Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C033702.283ON41341322020.0
Kpol_1003.342.283ON38835211831e-161
KAFR0H033402.283ON36734911771e-160
Smik_14.2962.283ON38935111361e-154
Suva_14.3112.283ON38938911331e-153
SAKL0E07766g2.283ON39835111341e-153
YNL035C2.283ON38935111321e-153
TDEL0G021402.283ON39234211301e-153
Skud_14.2982.283ON38935711231e-152
Kwal_27.115502.283ON40735011171e-151
ZYRO0A01804g2.283ON37635111101e-150
KLTH0G10296g2.283ON42635011141e-150
TBLA0B059202.283ON40337310971e-148
KLLA0E08449g2.283ON42233310871e-146
KNAG0H020402.283ON39935010831e-146
Ecym_33212.283ON40935110821e-145
NDAI0G006302.283ON39736110791e-145
ADL218C2.283ON40335110161e-135
NCAS0G038702.283ON38935210151e-135
CAGL0G01628g2.283ON3763489561e-127
TBLA0A071206.9ON4071981498e-10
KNAG0E009806.9ON4141991401e-08
ZYRO0F00462g6.9ON3931851382e-08
KLTH0C11550g6.9ON3982581283e-07
ACR017W6.9ON4231821275e-07
Kpol_1045.786.9ON3921701266e-07
NDAI0K029006.9ON4381911257e-07
KLLA0D00814g6.9ON4081961222e-06
Ecym_30126.9ON3972131222e-06
KLTH0E12694g8.548ON4181731222e-06
Kpol_1041.202.401ON5152061151e-05
AEL250C8.548ON4171771132e-05
NCAS0F019702.401ON5111901123e-05
ADR242C2.401ON5212071123e-05
KAFR0A003802.401ON5161901106e-05
KAFR0L003206.9ON3911841097e-05
TPHA0G026502.401ON5162081098e-05
Skud_5.336.9ON4011841098e-05
NDAI0H027502.401ON5121441099e-05
Suva_5.126.9ON4011851071e-04
Suva_13.3112.401ON5101881071e-04
Kwal_27.120708.548ON418741062e-04
Ecym_70428.548ON414721043e-04
Sklu_YGOB_Anc_2.4012.401ON5201901034e-04
Smik_13.3292.401ON5091881034e-04
KNAG0E021802.401ON5171901034e-04
CAGL0B03575g6.9ON419681025e-04
TBLA0B092502.401ON5261851025e-04
YMR131C (RRB1)2.401ON5111881026e-04
Skud_13.2912.401ON5091931026e-04
SAKL0E00814g6.9ON3982581016e-04
Smik_5.316.9ON4271941008e-04
NCAS0F001906.9ON4111651000.001
KLTH0E09394g2.401ON522188990.001
ZYRO0A08690g2.401ON516197980.002
Kwal_47.178272.401ON523188980.002
KLLA0E23541g8.548ON41775980.002
TPHA0M001906.9ON391207970.002
CAGL0K03861g2.401ON513190980.002
TDEL0G033402.401ON514188960.003
Ecym_60672.401ON522190960.003
Smik_16.795.104ON593170950.005
YEL056W (HAT2)6.9ON401183940.005
TPHA0P014903.25ON459128930.006
NCAS0G011206.276ON494108930.006
TBLA0H036508.548ON419205910.011
SAKL0H09900g8.548ON42576910.011
KLLA0F17237g2.401ON523130910.013
TBLA0H020005.201ON473154900.014
YGR225W (AMA1)5.104ON593180900.018
TBLA0B043908.585ON336118860.040
Suva_7.5185.104ON593145870.040
SAKL0G01628gna 1ON95981870.041
KLLA0E07085g3.25ON452125860.044
KNAG0I010508.288ON1159121870.049
CAGL0J01265g2.469ON517112860.050
Skud_7.5615.104ON593145850.065
KNAG0A036708.548ON426112850.069
KAFR0A006902.469ON508122850.070
KLTH0F19294g3.25ON451118840.071
NDAI0E015008.631ON42856840.079
Kpol_1014.193.25ON452128830.098
KAFR0F033404.119ON40941830.10
Kwal_55.220673.25ON451118830.12
SAKL0C13266g3.25ON459126820.13
ACR097W8.631ON46797820.13
KNAG0E024702.469ON509141820.14
Ecym_20243.22ON131768830.14
Suva_7.519na 2ON20570800.14
KNAG0D007406.276ON504107820.15
Suva_16.606.276ON52686810.17
ZYRO0G10406g4.119ON39137810.17
ZYRO0G03146g2.469ON510112810.17
TBLA0B046805.49ON1549160820.18
YOR212W (STE4)8.631ON42380810.18
NCAS0C039908.67ON730157810.19
KNAG0F038707.534ON465108810.21
TDEL0A068906.276ON44753800.25
KAFR0C029508.150ON48396800.26
KLTH0G13068g8.288ON110145800.27
TBLA0H030601.247ON73075800.27
CAGL0A00561g4.119ON41274790.28
Smik_14.143.25ON466128790.30
NDAI0F012406.276ON52475790.34
KAFR0A033801.247ON666136790.34
ABL044C2.469ON518110790.35
KLLA0D02530g4.309ON70745790.37
Suva_4.4498.548ON424141780.38
TBLA0B087303.25ON461124790.38
Smik_16.4427.534ON47082790.38
ZYRO0A09636g8.435ON808131790.42
TDEL0A048205.615ON326175780.43
YPR178W (PRP4)7.534ON465124780.43
SAKL0D09262gna 3ON122891790.43
ZYRO0D01122g7.534ON466162780.44
KAFR0F010606.276ON553107780.44
TBLA0A023106.276ON53172780.47
Smik_6.4516.276ON523113780.50
CAGL0G04345g1.247ON711207780.51
NCAS0A078602.469ON510107770.54
TPHA0D044807.310ON134098780.55
AEL269C7.534ON455158770.58
KLLA0F19734g8.288ON113345770.61
Kwal_26.77362.469ON507112770.62
TDEL0F002701.534ON70568770.69
Kwal_47.173108.133ON553101760.72
TDEL0A024502.469ON510112760.72
Kwal_56.223456.9ON396135760.74
Kwal_56.236858.288ON110245770.76
NCAS0B021708.548ON414139760.76
TBLA0I012202.469ON511147760.82
Kpol_1025.384.119ON42053750.92
TPHA0G018408.631ON43156750.92
KNAG0J024903.335ON720135760.97
KLTH0D05346g2.469ON507112750.99
SAKL0H07656g8.631ON42661750.99
Skud_12.2858.435ON817133751.00
TDEL0E054806.239ON88178751.1
NCAS0I024903.95ON62639751.1
Skud_16.326.276ON522117751.1
Suva_16.5107.534ON46582751.2
Suva_14.223.25ON469128741.3
TDEL0A057708.631ON43356741.3
KNAG0A030808.651ON446190741.4
CAGL0D05588g5.201ON477153741.4
SAKL0F15972g7.534ON470109741.4
Kwal_55.220763.22ON128668741.4
SAKL0E03080g2.469ON515150741.4
KNAG0D034604.119ON41240741.4
TPHA0L017208.548ON419121731.5
SAKL0C13332g3.22ON135366741.5
TPHA0C010508.288ON112496741.5
ZYRO0G10494g4.123ON432141731.6
Kwal_23.53517.534ON474106731.7
YNL317W (PFS2)3.25ON465128731.7
Kwal_26.87008.651ON38176731.8
Kwal_27.122398.585ON31665721.8
Kwal_47.175554.119ON41762731.8
Kpol_1072.418.631ON42057731.8
Smik_15.3988.631ON42580731.9
Ecym_42808.288ON113245732.0
KAFR0I028403.25ON456170732.0
KAFR0G019708.631ON42556722.1
SAKL0A02970g6.276ON41551722.1
TDEL0B020108.435ON805123732.2
Skud_14.223.25ON467128722.3
Suva_10.3168.435ON818119722.5
NDAI0C055108.548ON419142712.6
Skud_15.3798.631ON42566712.7
NDAI0F009205.615ON35296712.7
Suva_5.178na 4ON32287712.8
SAKL0D04532g3.231ON557141713.0
ZYRO0A13068g8.548ON397153713.0
KLTH0D10186g8.631ON42156713.1
TPHA0G025002.450ON94544713.1
Smik_4.457.310ON1270112713.3
TPHA0I004608.817ON56046713.3
ZYRO0E08184g6.276ON50652713.4
Kpol_1013.377.534ON468119703.6
TPHA0L016908.544ON832111713.6
KLTH0F19338g3.22ON129066713.7
NCAS0F033405.429ON44844703.8
CAGL0L02629g8.67ON795131704.0
TBLA0B040708.631ON41725704.1
TPHA0G007208.717ON51580704.1
NDAI0J003307.534ON47273704.2
TPHA0K007807.405ON361119704.2
Smik_12.2798.435ON817198704.2
KLTH0G12276g8.324ON93778704.3
KLLA0E20967g3.22ON132168704.4
KLTH0A07634g6.378ON48765694.8
Smik_5.200na 4ON391104694.9
CAGL0M05291g8.548ON419146695.0
TPHA0D035906.276ON59872695.0
AFL157C6.276ON43898695.0
ACR194C7.333ON51366695.2
TBLA0D021608.150ON54994695.6
Skud_12.5214.309ON64541695.7
KAFR0B055808.288ON1120113696.2
KLLA0F27159g8.82ON57680696.3
KAFR0I008408.548ON413143686.6
Ecym_55285.429ON47147686.6
YLR222C (UTP13)8.435ON817119696.6
KLTH0E13552g8.585ON31656686.9
TPHA0B011201.247ON719110687.1
Kpol_1060.246.276ON486148687.2
KLTH0H03608g6.239ON87566687.2
KLLA0A09471g5.49ON150635687.4
CAGL0M06193g8.585ON31658677.7
TPHA0D005808.67ON732167688.0
TBLA0C039904.123ON43745678.0
SAKL0F10384g7.310ON1261128688.3
NCAS0B01440na 5ON428174678.5
YDL195W (SEC31)7.310ON1273101688.5
Ecym_42498.316ON374203678.6
KLTH0D15840g4.309ON69763688.6
Suva_8.2658.631ON42378678.7
Kpol_2000.391.107ON44336678.9
NDAI0J011808.288ON1134122688.9
TDEL0A052908.585ON31958679.2
NCAS0A105003.259ON47836679.4
YPL247C6.276ON523113679.5
NCAS0B035508.316ON37530679.9
ADL186C3.22ON136168679.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C03370
         (413 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...   852   0.0  
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...   460   e-161
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...   457   e-160
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...   442   e-154
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...   441   e-153
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...   441   e-153
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...   440   e-153
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...   439   e-153
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...   437   e-152
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...   434   e-151
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...   432   e-150
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...   433   e-150
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...   427   e-148
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...   423   e-146
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...   421   e-146
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...   421   e-145
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...   420   e-145
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...   395   e-135
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283    395   e-135
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...   372   e-127
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    62   8e-10
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    59   1e-08
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    58   2e-08
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    54   3e-07
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    54   5e-07
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    53   6e-07
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      53   7e-07
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    52   2e-06
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    52   2e-06
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    52   2e-06
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    49   1e-05
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    48   2e-05
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    48   3e-05
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    48   3e-05
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    47   6e-05
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    47   7e-05
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    47   8e-05
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    47   8e-05
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    47   9e-05
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    46   1e-04
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    46   1e-04
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    45   2e-04
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    45   3e-04
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    44   4e-04
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    44   4e-04
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    44   4e-04
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    44   5e-04
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    44   5e-04
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    44   6e-04
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    44   6e-04
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    44   6e-04
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    43   8e-04
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    43   0.001
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    43   0.001
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    42   0.002
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    42   0.002
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    42   0.002
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    42   0.002
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    42   0.002
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    42   0.003
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    42   0.003
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    41   0.005
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    41   0.005
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    40   0.006
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    40   0.006
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    40   0.011
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...    40   0.011
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    40   0.013
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    39   0.014
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    39   0.018
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    38   0.040
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    38   0.040
SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {...    38   0.041
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    38   0.044
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    38   0.049
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    38   0.050
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    37   0.065
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    37   0.069
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    37   0.070
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    37   0.071
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    37   0.079
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    37   0.098
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    37   0.10 
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    37   0.12 
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    36   0.13 
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    36   0.13 
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    36   0.14 
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    37   0.14 
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    35   0.14 
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    36   0.15 
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    36   0.17 
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    36   0.17 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    36   0.17 
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    36   0.18 
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    36   0.18 
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    36   0.19 
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    36   0.21 
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    35   0.25 
KAFR0C02950 Chr3 complement(589512..590963) [1452 bp, 483 aa] {O...    35   0.26 
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    35   0.27 
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    35   0.27 
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    35   0.28 
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    35   0.30 
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    35   0.34 
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    35   0.34 
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    35   0.35 
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    35   0.37 
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    35   0.38 
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    35   0.38 
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    35   0.38 
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    35   0.42 
TDEL0A04820 Chr1 (848835..849815) [981 bp, 326 aa] {ON} Anc_5.61...    35   0.43 
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    35   0.43 
SAKL0D09262g Chr4 complement(766195..769881) [3687 bp, 1228 aa] ...    35   0.43 
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    35   0.44 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    35   0.44 
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    35   0.47 
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    35   0.50 
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    35   0.51 
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    34   0.54 
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    35   0.55 
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    34   0.58 
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    34   0.61 
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    34   0.62 
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    34   0.69 
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    34   0.72 
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    34   0.72 
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    34   0.74 
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    34   0.76 
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    34   0.76 
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    34   0.82 
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    33   0.92 
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    33   0.92 
KNAG0J02490 Chr10 (467902..470064) [2163 bp, 720 aa] {ON} Anc_3....    34   0.97 
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    33   0.99 
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    33   0.99 
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    33   1.00 
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    33   1.1  
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    33   1.1  
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    33   1.1  
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    33   1.2  
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    33   1.3  
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    33   1.3  
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    33   1.4  
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    33   1.4  
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    33   1.4  
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    33   1.4  
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    33   1.4  
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    33   1.4  
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....    33   1.5  
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    33   1.5  
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    33   1.5  
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    33   1.6  
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    33   1.7  
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    33   1.7  
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    33   1.8  
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    32   1.8  
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    33   1.8  
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    33   1.8  
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    33   1.9  
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    33   2.0  
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    33   2.0  
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    32   2.1  
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    32   2.1  
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    33   2.2  
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    32   2.3  
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    32   2.5  
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    32   2.6  
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    32   2.7  
NDAI0F00920 Chr6 complement(225382..226440) [1059 bp, 352 aa] {O...    32   2.7  
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    32   2.8  
SAKL0D04532g Chr4 complement(362288..363961) [1674 bp, 557 aa] {...    32   3.0  
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    32   3.0  
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    32   3.1  
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    32   3.1  
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    32   3.3  
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    32   3.3  
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    32   3.4  
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    32   3.6  
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    32   3.6  
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    32   3.7  
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    32   3.8  
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    32   4.0  
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    32   4.1  
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    32   4.1  
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      32   4.2  
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    32   4.2  
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    32   4.2  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    32   4.3  
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    32   4.4  
KLTH0A07634g Chr1 complement(642477..643940) [1464 bp, 487 aa] {...    31   4.8  
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    31   4.9  
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...    31   5.0  
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    31   5.0  
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    31   5.0  
ACR194C Chr3 complement(690186..691727) [1542 bp, 513 aa] {ON} S...    31   5.2  
TBLA0D02160 Chr4 complement(544468..546117) [1650 bp, 549 aa] {O...    31   5.6  
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    31   5.7  
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    31   6.2  
KLLA0F27159g Chr6 (2508838..2510568) [1731 bp, 576 aa] {ON} simi...    31   6.3  
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    31   6.6  
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    31   6.6  
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    31   6.6  
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    31   6.9  
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    31   7.1  
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    31   7.2  
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    31   7.2  
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    31   7.4  
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    30   7.7  
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    31   8.0  
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    30   8.0  
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    31   8.3  
NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON}               30   8.5  
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    31   8.5  
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    30   8.6  
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    31   8.6  
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    30   8.7  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    30   8.9  
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    31   8.9  
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    30   9.2  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    30   9.4  
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    30   9.5  
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    30   9.9  
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    30   9.9  

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score =  852 bits (2202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/413 (100%), Positives = 413/413 (100%)

Query: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60
           MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS
Sbjct: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60

Query: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120
           LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE
Sbjct: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120

Query: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
           LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ
Sbjct: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180

Query: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240
           EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR
Sbjct: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240

Query: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300
           GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI
Sbjct: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300

Query: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSDDYNMLVGRN 360
           PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSDDYNMLVGRN
Sbjct: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSDDYNMLVGRN 360

Query: 361 NEQYGENSEIKKHIKPLMITKKSRNIKAKNINRNVIKTNTPQRLVLNLIRICL 413
           NEQYGENSEIKKHIKPLMITKKSRNIKAKNINRNVIKTNTPQRLVLNLIRICL
Sbjct: 361 NEQYGENSEIKKHIKPLMITKKSRNIKAKNINRNVIKTNTPQRLVLNLIRICL 413

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score =  460 bits (1183), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 220/352 (62%), Positives = 274/352 (77%), Gaps = 7/352 (1%)

Query: 2   SAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSL 61
           S  L++  + G  +WCLEL+PLY  GLL S SNG VNL+DWN+ + I+  + G T+IN +
Sbjct: 3   SYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRM 62

Query: 62  RVINNDFENGCIFAATSLASVKIYDVR-NGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120
           RV+++D++NG +F+     +VK+ D+R  G+S VA + N+K + FLSL+SRH ML CGTE
Sbjct: 63  RVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTE 122

Query: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
           L+GVDAE+ IYD+R F KPVR  VDSHHDD+TDIKFHPSD N+LLSGSTDGYTN+YDL Q
Sbjct: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182

Query: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240
            +E++ALHQVINY S+HSCGWLSPKRIYTLSHMETFAIHELN+KSDELTEP+PLDFGDIR
Sbjct: 183 VEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242

Query: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300
           G WDCDYVVD+YPGY+A+GKS EN G LKI  F NE++N  + I IPNAHGDEV+RDVFI
Sbjct: 243 GTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFI 302

Query: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSDD 352
            P + N    I+YSCGEDG+V  W     S  L V   FW+ + Q++VL D+
Sbjct: 303 SPKSQN----IMYSCGEDGSVKTWKIENNS--LQVPPGFWDYSTQINVLDDN 348

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score =  457 bits (1177), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 211/349 (60%), Positives = 272/349 (77%), Gaps = 7/349 (2%)

Query: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60
           MS  LV + +FG+DNWCL+ +PLY+ GLL S SNG V L+DW + + ++ F++ + +INS
Sbjct: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60

Query: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120
           +++INND+ N  +FA  +L SVKIYD+++ D  +ATI NDK S FLSL+SRHDML CGTE
Sbjct: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDC-IATITNDKKSPFLSLDSRHDMLACGTE 119

Query: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
           L GVDAE++IYDVR +S PV++FVDSHHDDITDIKFHPSD N LLSGSTDGYTN+YDL Q
Sbjct: 120 LQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179

Query: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240
           ++ED+AL+QVINYASIHSCGWLSP+RIYTLSHMETF+I ELND++DEL EP+PLDFGDIR
Sbjct: 180 QEEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIR 239

Query: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300
            QW+CDYV+D+YPGY+A G+S E  G L+I   + E + +   I I  AH DEVIRDVFI
Sbjct: 240 DQWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFI 299

Query: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVL 349
           P     NH +++YSCGEDG V  W +P   S     ++FW+ +++ +V 
Sbjct: 300 P----RNHHNVLYSCGEDGTVKSWKSPHSQS--TALEEFWDYSQRFNVF 342

