPY 207

Query: 228 NE-KSDIWALGVFLYKVCYYTTPFEKEGEN--AIL----HSRYQYPAYPQYSDNLKNLIR 280
               SD+W+ GV L+ +     PF++E  N  A+L       ++ P+  + S   ++LI 
Sbjct: 208 QGFASDVWSCGVILFALLTGRLPFDEEDGNIRALLLKVQKGEFELPSDDEISREAQDLIS 267

Query: 281 VMLMVDPSKR 290
            +L VDP +R
Sbjct: 268 KILTVDPERR 277

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 71/148 (47%), Gaps = 16/148 (10%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           +V++ +EYC GK L D +      R+   E   + + +   V   H+L    +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHL--LFSKRIPIAECTELFAQIVGAVYYAHSLN--CVHRDLKLE 161

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           N+L+      KL DFG      R    ++ L+ V        T  Y +PE++        
Sbjct: 162 NILLDKHGRAKLTDFG----FTRECMTRSTLETV------CGTTVYMAPELIERKSYDGF 211

Query: 228 NEKSDIWALGVFLYKVCYYTTPFEKEGE 255
             K DIWALGV LY + Y   PF+++ E
Sbjct: 212 --KIDIWALGVILYTMIYGAMPFDEDDE 237

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/176 (33%), Positives = 82/176 (46%), Gaps = 20/176 (11%)

Query: 120  GLIDFMN-TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFK 178
            G ID  +   L+  + E+E   +   ++ GV  +H     ++HRDIK ENV++ NK   K
Sbjct: 1157 GSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKGCVK 1214

Query: 179  LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEK-SDIWALG 237
            L DFGS   V R P +     FV        T  Y +PE+L   +  P   K  DIWA+G
Sbjct: 1215 LIDFGSAAYVKRGPFDV----FV-------GTIDYAAPEVL---EGDPYEGKPQDIWAIG 1260

Query: 238  VFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNI 293
            V LY + Y   PF    E  IL    +       S+    LI ++L    SKRP +
Sbjct: 1261 VLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTV 1314

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 96/199 (48%), Gaps = 28/199 (14%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPP-LLHRDIKIE 167
           ++++MEYC+G  +   +      ++ E  I  IM  +   + A+H +    ++HRDIK  
Sbjct: 114 LWIIMEYCAGGSVRTLLR---PGKIDEKYIAVIMREL---LVALHYIHKDNVIHRDIKAA 167

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ---YRSPEMLSLSKS 224
           N+LI+N+   KLCDFG                  Q+ + + T A    + +PE+  + + 
Sbjct: 168 NLLITNEGNVKLCDFGVAA------------QLNQNTMRRQTMAGTPYWMAPEV--IMEG 213

Query: 225 IPINEKSDIWALGVFLYKVCYYTTPF-EKEGENAILHSRYQYPAYPQYSDN---LKNLIR 280
           I  + K+DIW++G+  Y++     PF E E   A+       PA  +  ++   LK  I 
Sbjct: 214 ISYDTKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKPARLEGKNHDPLLKEFIA 273

Query: 281 VMLMVDPSKRPNICQVVEE 299
           + L  DP +RP   +++ E
Sbjct: 274 MCLDEDPQERPTADKLLHE 292

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 84/182 (46%), Gaps = 20/182 (10%)

Query: 120  GLIDFMN-TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFK 178
            G ID  +    +  + EFE   I   +  G+  +H     ++HRDIK ENV++ +K   K
Sbjct: 1214 GCIDLFDLIEFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVK 1271

Query: 179  LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEK-SDIWALG 237
            + DFGS   V   P +     FV        T  Y +PE+LS     P   K  DIWA+G
Sbjct: 1272 IIDFGSAAYVKSGPFDV----FVG-------TIDYAAPEVLS---GEPYEGKPQDIWAIG 1317

Query: 238  VFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVV 297
            + LY + +   PF    E  IL    ++      S++   LI+ +L+    KRP I ++ 
Sbjct: 1318 ILLYTIVFKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEIF 1375

Query: 298  EE 299
             +
Sbjct: 1376 ND 1377

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 99/201 (49%), Gaps = 18/201 (8%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++++MEYC G    D +       L E +   I   V +G+  +H  +   +HRDIK  N
Sbjct: 88  MWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLHEQKK--IHRDIKAAN 145

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPIN 228
           +L++++ + KL DFG V G IR    +    FV        T  + +PE++S   S   +
Sbjct: 146 ILLTDEGKVKLGDFG-VSGQIRATLKRGT--FV-------GTPFWMAPEVVS-KDSDGYD 194

Query: 229 EKSDIWALGVFLYKVCYYTTPFEKEGENAI---LHSRYQYPAYPQYSDNLKNLIRVMLMV 285
           EK+DIW+LG+ +Y++   + P  K     +   L  R     +  YS   K+ +   L+ 
Sbjct: 195 EKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRKPPVLHGHYSSAAKHFVASCLVK 254

Query: 286 DPSKRPNICQVV--EEVSRLQ 304
           +P  RP+  +++  E V+ LQ
Sbjct: 255 NPKNRPSAVELLNSEFVTNLQ 275

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 94/197 (47%), Gaps = 29/197 (14%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           + +++EY SG     ++  +   RLKE     + + +  GV  +H+    L+HRD+K+EN
Sbjct: 132 IGIVLEYASGGEFYKYIQRK--KRLKEGPACRLFAQLINGVHYIHSKG--LVHRDLKLEN 187

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ---YRSPEMLSLSKSI 225
           +L+       + DFG V             +F  H  L  T+     Y +PE++  +K  
Sbjct: 188 LLLDKHENLIITDFGFVS------------EFYSHGELMKTSCGSPCYAAPELVVSTKPY 235

Query: 226 PINEKSDIWALGVFLYKVCYYTTPFEKEGENA-------ILHSRYQYP-AYPQYSDNL-K 276
              +K+DIW+ GV LY +     P++ +  N        + H   Q P  +P Y + + +
Sbjct: 236 EA-KKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDISRLYHYITQTPLKFPDYINPIPR 294

Query: 277 NLIRVMLMVDPSKRPNI 293
           +L+R +L+ DP +R  I
Sbjct: 295 DLLRRILISDPRRRITI 311

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 107/237 (45%), Gaps = 37/237 (15%)

Query: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120
           PD     + R E+  MKLLR+   V+S  D     S+           +++++EY     
Sbjct: 70  PDALPYGIER-EIIIMKLLRHPN-VLSLYDVWETNSK-----------LYMILEYAEKGE 116

Query: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180
           L + +  R    L E E +     +  G++  HAL   ++HRD+K EN+L+ +K   K+ 
Sbjct: 117 LFNLLVER--GPLPEKEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKLNIKIA 172

Query: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINE-KSDIWALGVF 239
           DFG      +    +T             +  Y +PE++S    +P +  +SD+W+ GV 
Sbjct: 173 DFGMAALETKDKMLETSCG----------SPHYAAPEIVS---GVPYHGFQSDVWSCGVI 219

Query: 240 LYKVCYYTTPFEKEGEN------AILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKR 290
           L+ +     PF++E  N       +    Y+ P   + S   ++LI  +L VDP +R
Sbjct: 220 LFALLTGRLPFDEEDGNIRNLLLKVQSGEYEMPDDDEISKEAQDLIGRILTVDPEQR 276

>KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 361

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 118/296 (39%), Gaps = 73/296 (24%)

Query: 23  KILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVI----VPDKTSLNVPRAEVEAMKL 78
           +I K L  G F +VY V+      H  + + C  + +    +   T     R EVE    
Sbjct: 101 EIGKILGKGKFGKVYCVK------HRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGS 154

Query: 79  LRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFM--NTRLQNRLKEF 136
            ++      Y            G       V+LLMEY     L  F+  N  L   L  +
Sbjct: 155 FKHKNLTQLY------------GFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASY 202

Query: 137 EILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFG------------S 184
                +  ++  +  MH+    +LHRDIK EN+LI   N  KL DFG            +
Sbjct: 203 ----FVYQMANALDYMHS--KNILHRDIKPENILIGFNNTIKLTDFGWSVYNEDGQKRKT 256