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  442 bits (1136), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 271/351 (77%), Gaps = 7/351 (1%)

Query: 2   SAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSL 61
           S  LV    FG++NWCL+L+P Y  GLL   SNG + L+DW +   ++  +  ET IN L
Sbjct: 3   SYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDL 62

Query: 62  RVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTEL 121
           +VI++DF  G + ++ S+ +VK++D+R  +S +ATI+N+ NS FLSL+SRH +L CGTEL
Sbjct: 63  KVIDSDFSAGHLVSSASIDAVKVFDIRT-NSCIATIQNESNSPFLSLDSRHGLLACGTEL 121

Query: 122 TGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
            G+DA + IYD+R +  P+R+ +DSHHDD+T IKFHPSD NILLSGSTDGYTNIYDL Q+
Sbjct: 122 QGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181

Query: 182 DEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIRG 241
           +E++ALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDEL EP+PLDFGD+R 
Sbjct: 182 EEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRK 241

Query: 242 QWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFIP 301
            WDCDYVVD+YPG +A GK+ ENAGEL++  F+NE + TE   +IP+AHGDEV+RD+FI 
Sbjct: 242 AWDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFIS 301

Query: 302 PGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSDD 352
                + SD++YSCGEDG V IW + +    LN  + FW+ +E+++VL DD
Sbjct: 302 A----HQSDMLYSCGEDGYVKIWKSTQ--GPLNTPETFWDYSEKMNVLGDD 346

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  441 bits (1133), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 217/389 (55%), Positives = 283/389 (72%), Gaps = 22/389 (5%)

Query: 2   SAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSL 61
           S  LV+  +FG++NWCL+L+P Y  GLL   SNG + L+DWN+   ++K    ET IN +
Sbjct: 3   SYSLVDLNSFGSENWCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRASETAINDM 62

Query: 62  RVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTEL 121
           ++I++DF  G + ++ S+ SVK++D+R+ D  VA I N+ NS FLSL+SRH +L CGTEL
Sbjct: 63  KIIDSDFVAGNLISSASIDSVKVFDIRSNDC-VAKINNETNSPFLSLDSRHGLLACGTEL 121

Query: 122 TGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
            G+DA + IYDVR +  P+R+ VDSHHDD+T IKFHPSD N+LLSGSTDGYTNIYDL Q+
Sbjct: 122 QGIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181

Query: 182 DEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIRG 241
           DE++ALHQVINYASIHSCGWLSPKRIYTLSHMETF+IHELNDKSDEL EP+PLDFGDIR 
Sbjct: 182 DEEDALHQVINYASIHSCGWLSPKRIYTLSHMETFSIHELNDKSDELKEPQPLDFGDIRK 241

Query: 242 QWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFIP 301
            W+CDYVVD+YPG++A GK+ E AGEL++  F++E ++T N I+IP+AHGDEV+RDVF+ 
Sbjct: 242 AWNCDYVVDVYPGFIATGKTQEGAGELRLLPFKDEKIDTGNGIVIPHAHGDEVVRDVFVS 301

Query: 302 PGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSDDYNMLVGRNN 361
             N    +D++YSCGEDG V IW        LN    FW+ +E++ VL D          
Sbjct: 302 EQN----TDVLYSCGEDGCVKIWK--NSLGCLNTPASFWDYSERISVLED---------- 345

Query: 362 EQYGENSEIKKHI-KPLMITKKSRNIKAK 389
               EN E    + +PL+I K+S   K +
Sbjct: 346 ----ENKEAPTSLEEPLIIQKESVATKPR 370

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score =  441 bits (1134), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 203/351 (57%), Positives = 274/351 (78%), Gaps = 7/351 (1%)

Query: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60
           MS   ++  +FG +NWCL+L+PLY+RGLL S SNG ++L+DW +  II +F     +I++
Sbjct: 1   MSYSKLHTASFGCENWCLQLQPLYNRGLLTSLSNGHIHLVDWCTGEIIHEFAAHSASISN 60

Query: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120
           L+V+NN+F N  +FA+ S  SVKI+DVR   S VAT+ NDK++ FLSL+SRHDML CGTE
Sbjct: 61  LKVLNNEFTNSDLFASASKDSVKIFDVRTS-SCVATLHNDKSAPFLSLDSRHDMLACGTE 119

Query: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
           L+GVDAE+ IYD++  SKP+R+FVDSHHDDITD KFHP D  +L+SGSTDGY NIYDL  
Sbjct: 120 LSGVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTN 179

Query: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240
            DE++ALHQVIN+AS+HSCGWL+P+RIYTLSHMETFAIHELNDKSD+L EP+P++FGD+R
Sbjct: 180 SDEEDALHQVINFASVHSCGWLAPRRIYTLSHMETFAIHELNDKSDDLREPKPVEFGDVR 239

Query: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300
             W CDY++++ PG++A G+S E  GELK+  F +E ++T N + IP AHGDE+IRDV I
Sbjct: 240 QPWGCDYIININPGFIAAGRSQETQGELKLIAFNDEKVDTTNVLTIPQAHGDEIIRDVLI 299

Query: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSD 351
           P    +  +D++YSCGEDG +NIW +   +  LN+S+DFW+ +++ +V  D
Sbjct: 300 P----DQTTDMLYSCGEDGCLNIWKSQ--TGPLNISRDFWDYSKRFNVFED 344

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score =  440 bits (1132), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 203/351 (57%), Positives = 275/351 (78%), Gaps = 7/351 (1%)

Query: 2   SAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSL 61
           S  LV   +FG++NWCL+L+P Y  GLL   SNG + L+DW++   ++K +  ET IN +
Sbjct: 3   SYSLVESNSFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASETAINDM 62

Query: 62  RVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTEL 121
           +VI +DF  G + ++ S+ +VK++D+R  D  +A I+N+ NS F+SL+SRH +L CGTEL
Sbjct: 63  KVIGSDFSAGHLVSSASIDAVKVFDIRTNDR-IAQIQNEANSPFISLDSRHGLLACGTEL 121

Query: 122 TGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
            G+DA ++IYD+R +  P+R+ +DSHHDD+T IKFHPSD NILLSGSTDGYTNIYDL Q+
Sbjct: 122 QGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQD 181

Query: 182 DEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIRG 241
           +E++ALHQVINYASIHSCGWLSPKRI+TLSHMETFAIHELNDKSDEL EP+PLDFGD+R 
Sbjct: 182 EEEDALHQVINYASIHSCGWLSPKRIFTLSHMETFAIHELNDKSDELKEPQPLDFGDVRE 241

Query: 242 QWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFIP 301
            W+CDYVVD+YPG +A GK+ EN GEL +  F++E ++TEN I+IP+AHGDEV+RD+FIP
Sbjct: 242 IWNCDYVVDIYPGLIATGKTQENCGELCLLPFKDEKVDTENGIVIPHAHGDEVVRDIFIP 301

Query: 302 PGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSDD 352
                 HS+++YSCGEDG V IW   +    L++ ++FW+ +++++VL DD
Sbjct: 302 A----QHSNMLYSCGEDGCVKIWENKQ--GPLDIPENFWDYSKKMNVLGDD 346

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score =  439 bits (1130), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 206/342 (60%), Positives = 265/342 (77%), Gaps = 7/342 (2%)

Query: 11  FGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFEN 70
           FG+DNWCL L+P Y+  LL S SNG V+ IDW +   ++  + G ++IN L++I+++F  
Sbjct: 12  FGSDNWCLGLQPFYNHHLLTSLSNGEVHHIDWVTGKSVRVDQAGNSSINKLKIIDSNFNE 71

Query: 71  GCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFI 130
           G  +A  S  SV I DVR+ D  +A++KNDKN+ FLSL+SRH ML CGTEL+GVDAE+ I
Sbjct: 72  GSSYAVASNDSVNILDVRSRDK-LASLKNDKNAPFLSLDSRHGMLACGTELSGVDAELHI 130

Query: 131 YDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQV 190
           YDVR +S P+R+FVDSHHDD+TDI+FHPSD+N+LLSGSTDGYTN+YDL Q++ED+ALHQV
Sbjct: 131 YDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQQEEDDALHQV 190

Query: 191 INYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIRGQWDCDYVVD 250
           INYASIHSCGWLSPKRI+TLSHMET A+HELNDKSDEL EP+PLDFGDIR +W C YVVD
Sbjct: 191 INYASIHSCGWLSPKRIFTLSHMETLAMHELNDKSDELREPQPLDFGDIREKWGCSYVVD 250

Query: 251 LYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFIPPGNLNNHSD 310
           LYPGYVA+G S E +  LK+   ENE + TE  ++IP+AHG+EV+RDV IPP N N    
Sbjct: 251 LYPGYVAVGSSQERSSFLKLMALENEQIETEKSLVIPSAHGEEVVRDVLIPPQNCN---- 306

Query: 311 IIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSDD 352
           ++YSCGEDG V IW         ++   FW+ ++++DV S++
Sbjct: 307 MLYSCGEDGTVKIWKTKDTG--FHIEPGFWDYSKKMDVFSEE 346

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  437 bits (1123), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 207/357 (57%), Positives = 269/357 (75%), Gaps = 13/357 (3%)

Query: 2   SAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSL 61
           S  LV   +FG++NWCL+L+P Y  GLL   SNG + L+DWNS   ++K +  ET+IN L
Sbjct: 3   SYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL 62

Query: 62  RVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTEL 121
           +VI++DF  G + ++ S+ +VK++D+R  ++ VA I N+ NS F+SL+SRH +L CGTEL
Sbjct: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRT-NACVAKIHNEANSPFISLDSRHGLLACGTEL 121

Query: 122 TGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
            G+DA ++IYD+R +  P+R+ +DSHHDD+T IKFHPSD N+LLSGSTDGYTNIYDL Q+
Sbjct: 122 QGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQD 181

Query: 182 DEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIRG 241
           +E++ALHQVINYASIHSCGWLS KRIYTLSHMETFAIHELNDKSDE  EPRP DFGDIR 
Sbjct: 182 EEEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIRE 241

Query: 242 QWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFIP 301
            W+CDYVVD+YPG +A GK+ E AGEL++  F +E ++ EN I+IP AHGDEV+RDVFI 
Sbjct: 242 AWNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFIS 301

Query: 302 PGNLNNHSDIIYSCGEDGNVNIWH---APRCSSILNVSKDFWNATEQLDVLSDDYNM 355
                  SD++YSCGEDG V IW     P     LN  + FW+ +E+L+VL +D+  
Sbjct: 302 AL----QSDLLYSCGEDGFVKIWKNNLGP-----LNTPESFWDYSEKLNVLDEDHKQ 349

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score =  434 bits (1117), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 207/350 (59%), Positives = 265/350 (75%), Gaps = 7/350 (2%)

Query: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60
           MS   V+ I FG DNWCL+L+PLY+RGLL S SNGSV LIDW     I + +   T I+ 
Sbjct: 1   MSYSKVDSINFGADNWCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISD 60

Query: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120
           + V+NND  NG + A  +  SVKI+D+R+ D+ VAT+KN+K++ FLSL+SRH ML CGTE
Sbjct: 61  MVVLNNDRNNGFLIATAAEDSVKIFDLRSSDT-VATLKNEKSAPFLSLDSRHGMLACGTE 119

Query: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
           L+GVDAE+ IYD++ + +P+R+ VDSHHDDIT+IKFHP+D N+LLSGSTDGY NIYDL Q
Sbjct: 120 LSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQ 179

Query: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240
            +ED+ALHQVIN+ASIHS GW +PKRIYTLSHMETF IHELNDK +E TEP P DFGDIR
Sbjct: 180 PEEDDALHQVINFASIHSSGWCAPKRIYTLSHMETFGIHELNDKLEEPTEPHPKDFGDIR 239

Query: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300
             W CDYVVD+YPG++A GKS E  GE+K+  F  E ++ ++ + IP+AHGDEV+RDV +
Sbjct: 240 QSWGCDYVVDVYPGFIATGKSQEGQGEVKLIPFTGEDLDLDSAVTIPSAHGDEVVRDVLV 299

Query: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLS 350
           P      H D++Y+CGEDG VN W + R    LNV ++FW+  +Q+DV S
Sbjct: 300 P----FQHEDMLYTCGEDGCVNAWKSNRGP--LNVPQEFWSYADQIDVFS 343

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score =  432 bits (1110), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 205/351 (58%), Positives = 264/351 (75%), Gaps = 7/351 (1%)

Query: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60
           MS  LVN  +FGN+NWCL L+P Y   LL S SNG V+ +DW +   I   + GE  +N 
Sbjct: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60

Query: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120
           L++INND EN   +A  ++ +VKI+D+R+ +  +ATI NDKN+ FLSL+SRH+ML CGTE
Sbjct: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNC-LATISNDKNAPFLSLDSRHNMLACGTE 119

Query: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
           L+G DAE+ IYDVR +  P+R+ VDSHHDDITDI FHPSD N+L+SGSTDGYTNIYDL Q
Sbjct: 120 LSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ 179

Query: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240
            +E++ALHQVIN+ASIHSCGWL+P+RI+TLSHMETF+IHELNDKSDE  EPRP++F D+R
Sbjct: 180 AEEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVR 239

Query: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300
             W CDYVVD++PGYVA G S E  G+L+I  F+ E ++T N I I  AHGDEV+RDVF+
Sbjct: 240 ESWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFV 299

Query: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSD 351
           P  N    S ++YSCGEDG+V  W     S  LNV+ +FW+ ++ L+VL +
Sbjct: 300 PARN----SKLLYSCGEDGSVKTWENK--SGPLNVTDEFWDYSQLLNVLDE 344

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score =  433 bits (1114), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 200/350 (57%), Positives = 266/350 (76%), Gaps = 7/350 (2%)

Query: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60
           MS   +  I FG +NWCL+L+P+Y+ GLL S SNG V LIDW +   I + +   T++N 
Sbjct: 20  MSYSKLESIEFGPNNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQTHATSVND 79

Query: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120
           + +INND  NG + A  +  +VKIYD+++ D  VAT+KN K++ FLSL+SRH +L CGTE
Sbjct: 80  MVIINNDRMNGSLIATAAEDAVKIYDLKSNDC-VATLKNGKSAPFLSLDSRHGLLGCGTE 138

Query: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
           L+GVDAE+ +YD+R + +P+R+ VDSHHDDIT IKFHPSD N+LLSGSTDGY NIYDL Q
Sbjct: 139 LSGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQ 198

Query: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240
           ++ED+ALHQVIN+ASIHSCGWLSPKRIYTLSHMET+ IHELNDK DE TEP+P+DFGD+R
Sbjct: 199 QEEDDALHQVINFASIHSCGWLSPKRIYTLSHMETYGIHELNDKRDEPTEPKPVDFGDVR 258

Query: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300
             WDC+YV+D+YPG++A GKS E  GELK+   ++E    ++ I IP+AH DEV+RDV +
Sbjct: 259 KPWDCNYVIDVYPGFIATGKSEEGRGELKLIPLDHEKPELQSAITIPSAHDDEVVRDVLV 318

Query: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLS 350
           P      H D++YSCGEDG++ +W +   +  LNV ++FW  +E++DV S
Sbjct: 319 P----FQHEDLLYSCGEDGSLKVWKS--SAGPLNVPQEFWQYSEKIDVFS 362

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score =  427 bits (1097), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 202/373 (54%), Positives = 279/373 (74%), Gaps = 13/373 (3%)

Query: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60
           MS   +N  +FG++NWCL+ KPLY+ GLL S SNG ++++DW +  I  K ++GET+IN 
Sbjct: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60

Query: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120
             ++NN++  G +    +  SVKIYD+++ D  + TI N+KNS FLSL+S H+M+ CGTE
Sbjct: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDC-IKTITNEKNSPFLSLDSLHNMMACGTE 119

Query: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
           L+GVDAE++IYD+R +  P+R+FVDSHHDDITDIKFHP+D  +L+SGSTDGYTNIYDL +
Sbjct: 120 LSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTE 179

Query: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240
            +E+++LHQVINY+SIHSCGWLS +RI+TLSHMETFAIH+LNDKS+ L EP+P++FGDIR
Sbjct: 180 TEEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIR 239

Query: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMN--TENHIIIPNAHGDEVIRDV 298
             W C+YV+D+YPGY+A GK+ E+ G+LKI  F NE ++   +N+IIIP AHGDEVIRDV
Sbjct: 240 NDWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDV 299

Query: 299 FIPPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVL------SDD 352
           FI P + +N    +YSCGEDGNV +W     +  L + + F++ + +L+VL       DD
Sbjct: 300 FINPNDPSN----MYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLRLNVLDEINENDDD 355

Query: 353 YNMLVGRNNEQYG 365
             + +G  N + G
Sbjct: 356 IEVDMGTENTEPG 368

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score =  423 bits (1087), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 195/333 (58%), Positives = 259/333 (77%), Gaps = 7/333 (2%)

Query: 11  FGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFEN 70
           F  +NWCL+L+PLY  GL+ S S+GSV+L+DW +   I   +   T+IN ++VIN+DF+ 
Sbjct: 11  FEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSINDMKVINSDFDT 70

Query: 71  GCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFI 130
           G +FA  +   VK++D+R  ++ VA+++NDK S F SL+SRH+ML CGTEL   DAE+ I
Sbjct: 71  GAVFATAAEDGVKVWDIRARNN-VASLQNDKASPFFSLDSRHNMLACGTELKDYDAELHI 129

Query: 131 YDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQV 190
           YD+R ++KPVR+FVDSHHDDITDIKFHP D N+L+SGSTDGY NIYDL Q+DE++ALHQV
Sbjct: 130 YDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQDDEEDALHQV 189

Query: 191 INYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIRGQWDCDYVVD 250
           IN+ASIHSCGWL PKRI++LSHMETF IHELNDKSDE+ EP+PL+FGD+R +W CDYV+D
Sbjct: 190 INFASIHSCGWLGPKRIWSLSHMETFGIHELNDKSDEMIEPKPLEFGDVRDKWGCDYVID 249

Query: 251 LYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFIPPGNLNNHSD 310
           +YP ++A GK+ E+ GELKI  F+NE ++  + ++IP+AHG+EVIRDV IP     N + 
Sbjct: 250 IYPSFIATGKTHESQGELKIIPFQNEQVDVSSALVIPDAHGNEVIRDVLIP----KNQTS 305

Query: 311 IIYSCGEDGNVNIWHAPRCSSILNVSKDFWNAT 343
           ++YSCGEDG VN+W     S  LNV  +FW+ T
Sbjct: 306 LLYSCGEDGYVNVWKDTTNS--LNVPHNFWDYT 336

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score =  421 bits (1083), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 205/350 (58%), Positives = 264/350 (75%), Gaps = 8/350 (2%)

Query: 11  FGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFEN 70
           FG++NWC +++PLY  G+L S SNG V+L+DW S   I KF+  ET IN+L+++N D+ N
Sbjct: 12  FGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN 71

Query: 71  GCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFI 130
              F   S+ +VK++DVR+ ++ + TI N+  + FLSL+SR+D + CGTEL GVDA++ I
Sbjct: 72  ETRFITASMHAVKLFDVRS-NACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHI 130

Query: 131 YDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQV 190
           +D+R    P ++ VDSHHDDIT IKFHPSD N+LLSGSTDGYTNIYDL+QE+ED++LHQV
Sbjct: 131 FDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQV 190

Query: 191 INYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIRGQWDCDYVVD 250
           IN+ SIHSCGW++PKRIYTLSHMETFAIHELN+KSDELTEP+PLDFGDIR  W CDYVVD
Sbjct: 191 INFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWGCDYVVD 250