Query: 185 VCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVC 244
           +CG I                       Y SPE++   KS   N K D+WALGV  Y++ 
Sbjct: 257 LCGTI----------------------DYLSPELI---KSREYNNKVDVWALGVLTYELL 291

Query: 245 YYTTPFEKEGENA----ILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQV 296
             + PFE++ +      IL    ++P     S   ++LI  +L  +PSKR  + +V
Sbjct: 292 VGSPPFEEDTKEMTYRRILRCDLKFPL--NVSPQARDLIVRLLQFEPSKRIPLSEV 345

>NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {ON}
           Anc_6.262 YPL236C
          Length = 406

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 77/154 (50%), Gaps = 11/154 (7%)

Query: 161 HRDIKIENVLISNKNEFKLCDFGSVCGV-IRPPTNQTELDFVQHDILKNTTAQYRSPEML 219
           HR+IK  N+L S+     + D  S     I   T +  LDF +  I    +  + SPE+L
Sbjct: 251 HRNIKPSNILFSSDGSQVISDLSSTSKSNIHLKTGKQILDFKEW-IDSCCSVPFMSPELL 309

Query: 220 SLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGE-------NAILHSRYQYPAYPQ-- 270
            L     I+EK DIW+LG  +Y +    +PFE+E +         IL + + +P   +  
Sbjct: 310 DLKMGSKIDEKVDIWSLGCTIYTIILGVSPFEREVQLTGKSIRMLILSANFTFPEGMERH 369

Query: 271 YSDNLKNLIRVMLMVDPSKRPNICQVVEEVSRLQ 304
            S  L + I+  L VDP+KRP I Q++ ++  LQ
Sbjct: 370 ASRELIDTIKQCLQVDPTKRPTINQLLNDLQALQ 403

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 99/200 (49%), Gaps = 29/200 (14%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           + +++E+ SG     ++  +   RLKE     + + +  GV  MH+    L+HRD+K+EN
Sbjct: 119 IGIVLEFASGGEFYKYIQKK--RRLKETPACRLFAQLVSGVHYMHS--KGLVHRDLKLEN 174

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ---YRSPEMLSLSKSI 225
           +L+       + DFG V             +F Q + L  T+     Y +PE++  ++  
Sbjct: 175 LLLDKHENLIITDFGFVN------------EFSQRNELMKTSCGSPCYAAPELVVTTEPY 222

Query: 226 PINEKSDIWALGVFLYKVCYYTTPFEKEGEN------AILHSRYQYPA--YPQYSDNL-K 276
               K+D+W+ G+ LY +     P++ + +N      A L+      A  +P+Y + + +
Sbjct: 223 EA-RKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKLYLYITKTALKFPEYINPIQR 281

Query: 277 NLIRVMLMVDPSKRPNICQV 296
           +L+R +L+ DP+KR NI  +
Sbjct: 282 DLLRKILVSDPTKRLNIRNI 301

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 109/233 (46%), Gaps = 35/233 (15%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           ++++++EY     L + +  R    L E E +     +  G++  HAL   ++HRD+K E
Sbjct: 102 DLYMVLEYVEKGELFNLLVQR--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPE 157

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTA---QYRSPEMLSLSKS 224
           N+L+ +K   KL DFG                    D L  T+     Y +PE++S    
Sbjct: 158 NLLLDHKFNIKLADFGMAA-------------LESKDKLLETSCGSPHYAAPEIVS---G 201

Query: 225 IPINE-KSDIWALGVFLYKVCYYTTPFEKEGEN------AILHSRYQYPAYPQYSDNLKN 277
           +P +  +SD+W+ GV LY +     PF++E  N       +   +Y+ P   + S   ++
Sbjct: 202 LPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEARD 261

Query: 278 LIRVMLMVDPSKRPNICQVVEEVSRLQGVPCPLKNFYLERAIRQTAVQDNHFN 330
           LI  +L V+P +R    ++++    LQ  P  +K+    ++IR    +D + N
Sbjct: 262 LIVQILTVEPEQRIKTREILKH-PLLQKYPS-IKD---SKSIRNLPREDTYLN 309