Query: 251 LYPGYVAMGKSAENA-GELKICGFENEIMNTENHIIIPNAHGDEVIRDVFIPPGNLNNHS 309
           +YPGYVA GKS E   GELK+   + E +  +N I IP+AHGDEVIRDVFIP  N    S
Sbjct: 251 IYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFIPEQN----S 306

Query: 310 DIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSDDYNMLVGR 359
           +++YSCGEDG +NIW     S  LNV + FWN    ++VL +  +   G+
Sbjct: 307 EVVYSCGEDGYLNIWR--NNSGPLNVPEKFWNYDIPMNVLDESLDSFAGQ 354

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score =  421 bits (1082), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 206/351 (58%), Positives = 266/351 (75%), Gaps = 8/351 (2%)

Query: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60
           MS    + I+FG+DNWCL+L+PLYSRGLL + SNG V+LIDWNS + I+   V  T+I++
Sbjct: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60

Query: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120
           L+V++ND ++G  F   S  SVKI+D+R     VAT++N KNS F+SL+SRH ML CGTE
Sbjct: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQC-VATVQNAKNSPFISLDSRHGMLACGTE 119

Query: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
           L+G DAE+ +YD++    P+R+F DSHHDDITDIKFH SD ++LLSGSTDGY N+YDL Q
Sbjct: 120 LSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ 179

Query: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240
           ++E+EALHQVIN+ASIHSCGWLSPKRI+ LSHMETF+IHELNDKSDEL EP+PL+FGDIR
Sbjct: 180 QEEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIR 239

Query: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300
             W+CDYVVD++PG +  G + E +  L++  F NE ++T N IIIP AHGDEV+RD  I
Sbjct: 240 KPWNCDYVVDIFPGCIITGSTQEQS-MLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALI 298

Query: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSD 351
                   S++ YS GEDGN+ +W + R S  LNV  +FWN  E+L+VL D
Sbjct: 299 HKTT----SELFYSGGEDGNIVLWKSNRGS--LNVPTEFWNYQEKLNVLHD 343

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score =  420 bits (1079), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 196/361 (54%), Positives = 272/361 (75%), Gaps = 8/361 (2%)

Query: 5   LVNQITFGNDNWCLELKPL-YSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRV 63
           L+N  +FG++NWC + +PL  + GLL S SNG ++ +D+ +    +   V   +IN L++
Sbjct: 8   LLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLKI 67

Query: 64  INNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTG 123
           +N+DF  G +F+  +  SVKI+D+ + + P+AT+ NDKN  FLSL+SRH +L  GTEL G
Sbjct: 68  LNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTELQG 127

Query: 124 VDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDE 183
           VDA++ IYD+R +  P+R+ +DSHHDD+T +KFHPSD  +LLSGSTDGYTN+YDL Q+DE
Sbjct: 128 VDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQDE 187

Query: 184 DEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIRGQW 243
           D+ALHQV+NYASIHSCGWLSP RI+TLSHMETFAIHELNDKS+EL EP+PLDFGD+R +W
Sbjct: 188 DDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVREKW 247

Query: 244 DCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFIPPG 303
            CDYV+D+YPGY+A GKS E  G+LK+     E ++ ++ ++IP+AHGDEVIRDVFIPP 
Sbjct: 248 GCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIPP- 306

Query: 304 NLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQ-LDVLSDDYNMLVGRNNE 362
              +HS+++YSCGEDG VN+W     +  LNV + FW+ +++ + VL  D+++  G   E
Sbjct: 307 ---SHSELVYSCGEDGFVNLWK--NNNGALNVPEQFWDYSKRTMHVLDGDFSLESGNEVE 361

Query: 363 Q 363
           +
Sbjct: 362 K 362

>ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL035C
          Length = 403

 Score =  395 bits (1016), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 252/351 (71%), Gaps = 7/351 (1%)

Query: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60
           MS  L  +++FG DNWCL L+PLY  G+L + SNG V+L+DW +   +      E++IN 
Sbjct: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60

Query: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120
           L+V+++  + G +FA  +   VK++D+R     VAT+ +   +  LSL+SRH ML  GTE
Sbjct: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGC-VATLTDANGAPALSLDSRHGMLAFGTE 119

Query: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
           L GVDA + ++ +  + +P+RAFVDSHHDD+TD+KFHP+D N+LLSGSTDGY N+YDL Q
Sbjct: 120 LVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179

Query: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240
            +EDEALHQVIN+ASIHSCGWLSPKRI++LSHMETFAIHELNDKS+   EP+P  FGD+R
Sbjct: 180 SEEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVR 239

Query: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300
             W CDYVVD+YPG++A G + ENAGEL++    +E ++  N I++P AHGDEV+RDV +
Sbjct: 240 EPWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLV 299

Query: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSD 351
           P  +     +++YS GEDGN+ IW +      LNV  DFW+ +++  VL D
Sbjct: 300 PASS----PELLYSAGEDGNMAIWKS--TLGPLNVPVDFWDYSKKETVLED 344

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score =  395 bits (1015), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 189/352 (53%), Positives = 266/352 (75%), Gaps = 9/352 (2%)

Query: 2   SAKLVNQITFGNDNWCLELKPLY--SRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNIN 59
           S  LVN  +FG++NW L+L+PL   + GLL S SNG V+ +D ++ + I+K+ + ET+IN
Sbjct: 4   SYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSIN 63

Query: 60  SLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGT 119
            L++IN++  +  +F   +  SVKI+D+ +    VATI +  N  F SL+SRH +L CGT
Sbjct: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKE-VATIHSQGNVPFPSLDSRHGLLACGT 122

Query: 120 ELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           EL GVDA ++IYD+R + +PVR+ VDSHHDD+T +K+HP+D NILLSGSTDGYTN+YDL+
Sbjct: 123 ELKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLS 182

Query: 180 QEDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDI 239
           + +E+++LHQVIN+ASIHSCGWLSP+RI+TLSHMETFAIHELNDKSD L EP+P+D GD+
Sbjct: 183 EAEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDV 242

Query: 240 RGQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVF 299
           R +W CDYVVD+YPG++A GKS E  GELK+   ++E ++  N I+IP AH DEVIRDV+
Sbjct: 243 REKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVY 302

Query: 300 IPPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSD 351
           IP    ++ S ++Y+CGEDGNV +W     +  LNV +  W+ ++++++L D
Sbjct: 303 IP----SHDSVMMYTCGEDGNVKLWK--NNNGPLNVPEQLWDYSKRVNMLED 348

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score =  372 bits (956), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 185/348 (53%), Positives = 255/348 (73%), Gaps = 13/348 (3%)

Query: 5   LVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVI 64
           L     FG++NWCL+L+P+++ G+L S S+G V+L+  +  S    F+VGET+IN+L  +
Sbjct: 4   LAGSCNFGSNNWCLKLQPVHN-GILTSVSSGEVHLLGLDL-SKQDSFKVGETSINALSRV 61

Query: 65  NNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGV 124
           +   EN  +FAA++   VK++D+R  +  VAT++ +  +  LSL S H ML  G+E  GV
Sbjct: 62  DGQ-EN--LFAASNGNKVKVFDLRE-NKEVATLEQENGANVLSLGSGHGMLAYGSEQQGV 117

Query: 125 DAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDED 184
           DA + ++D+R +SKPVR+FVDSH DDIT I FHP+D N+LLSGSTDGYTN+YDL + +E+
Sbjct: 118 DAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLEPEEE 177

Query: 185 EALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIRGQWD 244
           +ALHQVINYASIHSCGWL+P+RI+TLSHMETFAIHELNDKS+EL EP+PLDFGDIR  WD
Sbjct: 178 DALHQVINYASIHSCGWLAPRRIFTLSHMETFAIHELNDKSEELREPQPLDFGDIRQPWD 237

Query: 245 CDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFIPPGN 304
           C+YVVD+YPGY++ G S E  G L+I  F NE +  ++ I I  AHGDE++RD +I P  
Sbjct: 238 CNYVVDIYPGYISAGVSEEGKGALRIIPFRNEHVQAKDTITISQAHGDEIVRDTYILP-- 295

Query: 305 LNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSDD 352
             + SD++YSCGEDG V  W   R    L++ + FW+ + ++ +LSD+
Sbjct: 296 --SQSDMLYSCGEDGQVKAW---RNDIKLDIPETFWDYSTKMSLLSDE 338

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 94/198 (47%), Gaps = 19/198 (9%)

Query: 2   SAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNI-N 59
           S  ++++++   +N + L   PL    LL SS +GSV    WN    I    + ET+I N
Sbjct: 158 SNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIIN 215

Query: 60  SLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDK-------NSVFLSLESRH 112
            +R   N F        T  + + + DVRN ++ +  + N         N++  S  S +
Sbjct: 216 DVRW--NQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEY 273

Query: 113 DMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGY 172
            M   G      D+ +++YD R  ++P+  ++  H D +T + FH  +  I++SG +D  
Sbjct: 274 LMAASGE-----DSLIYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKR 327

Query: 173 TNIYDLAQEDEDEALHQV 190
             ++DL Q  +++   ++
Sbjct: 328 VAVWDLKQIGQEQTSDEI 345

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 96/199 (48%), Gaps = 28/199 (14%)

Query: 9   ITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSP--SIIKKFEVGETNINSLRVIN 65
           + +  DN + L   PL    LL  S + +V L D  S     ++K+E    NI+S  ++N
Sbjct: 172 LQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWE----NIHS-DIVN 226

Query: 66  N----DFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRH--DMLVCGT 119
           +    +F+       +  +S++I+D R    PVATI   K    LS  S H  ++L  G 
Sbjct: 227 DCQWHNFQKSLFGTVSEDSSLQIHDTRES-KPVATINGTKPFNTLSF-SHHSENLLATG- 283

Query: 120 ELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL- 178
              GV++E+++YD RY  +P+   +  H D +T + F   D  I+LS   D    I+D+ 
Sbjct: 284 ---GVNSEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339

Query: 179 ------AQEDEDEALHQVI 191
                   ED ++A  +V+
Sbjct: 340 DIGAEQVLEDAEDATSEVM 358

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 95/185 (51%), Gaps = 12/185 (6%)

Query: 1   MSAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNIN 59
           + + L++   F N+N + L   P   +G L S S+ S N++ W+     ++  +  T+ +
Sbjct: 142 VESGLLSTFQFHNENGYGLSFNP-NEKGKLLSGSDDS-NIVLWDVTGKSQEPILTFTDRH 199

Query: 60  SLRVINN----DFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDML 115
           S  ++N+    +F+     + +  ++++++D R  D+ V  ++  K    L+  +    L
Sbjct: 200 S-DIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNL 258

Query: 116 VCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNI 175
                  G D+ +++YD R  SKP+   +  H D +T ++FHP +  +L+S  +D  T +
Sbjct: 259 FAAA---GTDSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTIL 314

Query: 176 YDLAQ 180
           +DLA+
Sbjct: 315 WDLAE 319

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 108/258 (41%), Gaps = 40/258 (15%)

Query: 3   AKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSL 61
           + L  + +F  +N + L    +    LL  S +GS+ + D  S         G+     +
Sbjct: 151 SALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCS---------GKNTPVKV 201

Query: 62  RVINNDFENGC--------IFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHD 113
              +N+  N C        +F + S  S  I   +  D PV  I   +    L+      
Sbjct: 202 DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSS 261

Query: 114 MLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYT 173
            L       G D+++ +YD+R    P+ + +  HHD +T ++F P    IL SGS+D   
Sbjct: 262 NLFAAA---GTDSQVQLYDLRKPEAPIHS-MSGHHDSVTSLEFAPHKDGILCSGSSDRRV 317

Query: 174 NIYDL-------AQEDEDEALHQVINYASIH-------SCGWLSPKRIYTLSHMETFAIH 219
            I+DL        QED D+ + +++   + H       SC   SP   + ++ +E   + 
Sbjct: 318 LIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSC---SPNIPWLMASVEEENVV 374

Query: 220 ELNDKSDELTEPR-PLDF 236
           ++   S +LT P  P D+
Sbjct: 375 QIWKASKKLTSPYIPRDY 392

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 83/182 (45%), Gaps = 10/182 (5%)

Query: 2   SAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60
           S   V+ + F  +N + L   P  S  LL  S + +V L D  +    K       +I +
Sbjct: 175 SKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVN 234

Query: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDK--NSVFLSLESRHDMLVCG 118
             V  ++FE+      +   +++++D R    PV  +      N++  S  SR+ +   G
Sbjct: 235 -DVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAG 293

Query: 119 TELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
                VD+++++YD+R  S P+   +  H D +T ++F P    I+ S  +D    I+DL
Sbjct: 294 -----VDSQIYLYDMRDMSSPLHV-MSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347

Query: 179 AQ 180
            Q
Sbjct: 348 TQ 349

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 85/170 (50%), Gaps = 13/170 (7%)

Query: 16  WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINN----DFENG 71
           + L   P  S  L+  S + ++ L D +S S  K  +    NI+S  ++N+     F+  
Sbjct: 157 YGLSFNPNVSNELISGSDDFTIALWDIDSGS--KSPKSVWDNIHS-DIVNDCSWHHFDEN 213

Query: 72  CIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLE-SRHDMLVCGTELTGVDAEMFI 130
              + +  +++K++D R+    + TI+    + F +L  S+H   +      G+D  +++
Sbjct: 214 LFGSVSEDSTLKLHDKRSTSKVINTIQ--AKAAFNTLAFSKHSANLFAA--AGLDTNIYL 269

Query: 131 YDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
           YD R  +KP+      H D IT ++FHP +  IL+SG  D    ++DLA+
Sbjct: 270 YDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 93/191 (48%), Gaps = 29/191 (15%)

Query: 3   AKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSL 61
           + L++ + F  +N + L   P     LL  S +G++ L D    S + K          L
Sbjct: 186 SALISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAK--------KPL 237

Query: 62  RV---INNDFENGC--------IFAATSL-ASVKIYDVRNGDSPVATIKNDK--NSVFLS 107
           ++   ++ND  N C        +FA+ S  ++++++D R  ++ + +IK     N++  S
Sbjct: 238 KIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFS 297

Query: 108 LESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSG 167
             S++ M   GT     D+ +++YD R  S P+ + ++ H D IT+++F P    +L+S 
Sbjct: 298 KHSQYLMAAAGT-----DSLVYLYDSRNLSVPLYS-MNGHEDSITNLEFSPHTDGVLISS 351

Query: 168 STDGYTNIYDL 178
             D    ++D+
Sbjct: 352 GNDRRVIMWDI 362

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 6/60 (10%)

Query: 147 HHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQVINYASIHS-----CGW 201
           H ++   + F+P+DK  LLSGS DG   ++D+ QE+   A   +  + S+H+     C W
Sbjct: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDI-QENSTLAKKPLKIWDSVHNDIVNDCKW 253

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 87/196 (44%), Gaps = 15/196 (7%)

Query: 16  WCLELKPLYSRGLLCSSSNGSVNLIDWNS---PSIIKKFEVGETNINSLRVINNDFENGC 72
           + L   P  S  LL +S +G+V L D  S    S  + F+V    +N  +   ++F++  
Sbjct: 173 YGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKW--HEFQSSL 230

Query: 73  IFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYD 132
               +   ++ I+D  N D  +  +        L+   R + L+      G D+ +++YD
Sbjct: 231 FGTVSEDNTLIIHDT-NSDRAIQKLSVSSAFNTLAFSKRSENLLAAA---GTDSNVYLYD 286

Query: 133 VRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL----AQEDEDEALH 188
           +R   KP+ +    H D +T ++F P    +L S  +D    ++DL    A++  D+A  
Sbjct: 287 LRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYD 345

Query: 189 QVINYASIHSCGWLSP 204
            V     +H  G  SP
Sbjct: 346 GVPELFMMHG-GHRSP 360

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 94/213 (44%), Gaps = 25/213 (11%)

Query: 2   SAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60
           S  L   +++  DN + L   P     LL +S + +V L D NS        +  T+I  
Sbjct: 149 SEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDI-- 206

Query: 61  LRVINN----DFENGCIFAATSLASVKIYDVRN--GDSPVATIKNDKNSVFLSLESRHDM 114
              +N+    +F+       +   +++++D R+    + V  ++   N++  S  S++ +
Sbjct: 207 ---VNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLI 263

Query: 115 LVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTN 174
              GT     D  +++YD+R  S+P+      H D +T I+F      IL S  +D    
Sbjct: 264 AAAGT-----DTRVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLF 317

Query: 175 IYDL-------AQEDEDEALHQVINYASIHSCG 200
           I+DL       AQED D+ + +++   + H   
Sbjct: 318 IWDLTQIGAEQAQEDADDGVPELMMMHAGHRSA 350

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 86/173 (49%), Gaps = 16/173 (9%)

Query: 26  RGLLCSS-SNGSVNLIDW-----NSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSL 79
           +GLL +S S+G V + D      NSP++I    +   +      ++    +  + A  S 
Sbjct: 206 QGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHDSLLAYCSE 265

Query: 80  AS-VKIYDVRNGDSPVATIKNDKNSVFL---SLESRHDMLVCGTELTGVDAEMFIYDVRY 135
            + V I D+RN +   ++  N  +S  +         DML+C  +  G    + ++D+R 
Sbjct: 266 DNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAG---RINLWDIRN 322

Query: 136 FSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTD-GYTNIYDLAQEDEDEAL 187
           F++P++  +  H+D I+ ++++P +  +L +G  D G   I+DL+Q +  E +
Sbjct: 323 FTQPLKTLL--HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQELI 373

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 86/206 (41%), Gaps = 17/206 (8%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWN-SPSIIKKFEVGETNINSLRVINNDFENG 71
           + + L+  PL   G LL    +G V     + S  +  K     +N  S+  I       
Sbjct: 280 EGYALDWSPLIRSGALLTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEA 339

Query: 72  CIFAATSL-ASVKIYDVRNGD-SPVATIKNDKNSV-FLSLESRHDMLVCGTELTGVDAEM 128
            +FA       ++++D R+    P  + K     V  +S   +   L+   +  G     
Sbjct: 340 TVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGT---W 396

Query: 129 FIYDVRYFS------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQED 182
            ++D+R FS      +PV  + D H   IT I FHP+D++I+   S D    ++DL+ E 
Sbjct: 397 GVWDLRQFSPSNENAQPVAQY-DFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEA 455

Query: 183 EDEALHQVINYASIHSCGWLSPKRIY 208
           +DE + Q    A       + P+ ++
Sbjct: 456 DDEEIKQ--QTAETKELAQIPPQLLF 479

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 59/142 (41%), Gaps = 10/142 (7%)

Query: 69  ENGCIFAATSLASVKIYDV------RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           ENG ++        + +D       +    P+ TI+N  N    +L+    ++  G  LT
Sbjct: 239 ENGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYALD-WSPLIRSGALLT 297

Query: 123 GVDAEMFIYDVRYFSKPV---RAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           G  +    +  R+ SK V   + F  S++  I DI++  ++  +  +   DGY  ++D  
Sbjct: 298 GDCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEATVFATAGCDGYIRVWDTR 357

Query: 180 QEDEDEALHQVINYASIHSCGW 201
            +    A+    +   ++   W
Sbjct: 358 SKKHKPAISTKASNTDVNVISW 379

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 84/177 (47%), Gaps = 27/177 (15%)

Query: 27  GLLCSS-SNGSVNLIDWNSPSIIKKFEVGETNINS--LRVINND---------FENGCIF 74
           G++ SS SNG + + D      I +++  +  I++  LR++ +            +  I 
Sbjct: 207 GIIASSYSNGLIKVWD------ITRYQKSQPTISNPELRILQDKAGTNDVSWMVHHSSIL 260