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 91/190 (47%), Gaps = 24/190 (12%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           +++L++EY     L + +  R    L E E +     +  GV+  HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPE 160

Query: 168 NVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPI 227
           N+L+ +K   K+ DFG           +TE   ++       +  Y +PE++S    IP 
Sbjct: 161 NLLLDHKYNIKIADFGMAAL-------ETEGKLLETSC---GSPHYAAPEIVS---GIPY 207

Query: 228 NE-KSDIWALGVFLYKVCYYTTPFEKEGEN------AILHSRYQYPAYPQYSDNLKNLIR 280
               SD+W+ GV L+ +     PF++E  N       +    ++ P+  + S   ++LI 
Sbjct: 208 QGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQDLIS 267

Query: 281 VMLMVDPSKR 290
            +L VDP +R
Sbjct: 268 RILTVDPERR 277

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 112/235 (47%), Gaps = 38/235 (16%)

Query: 72  EVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQN 131
           E+  MK  R+N  VV++I++H +K             ++++MEY  G  L D +   L  
Sbjct: 562 EIIVMKESRHNN-VVNFINAHLSKGN-----------LWIVMEYMEGGSLTDVVTHCL-- 607

Query: 132 RLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRP 191
            L E +I  +     +G+  +H+    ++HRDIK +NVL+S K + KL DFG  C  I  
Sbjct: 608 -LSEGQIGAVCRETLEGLKFLHS--KGVIHRDIKSDNVLLSMKGDIKLTDFG-FCAQI-- 661

Query: 192 PTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFE 251
                ++D  +  ++   T  + +PE++S  +  P   K DIW+LG+ + ++     P+ 
Sbjct: 662 ----NDIDLNRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYL 712

Query: 252 KEGENAILH-------SRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEE 299
            E     L+        + + P     SD   N +   L V+P +R +  +++ +
Sbjct: 713 NEAPLKALYLIATNGTPKLKEPE--NLSDVFSNFLDRCLRVEPEERASAIELLAD 765

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 93/195 (47%), Gaps = 23/195 (11%)

Query: 108 EVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIE 167
           E++L++EY  G  L D++ +R   +L E E ++    + QGV+  H+    + HRD+K E
Sbjct: 226 ELYLILEYVDGGELFDYLVSR--GKLPEAEAIHYFKQIIQGVSYCHSFN--ICHRDLKPE 281

Query: 168 NVLISNKNEFKL-CDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIP 226
           N+LI  K +     DFG     +     QT             +  Y SPE++ + KS  
Sbjct: 282 NLLIDKKKKSIKIADFGMAALELPKKLLQTSCG----------SPHYASPEIV-MGKSYH 330

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEGENAIL----HSRYQYPAYPQYSDNLKNLIRVM 282
               SD+W+ G+ L+ +     PF  +    +L      +YQ P     SD  K+LI  +
Sbjct: 331 -GGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKYQMPK--NLSDEAKDLISRI 387

Query: 283 LMVDPSKRPNICQVV 297
           L+V PSKR    +++
Sbjct: 388 LVVSPSKRLTTVEIL 402

>KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {ON}
           Anc_8.652 YOR231W
          Length = 500

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 122/275 (44%), Gaps = 52/275 (18%)

Query: 46  IHSGSNIACLKRVIVPDKTSLNV-PRAEVEAMKLLRNNK-----YVVSYIDSHAAKSRPA 99
           +  G NI  LK +      +LN  P  + +  + L+ N+     Y+V Y      +S   
Sbjct: 229 LKHGKNIFALKTI-----NTLNTDPEFQKQIFRELQFNRSFKSDYIVRYYGMFTDES--- 280

Query: 100 PGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQ--NRLKEFEILNIMSHVSQGVAAMHALQP 157
               N S  +F+ MEY  GK L       L+   ++ E  +  I   V +G++ +H  + 
Sbjct: 281 ----NSS--IFIAMEYMGGKSLDAIYKNLLKRNGKISEKVLGKIAEDVLRGLSYLHEKK- 333