Query: 75  AATSLA-SVKIYDVRNGDS--PVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIY 131
           AA   + ++ + D R  D+  P     +      L     +DML+C  +  G  A   ++
Sbjct: 261 AACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNGGIA---LW 317

Query: 132 DVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLS-GSTDGYTNIYDLAQEDEDEAL 187
           D R FSKP+  F  +H D ++ ++++P+   I+ + G  DG   I+D ++E ED  L
Sbjct: 318 DCRAFSKPLSVF--NHGDSVSALQWNPNLPTIVATAGQGDGLIKIWDTSREPEDSLL 372

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 83/190 (43%), Gaps = 20/190 (10%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWNSPSII---KKFEVGETNINSLRVINNDFE 69
           + + L+  PL   G LL    +G +     ++   I   + F V   N  S+  I     
Sbjct: 275 EGYALDWSPLTKTGALLTGDCSGQIYFTQRHTSKWITDKQPFTVA--NNQSIEDIQWSRT 332

Query: 70  NGCIFAATSL-ASVKIYDVRNGD-SPVATIKNDKNSV-FLSLESRHDMLVCGTELTGVDA 126
              +FA+      ++I+D R+    P  ++K     V  +S   +   L+   +  G   
Sbjct: 333 ESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGT-- 390

Query: 127 EMFIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
              ++D+R FS       +PV  + D H   IT I F+P D++I+  GS D    ++DL+
Sbjct: 391 -WGVWDLRQFSPENAGSVQPVAQY-DFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLS 448

Query: 180 QEDEDEALHQ 189
            E +DE + Q
Sbjct: 449 VEADDEEIKQ 458

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 70/166 (42%), Gaps = 10/166 (6%)

Query: 68  FENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAE 127
           F+ G    A S    K+   +    P+ T+KN  N    +L+    +   G  LTG  + 
Sbjct: 241 FDLGPQSKAFSTPGYKV--PKAAKRPIHTVKNHGNVEGYALD-WSPLTKTGALLTGDCSG 297

Query: 128 MFIYDVRYFSKPV---RAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDED 184
              +  R+ SK +   + F  +++  I DI++  ++  +  S   DGY  I+D   +   
Sbjct: 298 QIYFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHK 357

Query: 185 EALHQVINYASIHSCGWLSPKRIYTLSHME---TFAIHELNDKSDE 227
            A+    +   ++   W S K  Y L+  +   T+ + +L   S E
Sbjct: 358 PAISVKASNTDVNVISW-SEKLGYLLASGDDNGTWGVWDLRQFSPE 402

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 91/207 (43%), Gaps = 19/207 (9%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWNSPS-IIKKFEVGETNINSLRVINNDFENG 71
           + + L+  PL   G LL    +G V L    S   I  K      N  S+  I       
Sbjct: 286 EGYGLDWSPLIKTGALLTGDCSGRVFLTQRTSSKWITDKQPFTVDNNKSIEDIKWSPSEN 345

Query: 72  CIFAATSL-ASVKIYDVRNGD-SPVATIK-NDKNSVFLSLESRHDMLVCGTELTGVDAEM 128
            +FA   +   V+I+D+R+    P  ++K +D +   +S   +   L+     TG D   
Sbjct: 346 TVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYLLA----TGDDNGT 401

Query: 129 F-IYDVRYFS------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
           + ++D+R FS       PV  + D H   IT I F+P D++I+   S D    ++DL+ E
Sbjct: 402 WGVWDLRQFSNQQGGVSPVAQY-DFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVE 460

Query: 182 DEDEALHQVINYASIHSCGWLSPKRIY 208
            +DE + Q    A +     + P+ ++
Sbjct: 461 ADDEEIKQ--QAAEVKELQQIPPQLLF 485

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 49/117 (41%), Gaps = 4/117 (3%)

Query: 88  RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPV---RAFV 144
           +    P  TIKN  N     L+    ++  G  LTG  +       R  SK +   + F 
Sbjct: 270 KAAQRPQYTIKNHGNVEGYGLD-WSPLIKTGALLTGDCSGRVFLTQRTSSKWITDKQPFT 328

Query: 145 DSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQVINYASIHSCGW 201
             ++  I DIK+ PS+  +  +   DG+  I+D+  +    AL   ++   ++   W
Sbjct: 329 VDNNKSIEDIKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSW 385

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 84/190 (44%), Gaps = 20/190 (10%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWNSPSII---KKFEVGETNINSLRVINNDFE 69
           + + L+  PL   G LL    +G + L   N+   +   + F VG  N  S+  I     
Sbjct: 280 EGYALDWSPLIKTGALLTGDCSGQIYLTQRNTSKWVTDKQPFTVG--NNKSVEDIQWSRT 337

Query: 70  NGCIFAATSL-ASVKIYDVRNGD-SPVATIKNDKNSV-FLSLESRHDMLVCGTELTGVDA 126
              +FA+      V+I+D R+    P  ++K     V  +S   +   L+   +  G   
Sbjct: 338 EATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNG--- 394

Query: 127 EMFIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
              ++D+R F+       +PV  + D H   IT I F+P +++I+   S D    ++DL+
Sbjct: 395 SWGVWDLRQFTPDNINNVQPVAQY-DFHKGAITSISFNPLEESIIAVASEDNTVTLWDLS 453

Query: 180 QEDEDEALHQ 189
            E +DE + Q
Sbjct: 454 VEADDEEIKQ 463

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 49/117 (41%), Gaps = 4/117 (3%)

Query: 88  RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPV---RAFV 144
           ++   PV TIKN  N    +L+    ++  G  LTG  +       R  SK V   + F 
Sbjct: 264 KSSKRPVHTIKNHGNVEGYALD-WSPLIKTGALLTGDCSGQIYLTQRNTSKWVTDKQPFT 322

Query: 145 DSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQVINYASIHSCGW 201
             ++  + DI++  ++  +  S   DGY  I+D   +    AL    +   ++   W
Sbjct: 323 VGNNKSVEDIQWSRTEATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISW 379

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 89/184 (48%), Gaps = 20/184 (10%)

Query: 6   VNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVI 64
           V   ++  DN + L   P+    LL ++ +G + + D N+ S     +  ET  ++   I
Sbjct: 144 VKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAES----EDPVETWQSTDNCI 199

Query: 65  NNDFE----NGCIFAATSLA--SVKIYDVRNGDSPVATIKNDK--NSVFLSLESRHDMLV 116
            ND +    +  +F   S    ++ IYD+R  D  V +I+ ++  NS+  S  S++    
Sbjct: 200 INDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDK-VTSIEMEQPFNSLAFSKHSKNLFSA 258

Query: 117 CGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIY 176
            GT     D  +++YD+R   K + + +  H   +T+++FH S   IL+S S D    I+
Sbjct: 259 AGT-----DQNVYLYDLRNTRKTLHS-MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIW 312

Query: 177 DLAQ 180
           DL +
Sbjct: 313 DLME 316

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 130 IYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDED 184
           I+D      PV+ +   H D+   + F+P  K  LLS + DGY  +YD+  E ED
Sbjct: 134 IFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 67/141 (47%), Gaps = 11/141 (7%)

Query: 47  IIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVF- 105
           I KKF++ E  I   R +  D     I       +V I+D  + DSPV T    K++ + 
Sbjct: 100 ITKKFKL-EKEITRSRYMVQD--PNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYG 156

Query: 106 LSLESRHDMLVCGTELTGV-DAEMFIYDVRYFSK-PVRAFVDSHHDDITDIKFHPSDKNI 163
           LS     + +  G  L+   D  + +YD+   S+ PV  +  + +  I DIK+H  D  +
Sbjct: 157 LSF----NPISKGQLLSAADDGYIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATL 212

Query: 164 LLSGSTDGYT-NIYDLAQEDE 183
             + S +  T +IYDL  +D+
Sbjct: 213 FGTVSEEKNTLSIYDLRTKDK 233

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 91/208 (43%), Gaps = 21/208 (10%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWNSPSIIK---KFEVGETNINSLRVINNDFE 69
           + + L+  PL   G LL    +G V L   ++   +     F VG  N  S+  I     
Sbjct: 281 EGYGLDWSPLIKTGALLTGDCSGMVYLTQRHTSKWVTDKTPFTVG--NNKSIEDIQWSRT 338

Query: 70  NGCIFAATSL-ASVKIYDVRNGD-SPV-ATIKNDKNSVFLSLESRHDMLVCGTELTGVDA 126
              +FA       ++I+D R+    PV +T+ ++ +   +S   +   L+   +  G   
Sbjct: 339 ESTVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGT-- 396

Query: 127 EMFIYDVRYFSK------PVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
              I+D+R FS       PV  + D H   IT I F+P D++I+   S D    ++DL+ 
Sbjct: 397 -WGIWDLRQFSPNSEKALPVAQY-DFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSV 454

Query: 181 EDEDEALHQVINYASIHSCGWLSPKRIY 208
           E +DE + Q    A I     + P+ ++
Sbjct: 455 EADDEEIKQ--QKAEIKELEQIPPQLLF 480

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 57/142 (40%), Gaps = 10/142 (7%)

Query: 69  ENGCIFAATSLASVKIYDV------RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           ENG +F        + ++       +    P+ TI+N  N     L+    ++  G  LT
Sbjct: 240 ENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLD-WSPLIKTGALLT 298

Query: 123 GVDAEMFIYDVRYFSKPVR---AFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           G  + M     R+ SK V     F   ++  I DI++  ++  +  +   DGY  I+D  
Sbjct: 299 GDCSGMVYLTQRHTSKWVTDKTPFTVGNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTR 358

Query: 180 QEDEDEALHQVINYASIHSCGW 201
            +     +  V++   ++   W
Sbjct: 359 SKKHKPVISTVVSNTDVNVISW 380

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 86/184 (46%), Gaps = 10/184 (5%)

Query: 2   SAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDW----NSPSIIKKFEVGET 56
           S  L + + F  DN + L   PL    LL  S + SV L D     +S + I+ ++   +
Sbjct: 149 SDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHS 208

Query: 57  NINSLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLV 116
           +I +    +N F        +  + +KI D+R  ++ + T K  +    L+       ++
Sbjct: 209 DIVNDSKWHN-FNKDLFGTVSEDSLLKINDIRAENTTIDTAKCPQPFNTLAFSHHSSNIL 267

Query: 117 CGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIY 176
                 G+D+ +++YD+R   +P+   +  H D +T+++F P    +++S  +D    ++
Sbjct: 268 AAA---GMDSHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMW 323

Query: 177 DLAQ 180
           DL Q
Sbjct: 324 DLKQ 327

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 67/144 (46%), Gaps = 14/144 (9%)

Query: 56  TNINSLRVINNDFENGCIFAATSL-ASVKIYDVRNGD-SPVATIKNDKNSV-FLSLESRH 112
           +N  S+  I      G +FA+      ++I+D R+    P  ++K     V  +S   + 
Sbjct: 320 SNNKSIEDIQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKL 379

Query: 113 DMLVCGTELTGVDAEMFIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILL 165
             L+   +  GV     ++D+R FS       +PV  + D H   IT I F+P D++I+ 
Sbjct: 380 GYLLASGDDNGV---WGVWDLRQFSPDTANSVQPVAQY-DFHKGAITSISFNPLDESIVA 435

Query: 166 SGSTDGYTNIYDLAQEDEDEALHQ 189
             S D    ++DL+ E +DE + Q
Sbjct: 436 VASEDNTVTLWDLSVEADDEEIKQ 459

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 57/137 (41%), Gaps = 6/137 (4%)

Query: 68  FENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAE 127
           F+ G    A S    KI   +    P+ TIK+  N    +L+     +  G  LTG  + 
Sbjct: 242 FDLGPQSKAFSTPGYKI--PKTAKRPIHTIKSHGNVEGYALD-WSPSIQTGALLTGDCSG 298

Query: 128 MFIYDVRYFSKPV---RAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDED 184
              +  R+ SK V   + F  S++  I DI++  ++  +  S   DGY  I+D   +   
Sbjct: 299 QIYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEGTVFASAGCDGYIRIWDTRSKKHK 358

Query: 185 EALHQVINYASIHSCGW 201
            A+    +   ++   W
Sbjct: 359 PAISVKASNTDVNVISW 375

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 89/185 (48%), Gaps = 12/185 (6%)

Query: 2   SAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60
           S  L + + F  +N + L   PL    LL  S + +V L D N  S   +     ++++S
Sbjct: 149 SEGLQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHS 208

Query: 61  LRVINNDFEN--GCIFAATSLASV-KIYDVRNGDSPVATIKNDK--NSVFLSLESRHDML 115
             V ++ + N    +F   S  S+ KI D+R  ++   T K  +  N++  S  S + + 
Sbjct: 209 DIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHHSSNLLA 268

Query: 116 VCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNI 175
             GT     D+ +++YD+R   +P+   +  H D +T+++F P    +++S  +D    +
Sbjct: 269 AAGT-----DSHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHVDGVVVSSGSDNRLIM 322

Query: 176 YDLAQ 180
           +DL Q
Sbjct: 323 WDLKQ 327

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 11/117 (9%)

Query: 71  GCIFAATSLASVKIYDVRNGDSPVATIK-NDKNSVFLSLESRHDMLVCGTELTGVDAE-M 128
           G +       +V IY    G    +T+K +++N   LS       LV G  L+G D   +
Sbjct: 132 GTVATINGQGTVFIYSRSEGLQ--STLKFHEENGYALSFSP----LVEGLLLSGSDDHTV 185

Query: 129 FIYDVRYFS---KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQED 182
            ++DV   S   +P+R + D H D + D K+H  +K++  + S D    I DL  E+
Sbjct: 186 ALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVEN 242

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 83/188 (44%), Gaps = 16/188 (8%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWNSPS-IIKKFEVGETNINSLRVINNDFENG 71
           + + L+  PL   G LL    +G + L   ++   +  K     +N  S+  I       
Sbjct: 274 EGYGLDWSPLIKTGALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTES 333

Query: 72  CIFAATSL-ASVKIYDVRNGD-SPVATIKNDKNSV-FLSLESRHDMLVCGTELTGVDAEM 128
            +FA  +    ++I+D R+    P  ++K     V  +S   +   L+   +  G     
Sbjct: 334 TVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGT---W 390

Query: 129 FIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
            ++D+R F+       +PV  + D H   IT I F+P D++I+  GS D    ++DL+ E
Sbjct: 391 GVWDLRQFTPSNADTVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVE 449

Query: 182 DEDEALHQ 189
            +DE + Q
Sbjct: 450 ADDEEIKQ 457

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 65/142 (45%), Gaps = 10/142 (7%)

Query: 69  ENGCIF----AATSLA-SVKIYDV-RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           ENG ++    AA S A S   Y + ++   P+ T+KN  N     L+    ++  G  L+
Sbjct: 233 ENGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLD-WSPLIKTGALLS 291

Query: 123 GVDAEMFIYDVRYFSKPV---RAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           G  +       R+ S+ V   ++F  S+++ I DI++  ++  +  + + DGY  I+D  
Sbjct: 292 GDCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFATAACDGYIRIWDTR 351

Query: 180 QEDEDEALHQVINYASIHSCGW 201
            +    A+    +   ++   W
Sbjct: 352 SKKHKPAISVKASNTDVNVISW 373

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 42/74 (56%), Gaps = 6/74 (8%)

Query: 113 DMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLS-GSTDG 171
           D+L+C  +  G    + ++D+R FS P+R+    HH  ++ ++++P    IL + G  DG
Sbjct: 303 DLLLCSADSAG---RINLWDIRDFSSPIRSL--DHHGSVSALQWNPHHPTILATAGQDDG 357

Query: 172 YTNIYDLAQEDEDE 185
              I+DL+Q  + E
Sbjct: 358 LVKIWDLSQPVDQE 371

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 6/72 (8%)

Query: 113 DMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLS-GSTDG 171
           D L+C  +  G    + I D+R    PV+ +  SH D ++ I+++P    ++ S G  DG
Sbjct: 298 DFLLCSADSEGT---LNICDIRQLEHPVKTW--SHLDAVSTIQWNPKFPTVIASAGQNDG 352

Query: 172 YTNIYDLAQEDE 183
              I+DLAQED+
Sbjct: 353 LVKIWDLAQEDD 364

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 82/190 (43%), Gaps = 20/190 (10%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWNSPSII---KKFEVGETNINSLRVINNDFE 69
           + + L+  PL   G LL    +G V L   ++   I   + F V   N  S+  I     
Sbjct: 284 EGYALDWSPLIKTGALLTGDCSGQVYLTQRHTSKWISDKEPFTVA--NNQSVEDIQWSRT 341

Query: 70  NGCIFAATSL-ASVKIYDVRNGD-SPVATIKNDKNSV-FLSLESRHDMLVCGTELTGVDA 126
              +FA+      ++++D R+    P  ++K     V  +S   +   L+   +  G   
Sbjct: 342 ESTVFASCGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGT-- 399

Query: 127 EMFIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
              ++D+R FS        PV  + D H   IT I F+P D++I+   S D    ++DL+
Sbjct: 400 -WGVWDLRQFSPSNSNNTSPVAQY-DFHKGAITSISFNPLDESIVAVASEDNTVTLWDLS 457

Query: 180 QEDEDEALHQ 189
            E +DE + Q
Sbjct: 458 VEADDEEIKQ 467

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 28/142 (19%), Positives = 58/142 (40%), Gaps = 10/142 (7%)

Query: 69  ENGCIFAATSLASVKIYDV------RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           ENG ++     + VK +        +    P+ TIK+  N    +L+    ++  G  LT
Sbjct: 243 ENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALD-WSPLIKTGALLT 301

Query: 123 GVDAEMFIYDVRYFSKPV---RAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           G  +       R+ SK +     F  +++  + DI++  ++  +  S   DGY  ++D  
Sbjct: 302 GDCSGQVYLTQRHTSKWISDKEPFTVANNQSVEDIQWSRTESTVFASCGCDGYIRVWDTR 361

Query: 180 QEDEDEALHQVINYASIHSCGW 201
            +    A+    +   ++   W
Sbjct: 362 SKKHKPAISVKASNTDVNVISW 383

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 81/188 (43%), Gaps = 16/188 (8%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWNSPS-IIKKFEVGETNINSLRVINNDFENG 71
           + + L+  PL   G LL    +G V     ++   +  K     +N  S+  I       
Sbjct: 273 EGYGLDWSPLIKTGSLLSGDCSGQVYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRSES 332

Query: 72  CIFAATSL-ASVKIYDVRNGD-SPVATIKNDKNSV-FLSLESRHDMLVCGTELTGVDAEM 128
            +FA       ++I+D R+    P  ++K     V  +S   +   L+   +  G     
Sbjct: 333 TVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGT---W 389

Query: 129 FIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
            ++D+R F+       +PV  + D H   IT I F+P D++I+  GS D    ++DL+ E
Sbjct: 390 GVWDLRQFTPSNADSVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVE 448

Query: 182 DEDEALHQ 189
            +DE + Q
Sbjct: 449 ADDEEIKQ 456

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 52/117 (44%), Gaps = 4/117 (3%)

Query: 88  RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPV---RAFV 144
           ++   P+ T+KN  N     L+    ++  G+ L+G  +    +  R+ S+ V   + F 
Sbjct: 257 KSAKRPIHTVKNHGNVEGYGLD-WSPLIKTGSLLSGDCSGQVYFTQRHTSRWVTDKQPFT 315

Query: 145 DSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQVINYASIHSCGW 201
            S++  I DI++  S+  +  +   DGY  I+D   +    A+    +   ++   W
Sbjct: 316 VSNNKSIEDIQWSRSESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 372

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 81/190 (42%), Gaps = 16/190 (8%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWN-SPSIIKKFEVGETNINSLRVINNDFENG 71
           + + L+  P+   G LL    +G +     + S  I  K      N  S+  I       
Sbjct: 281 EGYALDWSPMIKNGALLTGDCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTES 340

Query: 72  CIFAATSL-ASVKIYDVRNGD-SPVATIKNDKNSV-FLSLESRHDMLVCGTELTGVDAEM 128
            +FA+      ++I+D R+    P  ++K     V  +S   +   L+   +  G+    
Sbjct: 341 TVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGL---W 397

Query: 129 FIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
            ++D+R FS       +PV  + D H   IT I F+P D +I+   S D    ++DL+ E
Sbjct: 398 GVWDLRQFSPDNINDVQPVAQY-DFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVE 456

Query: 182 DEDEALHQVI 191
            +DE + Q I
Sbjct: 457 ADDEEIKQQI 466

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 61/142 (42%), Gaps = 10/142 (7%)

Query: 69  ENGCIF----AATSLA-SVKIYDV-RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           ENG ++    A  S A S   Y + +    P+ T++N  N    +L+    M+  G  LT
Sbjct: 240 ENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALD-WSPMIKNGALLT 298

Query: 123 GVDAEMFIYDVRYFSKPV---RAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           G  +    +  R+ SK +   + F   ++  + DI++  ++  +  S   DGY  I+D  
Sbjct: 299 GDCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRIWDTR 358

Query: 180 QEDEDEALHQVINYASIHSCGW 201
            +    AL    +   ++   W
Sbjct: 359 SKKHKPALSVKASNTDVNVISW 380

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 5/68 (7%)

Query: 122 TGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL--- 178
            G D  +++YD+R  S P+ A    H D +T I+F P++  IL S  +D  T ++DL   
Sbjct: 288 AGTDNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEI 346

Query: 179 -AQEDEDE 185
            A++ +DE
Sbjct: 347 GAEQTQDE 354

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 125 DAEMFIYDVRYFSK---PVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYD 177
           D+ + ++D+  F K   P   F D+H D I D+K+H S+ +I  S S D    ++D
Sbjct: 201 DSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFD 256

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 82/185 (44%), Gaps = 19/185 (10%)

Query: 18  LELKPLYSRG-LLCSSSNGSVNLIDWNSPSII---KKFEVGETNINSLRVINNDFENGCI 73
           L+  PL   G LL    +G + L   ++   I   + F VG  N  S+  I        +
Sbjct: 295 LDWSPLIKSGALLTGDCSGEIFLTSRHTSKWITEKQSFSVG--NNKSIEDIQWSKTEQTV 352

Query: 74  FAATSL-ASVKIYDVRNGD--SPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFI 130
           FA       ++I+D R+      ++T  ++ +   +S   + + L+   +  GV     +
Sbjct: 353 FATAGCDGYIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLASGDDKGV---WGV 409

Query: 131 YDVRYFS------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDED 184
           +D+R FS       PV  + D H   IT I F+P D++ +   S D    ++DL+ E +D
Sbjct: 410 WDLRQFSPSQENASPVAQY-DFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADD 468

Query: 185 EALHQ 189
           E + Q
Sbjct: 469 EEIKQ 473

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 30/143 (20%), Positives = 63/143 (44%), Gaps = 12/143 (8%)

Query: 69  ENGCIFAATSLASVKIYDV------RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           ENG ++    +  VK + +      +    P+ TI++  N     L+    ++  G  LT
Sbjct: 250 ENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLD-WSPLIKSGALLT 308

Query: 123 G-VDAEMFIYDVRYFSKPV---RAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           G    E+F+   R+ SK +   ++F   ++  I DI++  +++ +  +   DGY  I+D 
Sbjct: 309 GDCSGEIFLTS-RHTSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIRIWDT 367

Query: 179 AQEDEDEALHQVINYASIHSCGW 201
             +    A+    +   ++   W
Sbjct: 368 RSKKHKPAISTRASNVDVNVISW 390

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 16/188 (8%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWNSPS-IIKKFEVGETNINSLRVINNDFENG 71
           + + L+  PL   G LL    +G +     ++   +  K     +N  S+  I       
Sbjct: 275 EGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTES 334

Query: 72  CIFAATSL-ASVKIYDVRNGD-SPVATIKNDKNSV-FLSLESRHDMLVCGTELTGVDAEM 128
            +FA       ++I+D R+    P  ++K     V  +S   +   L+   +  G     
Sbjct: 335 TVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGT---W 391

Query: 129 FIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
            ++D+R F+       +PV  + D H   IT I F+P D++I+  GS D    ++DL+ E
Sbjct: 392 GVWDLRQFTPSNADAVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVE 450

Query: 182 DEDEALHQ 189
            +DE + Q
Sbjct: 451 ADDEEIKQ 458

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 62/142 (43%), Gaps = 10/142 (7%)

Query: 69  ENGCIF----AATSLA-SVKIYDV-RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           ENG ++    A  S A S   Y + ++   P+ T+KN  N     L+    ++  G  L+
Sbjct: 234 ENGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLD-WSPLIKTGALLS 292

Query: 123 GVDAEMFIYDVRYFSKPV---RAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           G  +    +  R+ S+ V   + F  S++  I DI++  ++  +  +   DGY  I+D  
Sbjct: 293 GDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTR 352

Query: 180 QEDEDEALHQVINYASIHSCGW 201
            +    A+    +   ++   W
Sbjct: 353 SKKHKPAISVKASNTDVNVISW 374

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 84/193 (43%), Gaps = 17/193 (8%)

Query: 10  TFGN-DNWCLELKPLYSRG-LLCSSSNGSVNLIDWNSPS-IIKKFEVGETNINSLRVINN 66
           + GN + + L+  PL   G LL    +G +     ++   +  K     +N  S+  I  
Sbjct: 268 SHGNVEGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQW 327

Query: 67  DFENGCIFAATSL-ASVKIYDVRNGD-SPVATIKNDKNSV-FLSLESRHDMLVCGTELTG 123
                 +FA       ++I+D R+    P  ++K     V  +S   +   L+   +  G
Sbjct: 328 SRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNG 387

Query: 124 VDAEMFIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIY 176
                 ++D+R F+       +PV  + D H   IT I F+P D++I+  GS D    ++
Sbjct: 388 T---WGVWDLRQFTPSNADTVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLW 443

Query: 177 DLAQEDEDEALHQ 189
           DL+ E +DE + Q
Sbjct: 444 DLSVEADDEEIKQ 456

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 62/142 (43%), Gaps = 10/142 (7%)

Query: 69  ENGCIF----AATSLA-SVKIYDV-RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           ENG ++    A  S A S   Y + ++   P+ T+K+  N     L+    ++  G  L+
Sbjct: 232 ENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLD-WSPLIKTGALLS 290

Query: 123 GVDAEMFIYDVRYFSKPV---RAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           G  +    +  R+ S+ V   + F  S++  I DI++  ++  +  +   DGY  I+D  
Sbjct: 291 GDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTR 350

Query: 180 QEDEDEALHQVINYASIHSCGW 201
            +    A+    +   ++   W
Sbjct: 351 SKKHKPAISVKASNTDVNVISW 372

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 111/258 (43%), Gaps = 37/258 (14%)

Query: 5   LVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWN------SPSIIKKFEVGETN 57
           LV++  F  DN + L   P     LL  S +G++ L  WN      SPS  K     E  
Sbjct: 153 LVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIAL--WNVMGTNTSPS--KAVTTHEDI 208

Query: 58  INSLRVINNDFENGCIFAATSLASVKIYDVR-NGDSPVATIKNDKNSVFLSLESRHDMLV 116
           +N      ++F      + +   +++I+D R N      T+ +  N++  S  S++    
Sbjct: 209 VNDCTW--HEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSSPFNTLDFSKHSQNLFAA 266

Query: 117 CGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIY 176
            GT     D+ +++YD+R  +  +   +  H D +T ++F P    IL S  +D    ++
Sbjct: 267 AGT-----DSLVYLYDLRNTADALHT-MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLW 320

Query: 177 DL-------AQEDEDEALHQVINYASIH-------SCGWLSPKRIYTLSHMETFAIHELN 222
           DL       AQED  + + +++   + H       S  W  P   + ++ +E   I  + 
Sbjct: 321 DLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIP---WLMASVEEDNIVHVW 377

Query: 223 DKSDELTEPRPLDFGDIR 240
             S +LT P  +   DIR
Sbjct: 378 KVSKKLTSPGLIQDYDIR 395

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 85/194 (43%), Gaps = 30/194 (15%)

Query: 2   SAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGE--TNI 58
           S  L + + F  DN + L    L    LL  S + +V L           +EVG   T+I
Sbjct: 175 SGGLQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVAL-----------WEVGSNSTSI 223

Query: 59  NSLRVIN-------NDFE----NGCIFAATSLASV-KIYDVRNGDSPVATIKNDKNSVFL 106
           + +R  N       ND +    N  +F   S  S+ KI DVR  +  +  +K  +    L
Sbjct: 224 SPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNITIDAVKCPQPFNTL 283

Query: 107 SLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLS 166
           +       L+      G+D+ +++YD+R   +P+   +  H D +T+I+F      +++S
Sbjct: 284 AFSHHSSNLLAAA---GMDSHVYLYDLRNMREPLH-HMSGHEDAVTNIEFSTHVDGVVVS 339

Query: 167 GSTDGYTNIYDLAQ 180
             +D    ++DL Q
Sbjct: 340 SGSDNRLIMWDLKQ 353

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 78/165 (47%), Gaps = 31/165 (18%)

Query: 28  LLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRV---INNDFENGC--------IFAA 76
           LL  S +G++ L  WN         V  +N + + V   +++D  N C        +F +
Sbjct: 188 LLSGSDDGTIAL--WN---------VNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGS 236

Query: 77  TSL-ASVKIYDVRNGDSPVATIKNDK--NSVFLSLESRHDMLVCGTELTGVDAEMFIYDV 133
            S  ++++++D R  D+  +  K D   N++  S  S++     GT     D+ ++++D 
Sbjct: 237 VSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGT-----DSHVYLFDR 291

Query: 134 RYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           R  S+P+ +    H   +T+++F P    IL++   D    I+D+
Sbjct: 292 RDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 80/188 (42%), Gaps = 16/188 (8%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWNSPS-IIKKFEVGETNINSLRVINNDFENG 71
           + + L+  PL   G LL    +G V L   ++   I  K      N  S+  I       
Sbjct: 286 EGYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEA 345

Query: 72  CIFAATSL-ASVKIYDVRNGD-SPVATIKNDKNSV-FLSLESRHDMLVCGTELTGVDAEM 128
            +FA+      ++I+D R+    P  ++K     V  +S   +   L+   +  G     
Sbjct: 346 TVFASCGCDGYIRIWDTRSKKHKPAISVKASATDVNVISWNEKIGYLLASGDDNG---SW 402

Query: 129 FIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
            ++D+R FS        PV  + + H   IT I F+P D +I+   S D   +++DL+ E
Sbjct: 403 GVWDLRQFSPNTAASTSPVAQY-NFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVE 461

Query: 182 DEDEALHQ 189
            +DE + Q
Sbjct: 462 ADDEEIKQ 469

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 59/142 (41%), Gaps = 10/142 (7%)

Query: 69  ENGCIFAATSLASVKIYDV------RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           ENG ++       VK +++      +    P+ T+++  N    +L+    +   G+ LT
Sbjct: 245 ENGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALD-WSPLNKSGSLLT 303

Query: 123 GVDAEMFIYDVRYFSKPVR---AFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           G  +       R+ SK +    AF   ++  I DI+F  ++  +  S   DGY  I+D  
Sbjct: 304 GDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIRIWDTR 363

Query: 180 QEDEDEALHQVINYASIHSCGW 201
            +    A+    +   ++   W
Sbjct: 364 SKKHKPAISVKASATDVNVISW 385

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 83/197 (42%), Gaps = 17/197 (8%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWN-SPSIIKKFEVGETNINSLRVINNDFENG 71
           + + L+  PL   G LL    +G + L   + S  I  K      N  S+  I       
Sbjct: 280 EGYGLDWSPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTES 339

Query: 72  CIFAATSL-ASVKIYDVRNGD--SPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEM 128
            +FA +     V+I+D R+      ++T  ++ +   +S   +   L+   +  G     
Sbjct: 340 TVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNG---SW 396

Query: 129 FIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
            ++D+R FS       +PV  + D H   IT I F+P D +++   S D    ++DL+ E
Sbjct: 397 GVWDLRQFSPANSEGVQPVAQY-DFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVE 455

Query: 182 -DEDEALHQVINYASIH 197
            D+DE   Q   Y  + 
Sbjct: 456 ADDDEIQQQTKEYKELQ 472

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 59/142 (41%), Gaps = 10/142 (7%)

Query: 69  ENGCIFAATSLASVKIYDVRNGDSP------VATIKNDKNSVFLSLESRHDMLVCGTELT 122
           ENG ++     A  K ++      P      + TI+N  N     L+    ++  G  LT
Sbjct: 239 ENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEGYGLD-WSPLIKTGALLT 297

Query: 123 GVDAEMFIYDVRYFSKPV---RAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           G  +       R+ SK +   + F  +++  + DI++ P++  +  +  TDGY  I+D  
Sbjct: 298 GDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDGYVRIWDTR 357

Query: 180 QEDEDEALHQVINYASIHSCGW 201
            +    A+    +   ++   W
Sbjct: 358 SKKHKPAISTRASNTDVNVISW 379

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 77/188 (40%), Gaps = 16/188 (8%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWNSPS-IIKKFEVGETNINSLRVINNDFENG 71
           + + L+  PL   G LL    +G V L   ++   I  K      N  S+  I       
Sbjct: 287 EGYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEA 346

Query: 72  CIFAATSL-ASVKIYDVRNGD-SPVATIKNDKNSV-FLSLESRHDMLVCGTELTGVDAEM 128
            +FA       ++I+D R+    P  ++K     V  +S   +   L+   +  G     
Sbjct: 347 TVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGT---W 403

Query: 129 FIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
            ++D+R FS        PV  +   H   IT I F+P D +I+   S D    ++DL+ E
Sbjct: 404 GVWDLRQFSPNNAASVSPVAQY-SFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVE 462

Query: 182 DEDEALHQ 189
            +DE + Q
Sbjct: 463 ADDEEIKQ 470

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 4/75 (5%)

Query: 111 RHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSG-ST 169
           ++DM++C  +  G   ++ I+D+R F +P++ +     D I+ I+++P    IL +    
Sbjct: 292 KNDMILCTGDSQG---QLKIWDIRDFKEPIKEWEHGDQDPISAIQWNPQIPQILATADQQ 348

Query: 170 DGYTNIYDLAQEDED 184
            G   I+D + E ED
Sbjct: 349 SGLVKIWDASGEQED 363

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 69/163 (42%), Gaps = 15/163 (9%)

Query: 31  SSSNGSVNLID----WNSPSIIKKFEV------GETNINSLRVINNDFENGCIFAATSLA 80
           +SSNGSV + D     N  S  +KFE+       +    SL +  N    G +    S  
Sbjct: 149 ASSNGSVYIFDRTKHGNKISTGRKFEIECRNNGDDEQDESLSLAWNYQLEGTLATCQSNG 208

Query: 81  SVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDM--LVCGTELTGVDAE---MFIYDVRY 135
            VK++D+   D     ++  +    +     +D+  +V  T +     E   + + D+R 
Sbjct: 209 KVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSILASCGESNVIGLIDIRQ 268

Query: 136 FSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
            +K       +H D I  I+F+  +  IL +G + G   I+D+
Sbjct: 269 DTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDI 311

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 92/207 (44%), Gaps = 19/207 (9%)

Query: 3   AKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSL 61
           + L++ + +  DN + L   P     L+  S + ++ L  W++ +   K  + E   +  
Sbjct: 141 SALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIAL--WDATNDKLKQPIQEWTTSHS 198

Query: 62  RVINND----FENGCIFAATSLASVKIYDVRNGDSPVATI--KNDKNSVFLSLESRHDML 115
            ++N+     F      + +  ++++++D RNG      I  K   NS+  S  S +   
Sbjct: 199 DIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFA 258

Query: 116 VCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNI 175
             GT        +++YD+R   K + +    H + +T ++F      IL+SGS+D    +
Sbjct: 259 AAGTT-----NNIYLYDIRNTGKILHSMT-GHEEPVTSLEFSNDKDGILISGSSDRRVIM 312

Query: 176 YDL----AQEDEDEALHQVINYASIHS 198
           +DL    A++  DEA   +     IH+
Sbjct: 313 WDLFEIGAEQQPDEADDGLPEVMMIHA 339

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 84/190 (44%), Gaps = 20/190 (10%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWNSPSII---KKFEVGETNINSLRVINNDFE 69
           + + L+  PL   G LL    +G + L   ++   +   + + VG  N  S+  I     
Sbjct: 277 EGYGLDWSPLIKSGALLSGDCSGQIYLTQRHTSKWVTDKQAYSVG--NNKSIEDIQWSKT 334

Query: 70  NGCIFAATSL-ASVKIYDVRNGD-SPVATIKNDKNSV-FLSLESRHDMLVCGTELTGVDA 126
              +FA       ++++D R+    P  ++K     V  +S   +   L+   +  G   
Sbjct: 335 ESTVFATAGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWNEKIGYLLASGDDNG--- 391

Query: 127 EMFIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
              ++D+R F+       +PV  + + H   IT I F+P +++I+  GS D    ++DL+
Sbjct: 392 SWGVWDLRQFTPDNAANIQPVAQY-NFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLS 450

Query: 180 QEDEDEALHQ 189
            E +DE + Q
Sbjct: 451 VEADDEEIKQ 460

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 58/142 (40%), Gaps = 10/142 (7%)

Query: 69  ENGCIFAATSLASVKIYDV------RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           ENG ++     A  K ++       +    PV TI+N  N     L+    ++  G  L+
Sbjct: 236 ENGEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLD-WSPLIKSGALLS 294

Query: 123 GVDAEMFIYDVRYFSKPV---RAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           G  +       R+ SK V   +A+   ++  I DI++  ++  +  +   DGY  ++D  
Sbjct: 295 GDCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATAGCDGYIRVWDTR 354

Query: 180 QEDEDEALHQVINYASIHSCGW 201
            +    A+    +   ++   W
Sbjct: 355 SKKHKPAISVKASNTDVNVISW 376

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 80/188 (42%), Gaps = 16/188 (8%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWN-SPSIIKKFEVGETNINSLRVINNDFENG 71
           + + L+  PL   G LL    +G V L   + S  +  K     +N  S+  I       
Sbjct: 278 EGYGLDWSPLIKTGALLTGDCSGQVYLTQRHTSKWVTDKQPFTFSNNKSIEDIQWSRTES 337

Query: 72  CIFAATSL-ASVKIYDVRNGD-SPVATIKNDKNSV-FLSLESRHDMLVCGTELTGVDAEM 128
            +FA +     ++I+D R+    P  + +     V  +S   +   L+   +    D   
Sbjct: 338 TVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGD---DDGRW 394

Query: 129 FIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
            ++D+R  S       +PV  + D H   IT I F+P D++I+   S D    ++DL+ E
Sbjct: 395 GVWDLRQLSPNNSENVQPVAQY-DFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVE 453

Query: 182 DEDEALHQ 189
            +DE + Q
Sbjct: 454 ADDEEIKQ 461

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 58/142 (40%), Gaps = 10/142 (7%)

Query: 69  ENGCIFAATSLASVKIYDV------RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           ENG ++        K ++       ++   P+ TI+N  N     L+    ++  G  LT
Sbjct: 237 ENGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLD-WSPLIKTGALLT 295