Query: 158 PLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPE 217
            ++HRDIK +N+L++++ E KLCDFG V G      N     F         T+ Y +PE
Sbjct: 334 -VIHRDIKPQNILLNDRGEVKLCDFG-VSGEA---VNSLATTFT-------GTSFYMAPE 381

Query: 218 MLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGEN----------AILHSRYQYPA 267
            +   K  P +   D+W+LG+ + +V     PF  E  N           IL    +   
Sbjct: 382 RI---KGEPYSVTCDVWSLGLTILEVAEGHFPFGSEKINNTIAPIELLVYILTFTPELKD 438

Query: 268 YPQ----YSDNLKNLIRVMLMVDPSKRPNICQVVE 298
            P+    ++ + K+ I   L  DP +RP+  Q+++
Sbjct: 439 EPEIGISWTSSFKSFIEYCLKKDPRERPSPRQMIQ 473

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 83/178 (46%), Gaps = 18/178 (10%)

Query: 120  GLIDFMN-TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFK 178
            G ID  +    +  + E E   I   V   +  +H     ++HRDIK ENV++ ++   K
Sbjct: 1129 GCIDLFDLIEFKTNMSEVETKLIFMQVVSSIKFLH--DQGIVHRDIKDENVIVDSQGFIK 1186

Query: 179  LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGV 238
            L DFGS   V   P +     FV        T  Y +PE+  L     + +  DIWA+G+
Sbjct: 1187 LIDFGSAAYVKSGPFDV----FV-------GTIDYAAPEV--LGGEPYVGKPQDIWAIGI 1233

Query: 239  FLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQV 296
             LY + +   PF    E  IL +  ++       ++  +LI+ +L  +P+KRP I ++
Sbjct: 1234 LLYTIIFKENPFYNIDE--ILEAELKFNTSTGACEDCVDLIKRILTRNPTKRPTIDEI 1289

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 128/298 (42%), Gaps = 46/298 (15%)

Query: 9    YTPGIILPVGSHQAKILKY-LTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLN 67
            +  G ++  GS  A  L   +T+G    V QVE+  Y + + + +            +++
Sbjct: 1140 WMKGEMIGKGSFGAVFLAMNITTGEMMAVKQVEVPKYGLQNETVV-----------NTVD 1188

Query: 68   VPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNT 127
              R EV  +K L ++  +V Y+   A          NG Y +FL  EY +G  +   +  
Sbjct: 1189 ALRLEVSTLKDL-DHLNIVQYLGFEAK---------NGIYSLFL--EYVAGGSVGSLI-- 1234

Query: 128  RLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCG 187
            R+  R  +  I ++   V QG++ +H+    +LHRD+K +N+L+      K+ DFG    
Sbjct: 1235 RMYGRFDDILIRHLTIQVLQGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDFG---- 1288

Query: 188  VIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYT 247
             I   +N     +   ++    T  + +PEM+   +    + K DIW+LG  + ++    
Sbjct: 1289 -ISRKSNDI---YSNSEMTMKGTVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGK 1342

Query: 248  TP---FEKEGENAILHSRYQYPAYPQ-----YSDNLKNLIRVMLMVDPSKRPNICQVV 297
             P   FE       +      P  P+      S+N K  +     +DP KRP   +++
Sbjct: 1343 RPWSNFEVVAAMFKIGQAKSAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLL 1400

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 93/192 (48%), Gaps = 28/192 (14%)

Query: 108 EVFLLMEYCSGKGLIDFMN-TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKI 166
           +++++MEYC+G  L   +   ++  +     + N++      VA ++  +  ++HRDIK 
Sbjct: 94  KLWVIMEYCAGGSLRTLLRPGKIDEKYLGVIVRNLL------VALLYIHKDNVIHRDIKA 147

Query: 167 ENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ---YRSPEMLSLSK 223
            NVLI+N    KLCDFG             +L    H   + T A    + +PE+  + +
Sbjct: 148 ANVLITNGGHVKLCDFGVAA----------QLTTANHK--RQTMAGTPYWMAPEV--IME 193