Query: 123 GVDAEMFIYDVRYFSKPV---RAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           G  +       R+ SK V   + F  S++  I DI++  ++  +  +   DGY  I+D  
Sbjct: 296 GDCSGQVYLTQRHTSKWVTDKQPFTFSNNKSIEDIQWSRTESTVFATSGCDGYIRIWDTR 355

Query: 180 QEDEDEALHQVINYASIHSCGW 201
            +    A+    +   ++   W
Sbjct: 356 SKKHKPAISTRASATDVNVISW 377

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 84/190 (44%), Gaps = 20/190 (10%)

Query: 14  DNWCLELKPLYSRG-LLCSSSNGSVNLIDWNSPSII---KKFEVGETNINSLRVINNDFE 69
           + + L+  PL   G +L    +G V L    +   +   + F VG  N  S+  I     
Sbjct: 286 EGYGLDWSPLIKTGSILTGDCSGRVYLTQRTASRWVTDKQPFTVG--NNKSIEDIQWSRA 343

Query: 70  NGCIFAATSL-ASVKIYDVRNGD--SPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDA 126
              +FA   +   ++I+D R+      ++ + +D +   +S   +   L+   + +G   
Sbjct: 344 EMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGDDSGT-- 401

Query: 127 EMFIYDVRYFSK-------PVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
              ++D+R FS        PV  + + H   IT I F+P D++I+   S D    ++DL+
Sbjct: 402 -WGVWDLRQFSAQNTEKTTPVAQY-NFHKAAITSISFNPLDESIIAVASEDNTVTLWDLS 459

Query: 180 QEDEDEALHQ 189
            E +DE + Q
Sbjct: 460 VEADDEEIKQ 469

>Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782
           bp, 593 aa] {ON} YGR225W (REAL)
          Length = 593

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 69/170 (40%), Gaps = 22/170 (12%)

Query: 5   LVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETN------- 57
           L +Q  F +     E +P++   +  + S   +  ++W  P  + KF +GE N       
Sbjct: 299 LYDQKEFFHSTKTDEKEPVF---VFQTESFKGICCLEWFKPGDVCKFYIGEENGSVTLFE 355

Query: 58  INSLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVC 117
           I +LR     +     F   +L  +K++      +        +    +SL    ++L  
Sbjct: 356 IKNLRFPAKKWSKRQKFQEDNLIGLKLHSTYQAQA--------QQVCGISLNEHSNLLAV 407

Query: 118 GTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSG 167
           G    G D    ++D+    KP++ FV  H   +  I F P  K++L +G
Sbjct: 408 G----GNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLATG 453

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 83/183 (45%), Gaps = 8/183 (4%)

Query: 2   SAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60
           S  L + + F  DN + L    L    LL  S + +V L +  S     K      +++S
Sbjct: 149 SEGLQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHS 208

Query: 61  LRVINNDFEN--GCIFAATSLASV-KIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVC 117
             + +N + N    +F   S  S+ KI DVR  ++ + T+K  +    L+       L+ 
Sbjct: 209 DIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLA 268

Query: 118 GTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYD 177
                G+D+ +++YD+R   +P+   +  H D + +++F      +++S  +D    ++D
Sbjct: 269 AA---GMDSYVYLYDLRNMKEPLH-HMSGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWD 324

Query: 178 LAQ 180
           L Q
Sbjct: 325 LKQ 327

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 65/128 (50%), Gaps = 11/128 (8%)

Query: 69  ENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLS--LESRHDMLVCGTELTGVDA 126
           E G I +A+    +K++D R+G   V+T+ N K++V  +    ++ ++L   ++    D 
Sbjct: 223 EMGLIVSASKDNLIKLWDPRSGQC-VSTLLNFKHTVLKTKFQPTKGNLLAAISK----DK 277

Query: 127 EMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEA 186
              ++D+RY  K +    D    D   + +HP+++++    S DG    +D+ Q  E+  
Sbjct: 278 SCRVFDIRYHMKELTVIRD--EVDYMTLLWHPTNESMFTIASYDGAIKHFDILQNLEEP- 334

Query: 187 LHQVINYA 194
             QVI YA
Sbjct: 335 -QQVIPYA 341

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 52/108 (48%), Gaps = 11/108 (10%)

Query: 80  ASVKIYDVRN-------GDSPVATIKNDKNS-VFLSLE-SRHDMLVCGTELTGVDAEMFI 130
            SV+++D+R+        + PV+ +  D +    L LE S HD  V  T       ++ I
Sbjct: 299 GSVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMAT-FAADSNKILI 357

Query: 131 YDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
            D+R    P+   ++ H   +  IK+HP  +N+LLSG  D     +DL
Sbjct: 358 LDMRNPESPL-MILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDL 404

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 91/205 (44%), Gaps = 24/205 (11%)

Query: 3   AKLVNQITF------GNDNW-CLELK--PLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEV 53
           AKL  Q  F       ND + CL +   P     LL   SNG+++L D+      K  E+
Sbjct: 177 AKLAKQRKFVIEDGTKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREI 236

Query: 54  G----ETNINSLRVINNDFENG--CIFAATSLAS-VKIYDVRNGDSPVATIKNDKNSVFL 106
                +TN + L      + NG   IFA     + + ++D R      +  + + N    
Sbjct: 237 NNTIWDTNFDDLGCNEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGIN 296

Query: 107 SLESRHD--MLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNIL 164
           S +  ++  ML+   +  G+   + ++D+R  +KP+R     H   I+ I++ P    ++
Sbjct: 297 SCKFNYENAMLLASGDSNGI---INLWDIRKLNKPIRNLY--HGSSISTIEWSPLMNEMI 351

Query: 165 LSGST-DGYTNIYDLAQEDEDEALH 188
            SG   DG   ++D++ E+E   +H
Sbjct: 352 ASGGQEDGLVKLWDISNEEEPIFIH 376

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 113 DMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSG-STDG 171
           DML+C  + TG    + ++D+R    P+++    H   I+  +++P+   IL +   +DG
Sbjct: 310 DMLLCSGDSTG---RVNLWDIRDLETPLKSL--DHGSSISKTQWNPNLSTILATADQSDG 364

Query: 172 YTNIYDLAQEDEDEAL 187
              ++D+AQE  +E L
Sbjct: 365 LVKLWDIAQEPGEELL 380

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 61/130 (46%), Gaps = 18/130 (13%)

Query: 72  CIFAATSL-ASVKIYDVRNGD-SPVATIK---NDKNSVFLSLESRHDMLVCGTELTGVDA 126
            +FA+  +   ++I+D R+    P  ++K    D N +  S E    +L  G +    D 
Sbjct: 347 TVFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWS-EKIGYLLASGDD----DG 401

Query: 127 EMFIYDVRYFS-------KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
              ++D+R F+        PV  +   H   IT I F+P D++I+   S D    ++DL+
Sbjct: 402 TWGVWDLRQFTPQNASTASPVAQY-QFHKGAITSISFNPLDESIIAVASEDNTVTLWDLS 460

Query: 180 QEDEDEALHQ 189
            E +DE + Q
Sbjct: 461 VEADDEEIKQ 470

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 52/118 (44%), Gaps = 10/118 (8%)

Query: 69  ENGCIFAATSLASVKIYDV------RNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           ENG ++     + VK ++       +    P+ T++N   SV         ++  G  L+
Sbjct: 246 ENGEVYIFDLASQVKAFETPGYQIPKQAKRPIHTVRN-HGSVEGYANDWSPIIKTGAMLS 304

Query: 123 GVDAEMFIYDVRYFSKPV---RAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYD 177
           G  +       R+ SK +   +AF  +++  I D+++  ++  +  S   DGY  I+D
Sbjct: 305 GDCSGQVFLTQRHTSKWITDKQAFTVANNKSIEDLQWSRTESTVFASCGIDGYIRIWD 362

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 67/154 (43%), Gaps = 12/154 (7%)

Query: 37  VNLIDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAAT-SLASVKIYDVRNGDSPVA 95
           + L D N  + I     G  N+ +++   N+ +   I A+T S  S+ +YD+R  +SP  
Sbjct: 194 IELWDSNRSNPISNLSWGADNVTNVKFNQNEHD---ILASTGSDNSIVLYDLRT-NSPTQ 249

Query: 96  TIKNDKNSVFLSLESRHDM-LVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDI 154
            I     +  L          V   E    D   + YD+RY S+ +  F D H   + D+
Sbjct: 250 KIVQTMRTNSLCWNPMEAFNFVTANE----DQNSYYYDMRYMSRALNVFKD-HVSAVMDV 304

Query: 155 KFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALH 188
            F P+ + I ++GS D    IY++      E  H
Sbjct: 305 DFSPTGQEI-VTGSYDKTIRIYNIKHGHSREIYH 337

>YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {ON}
            AMA1Activator of meiotic anaphase promoting complex
           (APC/C); Cdc20p family member; required for initiation
           of spore wall assembly; required for Clb1p degradation
           during meiosis
          Length = 593

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 71/180 (39%), Gaps = 42/180 (23%)

Query: 5   LVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVI 64
           L +Q  F + +   E +P++   +  + S   +  ++W  P  I KF VGE N N     
Sbjct: 299 LYDQKEFFHSSNTNEKEPVF---VFQTESFKGICCLEWFKPGEICKFYVGEENGN----- 350

Query: 65  NNDFENGCIFAATSLASVKIYDVRNGDSPVATIKN-----DKNSVFLSLESRHD---MLV 116
                            V ++++++   P+          D+N + L L S +      V
Sbjct: 351 -----------------VSLFEIKSLHFPIKNWSKRQKLEDENLIGLKLHSTYQAQAQQV 393

Query: 117 CGTELT---------GVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSG 167
           CG  L          G D    ++D+    KP++ FV  H   +  I F P  K++L +G
Sbjct: 394 CGISLNEHANLLAVGGNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLATG 453

>TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON}
           Anc_8.585 YBR175W
          Length = 336

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 61/118 (51%), Gaps = 26/118 (22%)

Query: 69  ENGCIFAATSLASVKIYDVRNG--------DSPVATIK-NDKNSVFLSLESRHDMLVCGT 119
           +N CI + ++  S++IY ++ G         +PV +IK N+K ++ LS            
Sbjct: 81  DNQCIASGSNDCSIEIYHLQYGLLHKLTGHTAPVTSIKYNEKGNLLLSCS---------- 130

Query: 120 ELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYD 177
               VD  + I+D+ + +  +R  +++H+D +  I F+ +D +I  SGS DG   +YD
Sbjct: 131 ----VDESIKIWDILHGTN-LRT-INTHNDPVVTIDFN-NDSSIFSSGSHDGLVRLYD 181

>Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 59/145 (40%), Gaps = 39/145 (26%)

Query: 40  IDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKN 99
           ++W  P  + KF +GE             ENG         SV +++++N   P+     
Sbjct: 331 LEWFKPGDVCKFFIGE-------------ENG---------SVSLFEIKNLHFPLKKWNK 368

Query: 100 -----DKNSVFLSLESRHD---MLVCGTELT---------GVDAEMFIYDVRYFSKPVRA 142
                +++ + L L+S +      VCG  L          G D    ++D+    KPV+ 
Sbjct: 369 RQKYEEEDLIGLKLQSTYQAQAQQVCGISLNEHSNLLAVGGNDNSCSLWDISNLDKPVKK 428

Query: 143 FVDSHHDDITDIKFHPSDKNILLSG 167
           FV  H   +  I F P  K++L +G
Sbjct: 429 FVLPHKAAVKAIAFCPWSKSLLATG 453

>SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {ON}
           conserved hypothetical protein
          Length = 959

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 39/81 (48%), Gaps = 5/81 (6%)

Query: 101 KNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHD-DITDIKFHPS 159
           K +  LSL      L+ G   TG    + +Y +   S    AFV  HH   I ++KFHP+
Sbjct: 136 KTTSCLSLSPDEKFLIVGE--TGHHPRVLLYSLAPDSNDFPAFVIHHHSYGIANLKFHPT 193

Query: 160 DKNILLSGS--TDGYTNIYDL 178
           D  I LS     DG+ +I+ L
Sbjct: 194 DPKIFLSLGLINDGFLHIWRL 214

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 60/125 (48%), Gaps = 7/125 (5%)

Query: 71  GCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLS-LESRHDMLVCGTELTGVDAEMF 129
           G I + +    +K +D R+G S V+T+   K+++  +  + +   L+    +   D    
Sbjct: 220 GLIVSGSKDNLIKFWDPRSG-SCVSTMLGFKHTIISTKFQPKQGNLL---SVISKDKTCK 275

Query: 130 IYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQ 189
           +YD+R  +K + +  D    D   +++HP D+ +   G  DG    +DL+QE++      
Sbjct: 276 VYDIRQQAKELFSVRDD--VDYMTLQWHPIDETVFTVGCYDGSIKHFDLSQENQPNKPTH 333

Query: 190 VINYA 194
            I YA
Sbjct: 334 NIPYA 338

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 60/121 (49%), Gaps = 5/121 (4%)

Query: 64  INNDFENGCIFAATSLAS-VKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           IN + ++  I A  S+ + V  +D+R+   P  T  + ++S      +  D  +  +   
Sbjct: 121 INFNSQHPDILATCSIDTYVHAWDMRSPHRPFYTTSSWRSSASQVKWNFKDSNILASSHG 180

Query: 123 GVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQED 182
               ++FI+D+R+ S P+      H+  +  I F   ++N ++S S DG    +DL++E+
Sbjct: 181 N---DVFIWDLRHGSTPLHKLT-GHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLSKEE 236

Query: 183 E 183
           +
Sbjct: 237 K 237

>CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa]
           {ON} highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093w
          Length = 517

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 5/112 (4%)

Query: 74  FAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDV 133
           FA TS   V+++  R   + + T    K+ V+ +   +   L+C  + TG+ +    Y+ 
Sbjct: 55  FAVTSSTRVQVFSSRTRQA-IKTFSRFKDVVYSASYRKDGKLLCAGDATGLVSVYDSYNP 113

Query: 134 RYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDE 185
           R     V A    H   +T  KFH  D   L+S S D  T ++D++   E +
Sbjct: 114 RTLLVSVAA--SQHPTHVT--KFHDHDLKTLVSASDDRVTRVWDISHAYEPQ 161

>Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 37.4 bits (85), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 56/145 (38%), Gaps = 39/145 (26%)

Query: 40  IDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKN 99
           ++W  P  + KF +GE N N                      V +++++N   P+     
Sbjct: 331 LEWFKPGDVCKFFIGEENGN----------------------VSLFEIKNLHFPLKKWNK 368

Query: 100 -----DKNSVFLSLESRHD---MLVCGTELT---------GVDAEMFIYDVRYFSKPVRA 142
                ++N + L L S +      VCG  L          G D    ++D+    KPV+ 
Sbjct: 369 RQKFEEENLIGLKLHSTYQAQAQQVCGISLNEHSGLLAVGGNDNSCSLWDISNLDKPVKK 428

Query: 143 FVDSHHDDITDIKFHPSDKNILLSG 167
           FV  H   +  I F P  K++L +G
Sbjct: 429 FVLPHKAAVKAIAFCPWSKSLLATG 453

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 60/112 (53%), Gaps = 11/112 (9%)

Query: 81  SVKIYDVRNGDSPVATIKNDKNSVFLS---LESRHDMLVCGTELTGVDAEMFIYDVRYFS 137
           S+ ++D R   + VA I+N   S  ++       +++L+  T+ TG      ++DVR  S
Sbjct: 273 SLALFDTR-AQNAVAKIRNQFKSEGINACKFNWENNLLLASTDSTG---RTNLWDVRKLS 328

Query: 138 -KPVRAFVDSHHDDITDIKFHPSDKNILLS-GSTDGYTNIYDLAQEDEDEAL 187
            +P+  F   H   ++ ++++P D ++L + G +DG   I+D + E ED+ +
Sbjct: 329 AEPIVHF--DHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWDTSLEIEDKTI 378

>KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {ON}
           Anc_2.469 YMR093W
          Length = 508

 Score = 37.4 bits (85), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (47%), Gaps = 9/122 (7%)

Query: 74  FAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHD--MLVCGTELTGVDAEMFIY 131
           FA TS   V+I+  +     V T    K+ V+ S   R+D  +LV G + TG+ +    Y
Sbjct: 55  FAVTSSTRVQIFSSKTRQV-VKTFSRFKDVVY-SASFRNDGKLLVAG-DATGLVSVYDAY 111

Query: 132 DVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQVI 191
           + R     + A   +H   +T  KFHP D   L++ S D  T I+D++   E + L    
Sbjct: 112 NPRSILLSINA--STHPTHVT--KFHPQDNKTLVTTSDDRVTRIWDISHAYEAQELTGAS 167

Query: 192 NY 193
           +Y
Sbjct: 168 DY 169

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 57/118 (48%), Gaps = 9/118 (7%)

Query: 71  GCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLS--LESRHDMLVCGTELTGVDAEM 128
           G I + +    +K++D R+G   ++TI   K+++  +    ++ +ML     +   D   
Sbjct: 222 GLIASGSKDNLIKLWDPRSGQC-ISTILGCKHTIISTKFQPTKGNMLA----VISKDKSC 276

Query: 129 FIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEA 186
            ++D+R   K +  + D    D   + +HP +++I   G  DG    +DL QE +D +
Sbjct: 277 RVFDIRQNMKELAVYRD--ESDYMSLTWHPINESIFTVGCYDGSMKHFDLMQEPQDSS 332

>NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {ON}
           Anc_8.631
          Length = 428

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 123 GVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           G D   +I+D R  S   + FV     D+T IKF   D N +++GS DG  N++DL
Sbjct: 251 GSDGYTYIWDTRSPSAVQKFFVSD--SDVTSIKFF-KDGNSIITGSDDGIINMFDL 303

>Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {ON}
           complement(30466..31824) [1359 nt, 453 aa]
          Length = 452

 Score = 36.6 bits (83), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 65/128 (50%), Gaps = 11/128 (8%)

Query: 69  ENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGV--DA 126
           E G I +A+    ++++D R+G   ++++ N K++V   L++R      G  LT +  D 
Sbjct: 219 EMGLIVSASKDNLIRLWDPRSGQC-ISSLLNFKHTV---LKTRFQP-TKGNLLTAISKDK 273

Query: 127 EMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEA 186
              ++D+R+  + +  + D    D   +++HP+++ +    S DG    +D+ Q+ E   
Sbjct: 274 SCRVFDIRHSMRELMVYRD--EVDYMTLEWHPTNETMFTVASYDGSLKHFDILQDLEKPT 331

Query: 187 LHQVINYA 194
              V+ YA
Sbjct: 332 --HVVPYA 337

>KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.119
           YGL004C
          Length = 409

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (65%), Gaps = 3/41 (7%)

Query: 130 IYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTD 170
           +Y+ +Y  + VR   D+H  DIT +KF PS + +LLS STD
Sbjct: 125 VYNAKY--ETVREIEDAHASDITSLKFFPSGE-VLLSASTD 162

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 56/118 (47%), Gaps = 9/118 (7%)

Query: 71  GCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLS--LESRHDMLVCGTELTGVDAEM 128
           G I + +    VK++D R G   ++TI   K+++  +    ++ +ML     +   D   
Sbjct: 222 GLIASGSKDNLVKLWDPRAGQC-ISTILGCKHTIISTKFQPTKGNMLA----VISKDKSC 276

Query: 129 FIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEA 186
            I+D+R   K +  + D    D   + +HP ++++   G  DG    +DL QE +D +
Sbjct: 277 RIFDIRQNMKELAVYRD--ESDYMSLTWHPINESMFTVGCYDGSMKHFDLLQEPQDSS 332

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 9/126 (7%)

Query: 71  GCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLS--LESRHDMLVCGTELTGVDAEM 128
           G I + +    +K++D R+G   ++TI   K+++  +    ++ ++L     +   D   
Sbjct: 220 GLIVSGSKDNLIKLWDPRSGQC-ISTILGFKHTIIKTKFQPTKGNLLA----VVAKDKSC 274

Query: 129 FIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALH 188
            I+D+R   K +++F D    D   + +HP +++I   G  DG    +DL Q+       
Sbjct: 275 KIFDIRQNMKELKSFRDE--SDYMSLTWHPINESIFTVGCYDGSLKHFDLLQDTGSSNSF 332

Query: 189 QVINYA 194
             I YA
Sbjct: 333 HDIPYA 338

>ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR212W (STE4)
          Length = 467

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 11/97 (11%)

Query: 123 GVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQED 182
           G D  ++I+D R  +     FV     D++ +KF   + N + +GS DG TN+YDL  + 
Sbjct: 281 GSDGYLYIWDKRVPTSVQSFFVS--DSDVSKVKFF-RNGNTIATGSDDGCTNLYDLRSD- 336

Query: 183 EDEALHQVINYASIHSCGWLSP--KRIYTLSHMETFA 217
                 ++ NY+   S    +P  ++ Y +S+M+  A
Sbjct: 337 -----CRIANYSLSRSIHGATPVQQQTYIMSNMDYTA 368

>KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.469
           YMR093W
          Length = 509

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 8/141 (5%)

Query: 74  FAATSLASVKIYDVRNGDSPVATIKNDKNSVFLS-LESRHDMLVCGTELTGVDAEMFIYD 132
           FA TS   V+I+  R     V T    K+ V+ +   +   +LV G + TG+ +    Y+
Sbjct: 55  FAVTSSTRVQIFSSRTRQV-VKTFSRFKDVVYCANFRADGKLLVAG-DATGLVSVYDSYN 112

Query: 133 VRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDE-ALHQVI 191
            R     ++A   +H   +T  KFHP D   L++ S D  T ++D++   E    L    
Sbjct: 113 PRNVLVSIQA--STHPTHVT--KFHPMDSKTLITSSDDRVTRLWDISHAYEPTLELGGAT 168

Query: 192 NYASIHSCGWLSPKRIYTLSH 212
           +Y    +C   +P  + T S+
Sbjct: 169 DYVRSLTCVPSAPHLVATGSY 189

>Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON}
           similar to Ashbya gossypii ADL186C
          Length = 1317

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 114 MLVCGTELTGVDAEMFIYDVRYFS---KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTD 170
           + +CGT  +     + IYD+   S    P+ A    H   I  + F+    N+++SG  D
Sbjct: 209 IAICGTSTS-----LSIYDINRTSDIGSPLVATYSEHSRSINSVDFNMGQTNLIISGGQD 263

Query: 171 GYTNIYDL 178
           GY  ++DL
Sbjct: 264 GYIKVWDL 271

>Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W
           (REAL)
          Length = 205

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 5/70 (7%)

Query: 98  KNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFH 157
           +ND  ++ +SL    ++L  G    G D    ++D+    KPV+ FV  H   +  I F 
Sbjct: 1   QND-TTIGISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFC 55

Query: 158 PSDKNILLSG 167
           P  K++L +G
Sbjct: 56  PWSKSLLATG 65

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 73  IFAATSLA-SVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIY 131
           +F   SLA S  +Y+   G+  V  +    N++     S  D  +  T L     ++ I 
Sbjct: 317 VFDLRSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIAT-LVADSKDILIL 375

Query: 132 DVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           D+R    P    +  H   +  IK+HP+ +N+LLS S D     +DL
Sbjct: 376 DMRNPESPALT-LKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDL 421

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 94  VATIKNDKNSVFLSLE-SRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDIT 152
             T  +D +   L LE S +D  V  T       ++ I D+R    P+   ++ H   + 
Sbjct: 343 TTTPSSDGSYALLRLEPSPYDPNVLAT-FAADSNKIIILDMRNPESPILT-LEGHSSSVN 400

Query: 153 DIKFHPSDKNILLSGSTDGYTNIYDL 178
           +IK+HP+ +N+LLS S D     +DL
Sbjct: 401 EIKWHPTKRNVLLSCSDDCQVLYWDL 426

>ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004C RPN14 Putative non-ATPase subunit of the 19S
           regulatory particle of the 26S proteasome localized to
           the cytoplasm
          Length = 391

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 1/37 (2%)

Query: 145 DSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
           ++H D+IT +KF PS + +LLSGSTD    I+ LA E
Sbjct: 121 EAHLDEITCLKFFPSGQ-VLLSGSTDMRLKIWSLADE 156

>ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 510

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 5/112 (4%)

Query: 74  FAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDV 133
           FA TS   V+++  R     + T    K+ V+ +       L+C  + TG+ +    Y+ 
Sbjct: 55  FAVTSSTRVQLFSSRTRQV-IKTFSRFKDVVYSASFRNDGKLLCAGDATGLVSVYDSYNP 113

Query: 134 RYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDE 185
           R     + A   +H   +T  KFH  D   L++ S D  T ++D++Q  E +
Sbjct: 114 RALLVSINA--STHPTHVT--KFHSHDSKSLVTASDDRITRVWDISQSYEPQ 161

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 77/178 (43%), Gaps = 14/178 (7%)

Query: 2   SAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSL 61
           SA+LV +    N    +   P++      +SS   V L    +  +IK F   +  + S 
Sbjct: 32  SAQLVKE---HNSVTHIAFNPVHPHDFAVTSST-RVQLFSSRTRQVIKTFSRFKDVVYSA 87

Query: 62  RVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDM--LVCGT 119
               ND +  C   AT L SV  YD  N  + + +I    +   ++    HD   LV  +
Sbjct: 88  S-FRNDGKLLCAGDATGLVSV--YDSYNPRALLVSINASTHPTHVTKFHSHDSKSLVTAS 144

Query: 120 ELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYD 177
           +    D    ++D+    +P +  +    D +  + F P+  +++++GS DG+  +YD
Sbjct: 145 D----DRITRVWDISQSYEP-QLELKGASDYVRSVNFVPAAPHLVMTGSYDGHVRLYD 197

>TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1549

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 65/160 (40%), Gaps = 12/160 (7%)

Query: 28   LLCSSSNGSVNLIDWNSPSIIKKFEVGE---TNINSLRVINNDFENGCIFAATSLASVKI 84
            L+ +    ++ + DW S  I  KF  G    T I SL++IN D +N  +   +S   VK+
Sbjct: 1199 LITADERDNITVFDWESSQICSKFSNGNPYGTKITSLQLINED-DNALLLTGSSNGIVKV 1257

Query: 85   YDVRNGDSPVATIKNDKNSVFLSLESRHDMLVC------GTELTGVDAEMF-IYDVRYFS 137
            +   +    V  I + +    + L  R   L+       G  L   D ++  I+D    S
Sbjct: 1258 FKNMHDSEDVEVINSWRALTDMLLTPRSSGLLLEWQQMKGYLLATGDVKVIRIWDAHTES 1317

Query: 138  KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYD 177
              V     +    IT I       NI + G TDG   +YD
Sbjct: 1318 MEVDIPAKTS-SLITSITSDQLSGNIFVCGFTDGSLRVYD 1356

>YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G
           protein beta subunit, forms a dimer with Ste18p to
           activate the mating signaling pathway, forms a
           heterotrimer with Gpa1p and Ste18p to dampen signaling;
           may recruit Rho1p to the polarized growth site during
           mating; contains WD40 repeats
          Length = 423

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 11/80 (13%)

Query: 33  SNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENG-CIFAATSLASVKIYDVRNGD 91
           S+G   + D  SPS ++ F V +++IN+LR     F++G  I A +   ++ +YD+R+ D
Sbjct: 248 SDGYTYIWDSRSPSAVQSFYVNDSDINALRF----FKDGMSIVAGSDNGAINMYDLRS-D 302

Query: 92  SPVATIKNDKNSVFLSLESR 111
             +AT      S+F   E R
Sbjct: 303 CSIATF-----SLFRGYEER 317

>NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {ON}
           Anc_8.67
          Length = 730

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 71/157 (45%), Gaps = 20/157 (12%)

Query: 29  LCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYDVR 88
           +CS+ N  +N     +P + K   + E+ +++  V NN+      F    + S++I  ++
Sbjct: 285 VCSNWNAIIN----TTPLLWKNLLISESFVSAQEVANNN-NKSSFFKEKFIESLRI--LQ 337

Query: 89  NGDSPV-----ATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAF 143
           N  +P       T+     SV   L+   D ++ G +    D ++ IYD R  SK     
Sbjct: 338 NWYNPSFKPERTTLTGHATSVVTCLQFEDDYVITGAD----DRQLRIYDAR--SKKFLKE 391

Query: 144 VDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
           +  H   +  +K+      I++SGSTD    I+D+ +
Sbjct: 392 LSGHEGGVWALKYDAD--GIIVSGSTDRSVRIWDIKR 426

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 51/108 (47%), Gaps = 6/108 (5%)

Query: 70  NGCIFAATSLASVK-IYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEM 128
           +G +  +  L S+  ++D+R+G + V    + K    +   S    L  G    G D  +
Sbjct: 319 DGALICSGGLDSLAMVWDLRSGKNIVTLQGHAKPVYCVDWSSNSHQLATG----GGDGVV 374

Query: 129 FIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIY 176
            ++D+R   +P    + +H   ++ ++F  +  ++L+SG  D   N+Y
Sbjct: 375 NVWDLRKLEQPATKLL-AHKSIVSSLRFERNRGDVLVSGGYDRALNVY 421

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 126 AEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           +++ I D+R    P+   +++H   I  IK+HP+ +N+LLS S D     +DL
Sbjct: 335 SKVLILDMRSPGSPLLT-LEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDL 386

>KAFR0C02950 Chr3 complement(589512..590963) [1452 bp, 483 aa] {ON}
           Anc_8.150 YGL190C
          Length = 483

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 43/96 (44%), Gaps = 18/96 (18%)

Query: 17  CLELKPLYSRGLLCSSSNGSVNLIDWNSPSII-KKFEVGETNINSLRVINNDF------- 68
           C E  P++    + SSS G+V L D    S+   K +V E  +N    IN++F       
Sbjct: 223 CAEFHPIHCNYFMYSSSKGTVKLCDMRENSLCDNKAKVFEEYVNP---INHNFFTEITSS 279

Query: 69  -------ENGCIFAATSLASVKIYDVRNGDSPVATI 97
                   NG   A+    +VKI+DV   + P+ TI
Sbjct: 280 ISDIKFSPNGRYIASRDYLTVKIWDVNMNNKPIKTI 315

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%)

Query: 134 RYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           R  S  V   +  H   ITDI FHP++  IL + S D Y + +D+
Sbjct: 100 RSSSNAVEHVLHGHSRAITDINFHPTNPEILATCSIDAYVHAWDM 144

>TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {ON}
           Anc_1.247 YKR036C
          Length = 730

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 9/75 (12%)

Query: 107 SLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLS 166
           +L+     L  GT+    D  + ++D+R  S  +   +  H D IT +KF   D N ++S
Sbjct: 586 ALQCFDSALATGTK----DGIIRLWDLR--SGEIARKLIGHQDAITSLKF---DTNNIIS 636

Query: 167 GSTDGYTNIYDLAQE 181
           GS DG T I+DL Q+
Sbjct: 637 GSLDGSTRIWDLRQD 651

>CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004c
          Length = 412

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 7/74 (9%)

Query: 105 FLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNIL 164
            +S ++  D +V G        ++ +YD  + SK   + V +H  D+T +K  PS+  +L
Sbjct: 104 LISCDASTDKIVIGDS----GGDINVYDHEWMSK--LSLVGAHVSDVTTVKIFPSNA-VL 156

Query: 165 LSGSTDGYTNIYDL 178
           LSGSTD    ++ L
Sbjct: 157 LSGSTDMQLKVWSL 170

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 63/128 (49%), Gaps = 11/128 (8%)

Query: 69  ENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGV--DA 126
           E G I +A+    VK++D R+G+  +++I   K++V   L++R    V G  L  +  D 
Sbjct: 230 EMGLIASASKDNLVKLWDPRSGNC-ISSILKFKHTV---LKTRFQP-VKGNLLMAISKDK 284

Query: 127 EMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEA 186
              ++D+RY  K +    D    D   +++HP ++++      DG    +DL Q+  +  
Sbjct: 285 SCRVFDIRYSMKELMCVRDE--TDYMTLEWHPINESMFTLACYDGSLKHFDLLQDLNEPV 342

Query: 187 LHQVINYA 194
           L   I YA
Sbjct: 343 L--TIPYA 348

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 3/75 (4%)

Query: 105 FLSLE-SRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNI 163
            L LE S HD  +  T       ++ I D+R    PV   +  H   +  IK+HP+++NI
Sbjct: 350 LLRLEPSPHDPNIVAT-FAADSNKIIILDMRNPETPVLT-LQGHSSSLNQIKWHPTERNI 407

Query: 164 LLSGSTDGYTNIYDL 178
           LLS + D     +DL
Sbjct: 408 LLSCADDCQVLYWDL 422

>KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.247
           YKR036C
          Length = 666

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 67/136 (49%), Gaps = 24/136 (17%)

Query: 55  ETNINSLRVINNDFENGCIFAATSL-ASVKIYDVRNGDSPVATIKNDKNSV-FLSLESRH 112
           E NI +L     DF NG +  A  L  ++K++D+    + +  +K  K +V  L ++  +
Sbjct: 365 EDNITTLDF---DFPNGTLSTAGHLDHTIKLWDLTKS-TQIGELKGHKATVNSLQMDLTY 420

Query: 113 DMLVCGTELTGVDAEMFIYDV----------RYFSKPVRAFVDSHHDDITDIKFHPSDKN 162
           +M++      G DA + +++V          RYF+  +  F DSH D+IT I  +  +  
Sbjct: 421 NMVISA----GKDATVKLWNVDLGIESFNTERYFNPCIYTF-DSHTDEITAISSYHEN-- 473

Query: 163 ILLSGSTDGYTNIYDL 178
            L+SGS D     +DL
Sbjct: 474 -LVSGSRDKTIRQWDL 488

>ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR093W
          Length = 518

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 5/110 (4%)

Query: 74  FAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDV 133
           FA TS   V+++  R     + T    K+ V+ S       L+   + TG+ +    Y+ 
Sbjct: 55  FAVTSSTRVQLFSSRTRQV-IKTFSRFKDVVYSSSFRPDGKLLAAGDATGLVSVYDSYNP 113

Query: 134 RYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDE 183
           R     ++A   +H   +T  KFHP DK  L++ + D    ++D++   E
Sbjct: 114 RNLLVSIKA--STHPAHVT--KFHPLDKQTLVTATDDRVVRVWDISHAYE 159

>KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {ON}
           similar to uniprot|Q06440 Saccharomyces cerevisiae
           YLR429W CRN1 Coronin cortical actin cytoskeletal
           component that associates with the Arp2p/Arp3p complex
           to regulate its activity
          Length = 707

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 138 KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQED 182
           KPVR  +  H   +  + FHP  +NIL S S D    I+D++QE+
Sbjct: 143 KPVR-MLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEE 186

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 67/141 (47%), Gaps = 12/141 (8%)

Query: 69  ENGCIFAATSLASVKIYDVRNG-------DSPVATIKNDKNSVF-LSLESRHDMLVCGTE 120
           +   + ++ S   V+I+D++         DSP+ +I++D + V  ++    HD L     
Sbjct: 212 QEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDASGVNDVTWMPTHDSLFAACT 271

Query: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
              V   + + D+R   + +R+   +H   +   KF+  +  +L S  ++G  N++D+ +
Sbjct: 272 EGNV---VSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNSLVLASADSNGRLNLWDIRK 328

Query: 181 EDEDEALHQVINYASIHSCGW 201
            +E   +  + + ASI +  W
Sbjct: 329 MNE-SPITTMEHGASISTLEW 348

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 60/124 (48%), Gaps = 10/124 (8%)

Query: 69  ENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGV--DA 126
           E G I + +    VK +D R+G   V+TI N K++V   L +R      G  L G+  D 
Sbjct: 220 EMGLIVSGSKDNLVKFWDPRSGQC-VSTILNFKHTV---LRTRFQP-TRGNYLLGISKDK 274

Query: 127 EMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEA 186
              ++D+R  +K +    D    D   + +HP ++++    + DG    +D+  ED ++ 
Sbjct: 275 SCRVFDIRNHTKELLTVRD--EVDFMTLSWHPINESVFTLANYDGSIKHFDIL-EDLEKP 331

Query: 187 LHQV 190
           +H +
Sbjct: 332 IHTI 335

>Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178W
           (REAL)
          Length = 470

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 44/82 (53%), Gaps = 7/82 (8%)

Query: 115 LVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTN 174
           LVC     G+D+   ++D+R  SK +   +  H   +  + + P+   +  +G  DG  N
Sbjct: 326 LVCSG---GMDSLTMLWDIRSGSKVMT--LAGHSKPVYTVAWSPNGYQVA-TGGGDGLIN 379

Query: 175 IYDLAQEDEDEALHQVINYASI 196
           ++D+ Q DE + L+Q++ + +I
Sbjct: 380 VWDIRQRDEGQ-LNQILAHRNI 400

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 59/131 (45%), Gaps = 17/131 (12%)

Query: 55  ETNINSLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDM 114
           E +I +L+ +  D    C  +   L  +KI+D+R G   V ++K    S  +  +S   +
Sbjct: 60  EQDITALK-LTADGRYLCFASQAQL--LKIFDLREG-KIVRSMKISSPSYVVDSDSTSTL 115

Query: 115 LVCGTELTGVDAEMFIYDVR--YFSKPVRAFVDSHHDDITDIKFHPSDKN---ILLSGST 169
           L  G    G D  + + DV   Y +  ++     H   I+ +KF+        +L SG T
Sbjct: 116 LAIG----GTDGSITVVDVENGYVTHSLKG----HGGTISSVKFYGEQNGEVWLLASGDT 167

Query: 170 DGYTNIYDLAQ 180
           +G   I+DL +
Sbjct: 168 NGMVKIWDLVK 178

>TDEL0A04820 Chr1 (848835..849815) [981 bp, 326 aa] {ON} Anc_5.615
           YOR026W
          Length = 326

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 76/175 (43%), Gaps = 29/175 (16%)

Query: 28  LLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYDV 87
           L+C S +G++ ++D  +  ++    + E   + L+VI+ D +N  +  ATS   V+++++
Sbjct: 117 LICGSWDGTLQVVDCETNCVV----LQERLSDGLKVISMDVDNERMVIATSRNKVRLFEL 172

Query: 88  R-----NGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRA 142
                  G    + +K     V   L  + D  VC + L G  A      V Y     R 
Sbjct: 173 PLRPKDKGTEVESGLKYQARKV--KLTPQGDGYVCSS-LDGRVA------VEYLEDESRK 223

Query: 143 FV-DSHHDDITD---------IKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEAL 187
           F    H  ++ D         + F P + N+L +G +DG  + ++L    + E L
Sbjct: 224 FAFRCHRLNLVDTSMVFPVNALSFRP-NSNVLYTGGSDGSVSCWNLTSRKKVEQL 277

>YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splicing
           factor, component of the U4/U6-U5 snRNP complex
          Length = 465

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 60/124 (48%), Gaps = 8/124 (6%)

Query: 73  IFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYD 132
           I +A+   + +++D       +    +DK    LS +    ++  G    G+D+   ++D
Sbjct: 280 IGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSG----GMDSLSMLWD 335

Query: 133 VRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQVIN 192
           +R  SK +   +  H   I  + + P+   +  +G  DG  N++D+ + DE + L+Q++ 
Sbjct: 336 IRSGSKVMT--LAGHSKPIYTVAWSPNGYQVA-TGGGDGIINVWDIRKRDEGQ-LNQILA 391