Query: 224 SIPINEKSDIWALGVFLYKVCYYTTPF-EKEGENAI-LHSRYQYPAYP--QYSDNLKNLI 279
            +  N K+DIW+LG+  Y++     P+ + E   A+ L ++ + P      YS  LK  I
Sbjct: 194 GVYYNTKADIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFI 253

Query: 280 RVMLMVDPSKRP 291
            + L  DP  RP
Sbjct: 254 ALCLDEDPEARP 265

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 94/200 (47%), Gaps = 29/200 (14%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           + +++EY  G     ++  +   RLKE     + S +  GV  +H+    L+HRD+K+EN
Sbjct: 125 IGIVLEYACGGEFYKYIQKK--RRLKEMNACRLFSQLISGVHYIHSKG--LVHRDLKLEN 180

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ---YRSPEMLSLSKSI 225
           +L+       + DFG V             +F   + L  T+     Y +PE++ +S   
Sbjct: 181 LLLDKNENLVITDFGFVN------------EFCSRNELMKTSCGSPCYAAPELV-ISAEP 227

Query: 226 PINEKSDIWALGVFLYKVCYYTTPFEKE---GENAILHSRYQYP-----AYPQYSDNL-K 276
               K+DIW+ GV LY +     P++ +    E + +   Y Y       +P Y   + +
Sbjct: 228 YEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRLYNYINSTPLKFPDYILPIPR 287

Query: 277 NLIRVMLMVDPSKRPNICQV 296
           +L+R ML+ DP KR N+ Q+
Sbjct: 288 DLLRRMLVSDPKKRINLKQI 307

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/272 (23%), Positives = 126/272 (46%), Gaps = 37/272 (13%)

Query: 31  GGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKT--SLNVPRAEVEAMKLLRNNKYVVSY 88
           G F  VY+      D  +G  +A   ++I  ++T   ++V   E+  +  LR   +V +Y
Sbjct: 45  GSFGDVYRA----IDKETGEMVAV--KIINLEETQDDIDVLAQEIYFLSELRA-PFVTTY 97

Query: 89  IDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQG 148
             ++                ++++ME+C G    D +    ++RL E ++  I+  V  G
Sbjct: 98  YKTYVE-----------DVSMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYG 146

Query: 149 VAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKN 208
           +  +H+ +   +HRD+K  N+L++++ E KL DFG V G I     +    FV       
Sbjct: 147 LEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG-VSGQIMATLKRNT--FV------- 194

Query: 209 TTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILHS---RYQY 265
            T  + +PE+++       +EK+DIW+LG+   ++     P+ K     +L +   R   
Sbjct: 195 GTPYWMAPEIIARDNG--YDEKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKPP 252

Query: 266 PAYPQYSDNLKNLIRVMLMVDPSKRPNICQVV 297
               +++ + ++ I + L  DP+ RP    ++
Sbjct: 253 RLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 99/203 (48%), Gaps = 31/203 (15%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILN------IMSHVSQGVAAMHALQPPLLHR 162
           ++ L+EY       DF+       +K++  LN        S +   V ++H +   ++HR
Sbjct: 199 LYFLLEYAPHG---DFLGL-----IKKYGSLNETCARYYASQIIDAVDSLHNIG--IIHR 248

Query: 163 DIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTE----LDFVQHDILKNTTAQYRSPEM 218
           DIK EN+L+    + KL DFG+   +   P+N  +     D          TA+Y SPE+
Sbjct: 249 DIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPEL 308

Query: 219 LSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGE----NAILHSRYQYPA-YPQYSD 273
           L+ + +   + + DIWA G  LY++     PF+   E      ++  +Y + A +PQ   
Sbjct: 309 LNDNYT---DSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQI-- 363

Query: 274 NLKNLIRVMLMVDPSKRPNICQV 296
            +K+L++ +L+ DP+ R  I Q+
Sbjct: 364 -VKDLVKKLLVRDPNDRLTIKQI 385

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 99/200 (49%), Gaps = 29/200 (14%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           + +++E+ SG     ++  + + RLKE     + + +  GV  MH+    L+HRD+K+EN
Sbjct: 125 IGIVLEFVSGGEFYKYI--QRKRRLKESSACRLFAQLISGVDYMHSKG--LVHRDLKLEN 180

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ---YRSPEMLSLSKSI 225
           +L+       + DFG V             +F + + L  T+     Y +PE++  +K+ 
Sbjct: 181 LLLDKHENLVITDFGFVN------------EFFEDNELMRTSCGSPCYAAPELVVSTKAY 228

Query: 226 PINEKSDIWALGVFLYKVCYYTTPFEKEGENAI---LHSRYQYPA-----YPQYSDNL-K 276
               K+D+W+ GV LY +     P++ + EN     +   YQY       +P+Y   + +
Sbjct: 229 EA-RKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYITQTPLKFPEYITPVPR 287

Query: 277 NLIRVMLMVDPSKRPNICQV 296
           +L+R +L+ +P +R ++  +
Sbjct: 288 DLLRRILVPNPRRRVSVRAI 307

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 66/281 (23%), Positives = 131/281 (46%), Gaps = 54/281 (19%)

Query: 30  SGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSLNVPRAE--VEAMKLLRNNKY--V 85
           SGG    Y++         G+N++   + +  +K     P+ E  +  + +++ +K+  +
Sbjct: 610 SGGVYTAYEI---------GTNVSVAIKQMNLEKQ----PKKELIINEILVMKGSKHPNI 656

Query: 86  VSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHV 145
           V++IDS+  K            +++++MEY  G  L D +   +   L E +I  +    
Sbjct: 657 VNFIDSYVLKG-----------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRET 702

Query: 146 SQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDI 205
             G+  +H+    +LHRDIK +N+L+S + + KL DFG  C  I       EL+  +  +
Sbjct: 703 LSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFG-FCAQIN------ELNLKRTTM 753

Query: 206 LKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYYTTPFEKEGENAILH----- 260
           +   T  + +PE++S  +  P   K DIW+LG+ + ++     P+  E     L+     
Sbjct: 754 VG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATN 808

Query: 261 --SRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEE 299
              + + P     S +LK  +   L V+P +R +  +++ +
Sbjct: 809 GTPKLKEPE--NLSSSLKKFLDWCLCVEPEERASATELLHD 847

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 130/288 (45%), Gaps = 39/288 (13%)

Query: 9   YTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTS--L 66
           YTP I     +H   + + +  G F  VY+       I   +N     +V+  + T+  L
Sbjct: 12  YTPRI---SKAHNYIVKECVGRGNFGDVYRA------IDRTTNKVVAIKVVDLENTNERL 62

Query: 67  NVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMN 126
            V   E+  +  L++  Y+++YI +    +            ++++MEYC G    D + 
Sbjct: 63  EVLAQEIFFLAELKS-PYIINYITTLLEDA-----------SMWIVMEYCGGGSCSDLLK 110

Query: 127 TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVC 186
               N L E ++  I   + +G+  +H  +   +HRDIK  N+L++ +   KL DFG V 
Sbjct: 111 YYFNNGLPEKKVAYITREILKGLQYLHEQKK--IHRDIKAANILLTEEGHVKLGDFG-VS 167

Query: 187 GVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFLYKVCYY 246
           G ++    +  +           T  + +PE+ S +     +EK DIW+LG+ ++++   
Sbjct: 168 GQLKSTLRRGTI---------VGTPYWMAPEVASQNIE-GYDEKIDIWSLGITVFELLKG 217

Query: 247 TTPFEKEGENAILH--SRYQYPAYP-QYSDNLKNLIRVMLMVDPSKRP 291
             P  K     +L   SR   P     YSD  K+ + + L+ +P++RP
Sbjct: 218 VPPLVKLDPIRVLANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERP 265

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 99/203 (48%), Gaps = 27/203 (13%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           + +++E+ SG     ++  + + RLKE     + + +  GV  MH     L+HRD+K+EN
Sbjct: 125 IGIVLEFVSGGEFYKYI--QRKRRLKESSACRLFAQLISGVNYMHYKG--LVHRDLKLEN 180

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQ--YRSPEMLSLSKSIP 226
           +L+       + DFG V              F  ++++K +     Y +PE++  +K+  
Sbjct: 181 LLLDKHENLVITDFGFVNEF-----------FEDNELMKTSCGSPCYAAPELVVSTKAYE 229

Query: 227 INEKSDIWALGVFLYKVCYYTTPFEKEGENAI---LHSRYQYPA-----YPQYSDNL-KN 277
              K+D+W+ GV LY +     P++ + EN     +   Y+Y       +P+Y   + ++
Sbjct: 230 A-RKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYKYITQTPLKFPEYITPIPRD 288

Query: 278 LIRVMLMVDPSKRPNICQVVEEV 300
           L+R +L+ +P +R N+  +   V
Sbjct: 289 LLRRILVPNPRRRINLQTIKRHV 311

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 132/302 (43%), Gaps = 50/302 (16%)

Query: 9   YTPGIILPVGSHQAKIL--KYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIVPDKTSL 66
           +  G  L VGS   K+L  + + +G  A V  +  S ++    + +        PD    
Sbjct: 20  WMLGETLGVGS-TGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSND----PDVLPY 74

Query: 67  NVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKGLIDFMN 126
            + R E+  MKLL N+  V+   D           V   S ++++++EY     L + + 
Sbjct: 75  GIER-EITIMKLL-NHPNVLRLYD-----------VWETSTDLYMVLEYVEKGELFNLLI 121

Query: 127 TRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLCDFGSVC 186
            R    L E E +     +  G++  HAL   ++HRD+K EN+L+ +K   KL DFG   
Sbjct: 122 ER--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKLADFGMAA 177

Query: 187 GVIRPPTNQTELDFVQHDILKNTTA---QYRSPEMLSLSKSIPINE-KSDIWALGVFLYK 242
                            D L  T+     Y +PE++S    +P +  +SD+W+ GV LY 
Sbjct: 178 -------------LESKDKLLETSCGSPHYAAPEIVS---GLPYHGFESDVWSCGVILYA 221

Query: 243 VCYYTTPFEKEGEN------AILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQV 296
           +     PF+++  N       +    ++ P   + S   ++LI  +L VDPS R    ++
Sbjct: 222 LLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREI 281

Query: 297 VE 298
           ++
Sbjct: 282 LK 283

>AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR466W
           (PKH3)
          Length = 726

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 92/198 (46%), Gaps = 28/198 (14%)

Query: 109 VFLLMEYCSGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIEN 168
           ++ +M+   G  L+  +  R Q    E    + M  +   V  +H++   ++HRD+K EN
Sbjct: 86  LYFVMDLAPGGELLQLL--RRQRVFSEAWARHYMCQLVDTVEYIHSMG--VIHRDLKPEN 141

Query: 169 VLISNKNEFKLCDFGSVCGVIRPPT----NQTELDFVQHDILKNTTAQYRSPEMLSLSKS 224
           VL+  +    + DFG+   V +       ++    FV        TA+Y SPE+L  +KS
Sbjct: 142 VLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFV-------GTAEYVSPELLLENKS 194

Query: 225 IPINEKSDIWALGVFLYKVCYYTTPFEKEGENAI------LHSRYQYPAYPQYSDNLKNL 278
                 SD+WALG  LY+    T PF  + E         L   ++ PA P  +     L
Sbjct: 195 Y---YSSDVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIPANPLAA----GL 247

Query: 279 IRVMLMVDPSKRPNICQV 296
           +  +L++DPS+R  + Q+
Sbjct: 248 VSKILVLDPSQRYTLEQI 265

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 79,364,341
Number of extensions: 3806857
Number of successful extensions: 23224
Number of sequences better than 10.0: 2439
Number of HSP's gapped: 21989
Number of HSP's successfully gapped: 2576
Length of query: 697
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 580
Effective length of database: 40,065,477
Effective search space: 23237976660
Effective search space used: 23237976660
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)