Query: 193 YASI 196
           + +I
Sbjct: 392 HRNI 395

>SAKL0D09262g Chr4 complement(766195..769881) [3687 bp, 1228 aa] {ON}
            conserved hypothetical protein
          Length = 1228

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 7/91 (7%)

Query: 27   GLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYD 86
            G+L  +      LID  + + IKKF++G+    +LRV  +D    C F  +  ASV  + 
Sbjct: 945  GMLLKTKGNEAELIDVQTGTFIKKFQLGDFKPGTLRVF-HDQPTHCRFCGS--ASVASFS 1001

Query: 87   VRNGDSPVATIKNDKNSVFLSLESRHDMLVC 117
            +   D   +T+          LESR    +C
Sbjct: 1002 IAYTDQNTSTLVMHT----FQLESRTKSSIC 1028

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 71/162 (43%), Gaps = 12/162 (7%)

Query: 28  LLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFE-NGCIFAATSL-ASVKIY 85
           +      GSV L  + S ++    E+   N +  RV ++ F  +G   A+ S   + +++
Sbjct: 238 ITAGGEEGSVKLFGYKSNTLE---EMATLNGHENRVTDSKFHPSGRFIASASFDMTWRLW 294

Query: 86  DVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVD 145
           DV   +  +    + K    L  +    ++  G    G+D +  ++D+R   + +   + 
Sbjct: 295 DVETQEELLLQEGHGKELYSLGFQCDGSLVCSG----GIDCKGLVWDIRSGKRAMS--LS 348

Query: 146 SHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEAL 187
            H   I  + + P+   +  +GS DG   I+DL + +E + +
Sbjct: 349 GHTKPIYSLDWSPNGYQVA-TGSGDGTIRIWDLRKPEEYQTI 389

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 7/88 (7%)

Query: 113 DMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGY 172
           D++  G E   V  ++F Y      +   A ++ H + +TD KFHPS +  + S S D  
Sbjct: 236 DLITAGGEEGSV--KLFGYKSNTLEE--MATLNGHENRVTDSKFHPSGR-FIASASFDMT 290

Query: 173 TNIYDLAQEDEDEALHQVINYASIHSCG 200
             ++D+  E ++E L Q  +   ++S G
Sbjct: 291 WRLWDV--ETQEELLLQEGHGKELYSLG 316

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 3/107 (2%)

Query: 73  IFAATSLA-SVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIY 131
           +F   SLA S  IY+        A +   +N++     S  D  V  T ++  + ++ I 
Sbjct: 351 VFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESN-KILIL 409

Query: 132 DVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           D+R    PV   ++ H   I  IK+HP+ + ILLS S D     +DL
Sbjct: 410 DMRNSESPVLV-LEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDL 455

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 101 KNSVFLSLE-SRHDMLVCGTELTGVDA-EMFIYDVRYFSKPVRAFVDSHHDDITDIKFHP 158
           K++  L LE S  D  V  T   G D+  + I D+R    PV   +D H   I  IK+HP
Sbjct: 364 KSNALLRLEPSPTDPNVIAT--FGADSNSVLILDMRNPGTPVLT-LDGHSAPINQIKWHP 420

Query: 159 SDKNILLSGSTD 170
           + KN +LS S D
Sbjct: 421 TKKNTILSSSDD 432

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 9/113 (7%)

Query: 73  IFAATSLA-SVKIYDVRNGDSP-----VATIKNDKNSVFLSLE-SRHDMLVCGTELTGVD 125
           +F   SLA S  IY+     +P       T  +  +   L LE S +D  V  T      
Sbjct: 314 VFDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLAT-FAAES 372

Query: 126 AEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
            ++ I D+R    P+   ++ H   + +IK+HP+ +N+LLS   D     +DL
Sbjct: 373 NKIIILDMRNPESPILN-LEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDL 424

>CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112w MDV1
          Length = 711

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 85/207 (41%), Gaps = 37/207 (17%)

Query: 19  ELKPLYSRG--LLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAA 76
           E+  LY  G  L+ +S + ++   D  S   I+ F+V   N  SL    + F        
Sbjct: 501 EVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFDV---NFPSLSAYKSSFMKS----- 552

Query: 77  TSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYF 136
                       N DS +  +K     +  S++S    L  GT+    D  + ++D+R  
Sbjct: 553 ------------NEDSMI--LKTVNTPIIGSIQSFDAALATGTK----DGLIRLWDMR-- 592

Query: 137 SKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQVINYASI 196
           +  V   ++ H D IT +KF   D   ++SGS DG   ++DL   +    L  +I+Y   
Sbjct: 593 TGEVVRVLEGHMDAITSLKF---DATTIISGSLDGTIRLWDLRSNN----LTDIISYEKP 645

Query: 197 HSCGWLSPKRIYTLSHMETFAIHELND 223
            S      K I   S+     I++ ND
Sbjct: 646 ISSLDFDAKHIVVASNEHNTHIYDRND 672

>NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 50/107 (46%), Gaps = 7/107 (6%)

Query: 74  FAATSLASVKIYDVRNGDSPVATIKNDKNSVF-LSLESRHDMLVCGTELTGVDAEMFIYD 132
           FA TS   V+I+  R     + T    K+ V+  S  S   +LV G + TG+ +    Y+
Sbjct: 55  FAVTSSTRVQIFSSRTRQV-IKTFSRFKDVVYSASFRSDGKLLVAG-DATGLVSVYDSYN 112

Query: 133 VRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
            R     + A   +H   +T  KFHP D   L++ S D    ++D++
Sbjct: 113 PRTILLSINA--STHPTHVT--KFHPQDNKTLITASDDRVIRLWDIS 155

>TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1340

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 81  SVKIYDVRNGDSPVATIKNDKNSVFLSLE-SRHDMLVCGTELTGVDAEMFIYDVRYFSKP 139
           ++K++ + +  S +  +  D +S F  L  S  + ++ G    G   ++F  D +   + 
Sbjct: 47  TLKLWSLISSKSDIPVLSIDVDSTFNDLSWSIDNEMIAGAMQNGT-IQLFKTDKKESLEK 105

Query: 140 VRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYD 177
           + +F D   D IT IKF+    N+LLSGS+ G   ++D
Sbjct: 106 IGSFEDEAQD-ITIIKFNNKQNNVLLSGSSTGKILVWD 142

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 74/158 (46%), Gaps = 15/158 (9%)

Query: 23  LYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFE-NGCIFAATSLAS 81
           ++  G L +S++  +  I W+   + +K E+     +S  V    F+ +G + A+  L +
Sbjct: 264 VHPSGRLAASASFDLTWILWD---LERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDA 320

Query: 82  V-KIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT--GVDAEMFIYDVRYFSK 138
           V  I+D+R+G+ P+  ++    ++     S  D    G +L   G D  + ++D+R    
Sbjct: 321 VCAIWDLRSGE-PIMKLEGHAGAI-----SGVDWSPNGYQLATAGADGTVRVWDIRNVG- 373

Query: 139 PVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIY 176
              + + +H     D+KF  ++   L+S   D   NI+
Sbjct: 374 -TESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIF 410

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 22/45 (48%)

Query: 134 RYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           R  SK V   +  H   ITDI FHP    IL + S D Y   +D+
Sbjct: 100 RSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYALAWDM 144

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 54/113 (47%), Gaps = 6/113 (5%)

Query: 73  IFAATSLASVKI-YDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIY 131
           I A +S+ +  + +D+R+   P     N ++       +  +  V  T  + +   ++++
Sbjct: 129 ILATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVKWNHKNSNVLATSHSNI---VYVW 185

Query: 132 DVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ-EDE 183
           DVR  + P+ + ++ H   +  I F+P ++  ++S   DG    +D  + EDE
Sbjct: 186 DVRKGTSPL-SVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

>Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {ON}
           YMR093W (UTP15) - Protein required for cell viability
           [contig 55] FULL
          Length = 507

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 74  FAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDV 133
           FA TS   V+++  R     + T    K+ V+ +   +   L+   + TG  +    Y+ 
Sbjct: 55  FAITSSTRVQLFSSRTRQV-IKTFSRFKDVVYSASFRQDGKLLAMGDATGRVSVYDSYNP 113

Query: 134 RYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDE 185
           R  ++ V     SH   +   KFHP+D   L++ S D    ++D+ Q  E +
Sbjct: 114 R--AQLVSIAASSHPTHVA--KFHPADSRTLVTASDDRVVRVWDITQAQEPQ 161

>TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}
           Anc_1.534 YKL213C
          Length = 705

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 35/68 (51%), Gaps = 16/68 (23%)

Query: 261 SAENAGELKICGFE-NEIMNTENHIIIPNAHGDEVIRDVFIPPGNLNNHSDIIYSCGEDG 319
           S+ N G +KIC FE N I + E H             + F+    L+ + DI+ SCGED 
Sbjct: 198 SSSNDGTIKICDFEGNVIKSLEGH-------------ESFVYSCKLSPNGDIV-SCGEDR 243

Query: 320 NVNIWHAP 327
           +V +W AP
Sbjct: 244 SVRVW-AP 250

>Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124C
           (DSE1) - Daughter Specific Expression 1 [contig 210]
           FULL
          Length = 553

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 47/101 (46%), Gaps = 13/101 (12%)

Query: 124 VDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDE 183
           +D ++ ++D+R  S   +  V+ H   I  +K+H +D   L S   +GYT  +DL   D 
Sbjct: 316 IDNQVKVWDIR--STGAKCTVNGHKGSIKGLKYH-NDTRRLYSSDDEGYTIAWDLQGIDN 372

Query: 184 DEALHQVINYAS--------IHSCG--WLSPKRIYTLSHME 214
               H    + S        I  CG   ++PK + T+S ++
Sbjct: 373 VSECHLATGFLSITEEKISEIKQCGNVVVAPKNLRTVSSIK 413

>TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 74  FAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDV 133
           FA TS   V+++   +    + T    K+ V+ +       L+C  + TG+ +    Y+ 
Sbjct: 55  FAVTSSTRVQLFS-SSTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNP 113

Query: 134 RYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDE 185
           R     + A   SH   +T  KFH  D   L++ S D  T ++D++   E +
Sbjct: 114 RTLLLSINA--SSHPTHVT--KFHTQDSKTLVTASDDRITRVWDISHAYEPQ 161

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 12/135 (8%)

Query: 68  FENGCIFAATSLASVKIYDVRNGD-----SPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           F++  I   +   +V +YD    D        A  K +   +  S+ S  +++ C     
Sbjct: 124 FDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSD--- 180

Query: 123 GVDAEMFIYDVRYFSKPVRAFVDSHHDDIT-DIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
             D  + I+D++   K V   V+S H DI  + K+H SD NI  S S D +  I+D   E
Sbjct: 181 --DGSIAIWDIKS-GKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSE 237

Query: 182 DEDEALHQVINYASI 196
              + L Q   + +I
Sbjct: 238 KPLQKLLQKEPFNTI 252

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%)

Query: 134 RYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           R  S  +   +  H   ITDI FHP+   IL + S D Y + +D+
Sbjct: 100 RNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDM 144

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 28/139 (20%), Positives = 68/139 (48%), Gaps = 12/139 (8%)

Query: 71  GCIFAATSLASVKIYDVRN-------GDSPVATIKNDKNSVF-LSLESRHDMLVCGTELT 122
           G + +  S   ++++D++         D+P+  +  D   V  ++    HD ++  +  +
Sbjct: 206 GLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNVDFDALGVNDVNWHPSHDSILAASGES 265

Query: 123 GVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQED 182
            +   + ++D R  ++ +R+    H+  I   KF+    ++L+SG ++G  N++DL + D
Sbjct: 266 NI---IGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDSLLISGDSEGRINLWDLRKLD 322

Query: 183 EDEALHQVINYASIHSCGW 201
             E +  + + +SI +  W
Sbjct: 323 -GEPIKTLHHGSSISTLEW 340

>TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.469
           YMR093W
          Length = 511

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 31/147 (21%), Positives = 64/147 (43%), Gaps = 8/147 (5%)

Query: 32  SSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYDVRNGD 91
           +S+  V +    +  ++K F   +  + S    N   +   + A  +   V +YD  N  
Sbjct: 58  TSSTRVQIFSSRTRQVVKTFSRFKDVVYSASFRN---DGKLLVAGDATGLVSVYDSYNPR 114

Query: 92  SPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMF-IYDVRYFSKPVRAFVDSHHDD 150
           + + +I    +   ++    HD     T LT  D  +  ++D+ +  +P+  F  +  D 
Sbjct: 115 TLLLSINASSHPTHVTKFHAHD---TTTLLTSSDDRVTRLWDISHAYEPISEFTGAS-DY 170

Query: 151 ITDIKFHPSDKNILLSGSTDGYTNIYD 177
           +    F PS   ++++GS DG+  +YD
Sbjct: 171 VRTACFIPSAPQLVVTGSYDGFIRLYD 197

>Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]
           {ON} (90229..90465,90467..91492) [1263 nt, 421 aa]
          Length = 420

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 126 AEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
            ++FIY+ R+  +  R   D H  DIT  KF PS + +LLSGS+D    I+ +
Sbjct: 127 GDIFIYNNRF--ELERELKDVHKGDITFSKFFPSGE-VLLSGSSDMQLKIWSV 176

>TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {ON}
           Anc_8.631 YOR212W
          Length = 431

 Score = 33.5 bits (75), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 123 GVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           G D+ + I+D R  S   + ++   + D+  +KF+ +D N ++SGS DG   +YDL
Sbjct: 254 GSDSYVHIWDTRAPSSVQKFYI--SNSDVNTVKFY-NDGNAIVSGSDDGIIRLYDL 306

>KNAG0J02490 Chr10 (467902..470064) [2163 bp, 720 aa] {ON} Anc_3.335
           YBR094W
          Length = 720

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 58/135 (42%), Gaps = 6/135 (4%)

Query: 22  PLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFE---NGCIFAATS 78
           P+    L C  +N  +   D  S S+++   + +    + R + N      +    AAT+
Sbjct: 573 PIDLNTLQCHLTNTCLQKDDSKSLSVVEFDNLEDIAQENKRKVKNQIHAIAHDVFLAATT 632

Query: 79  LASVKIYDVRNGDSPVAT---IKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRY 135
           ++S+    +RN          + ++ N   L + +  D    G EL G+  E+F   V++
Sbjct: 633 VSSLNFQPLRNAFETYGVDFLVDSEYNVKLLEINAYPDFKQTGDELKGLIDELFQLSVKH 692

Query: 136 FSKPVRAFVDSHHDD 150
             +P+   VDS  DD
Sbjct: 693 CIRPLLDGVDSDEDD 707

>KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 507

 Score = 33.5 bits (75), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 74  FAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDV 133
           FA TS   V+++  R     + T    K+ V+ +   +   L+   + TG  +    Y+ 
Sbjct: 55  FAITSSTRVQLFSSRTRQV-IKTFSRFKDVVYSASFRQDGKLLAMGDATGRVSIYDSYNP 113

Query: 134 RYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDE 185
           R  ++ V     SH   +   KFHP+D   L++ S D    ++D+ Q  E +
Sbjct: 114 R--TQLVSIAASSHPTHVA--KFHPADSRTLVTASDDRVVRVWDITQAQEPQ 161

>SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {ON}
           similar to uniprot|P18851 YOR212W Saccharomyces
           cerevisiae STE4 G protein beta subunit
          Length = 426

 Score = 33.5 bits (75), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 123 GVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQED 182
           G D  ++++D R  S     FV     DI+ ++F  SD N +++GS DG   ++DL  + 
Sbjct: 242 GSDGYVYLWDTRSPSSVQNFFVS--DSDISTVRFF-SDGNSIITGSDDGIARLFDLRSDC 298

Query: 183 E 183
           E
Sbjct: 299 E 299

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 33.5 bits (75), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 59/133 (44%), Gaps = 19/133 (14%)

Query: 55  ETNINSLRVINNDFENGCIFAATSLASV-KIYDVRNGDSPVATIKNDKNSVFLSLESRHD 113
           E  I +LR+      +G   A  S A + KI+ ++ G   V ++K    S  L  +    
Sbjct: 61  EQEITALRLT----PDGQYLAYVSQAQLLKIFQLKTG-RIVRSLKISSPSYILDTDPTST 115

Query: 114 MLVCGTELTGVDAEMFIYDVR--YFSKPVRAFVDSHHDDITDIKFHP---SDKNILLSGS 168
           +L  G    G D  + I D+   Y +  ++     H   I+ +KF+    S+  +L SG 
Sbjct: 116 LLAVG----GTDGSIVIVDIENGYITHSLKG----HGGTISSLKFYGQLDSETWLLASGD 167

Query: 169 TDGYTNIYDLAQE 181
           T+G   ++DL + 
Sbjct: 168 TNGMVKVWDLVKR 180

>TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657)
           [2646 bp, 881 aa] {ON} Anc_6.239 YGL137W
          Length = 881

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 13/78 (16%)

Query: 9   ITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNI------NSLR 62
           +T+G D        L+S  LL + S+G +   DW S +++++ +V   N+        + 
Sbjct: 432 LTYGVDK-------LFSGALLGAKSDGFIYFFDWESGNLVRRIDVNARNVVWSDNGELVM 484

Query: 63  VINNDFENGCIFAATSLA 80
           +IN + E G   +A SLA
Sbjct: 485 IINTEDERGDEASAYSLA 502

>NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {ON}
           Anc_3.95 YDR488C
          Length = 626

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 24/39 (61%)

Query: 144 VDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQED 182
           V+ H  D+T ++FHP + ++L SGS D   +++D    D
Sbjct: 487 VNFHSSDVTSLRFHPQNDDLLCSGSMDWNCHLWDTFNND 525

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 20/117 (17%)

Query: 80  ASVKIYDVRN----------------GDSPVATIKNDKNS-VFLSLE-SRHDMLVCGTEL 121
            SV+++D+R+                G +  AT  + K S   L LE S +D  V  T  
Sbjct: 310 GSVRVFDLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLAT-F 368

Query: 122 TGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
                ++ I D+R    P+   ++ H   + +IK+HP+ +N+LLS S D     +DL
Sbjct: 369 AADSNKIIILDMRNPESPILN-LEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDL 424

>Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 43/82 (52%), Gaps = 7/82 (8%)

Query: 115 LVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTN 174
           LVC     G+D+   I+D+R  +K +   +  H   +  + + P+   +  +G  DG  N
Sbjct: 321 LVCSG---GMDSLAMIWDIRSGNKVMS--LTGHSKPVYTVDWSPNGYQVA-TGGGDGLIN 374

Query: 175 IYDLAQEDEDEALHQVINYASI 196
           ++D+ Q D  + +HQ++ + +I
Sbjct: 375 VWDIRQRDGGQ-VHQILAHRNI 395

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 62/128 (48%), Gaps = 11/128 (8%)

Query: 69  ENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGV--DA 126
           E G I +A+    VK++D R+G+  +++I   K++V   L++R      G  L  +  D 
Sbjct: 232 EMGLIASASKDNLVKLWDPRSGNC-ISSILKFKHTV---LKTRFQP-TKGNLLMAISKDK 286

Query: 127 EMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEA 186
              ++D+RY  K +    D    D   +++HP ++++      DG    +DL Q+  +  
Sbjct: 287 SCRVFDIRYSMKELMCVRDE--TDYMTLEWHPINESMFTLACYDGSLKHFDLLQDLNEPI 344

Query: 187 LHQVINYA 194
           L   I YA
Sbjct: 345 L--TIPYA 350

>TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON}
           Anc_8.631 YOR212W
          Length = 433

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 123 GVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           G D  ++++DVR  S     FV     DI  ++F   D N L SGS DG   ++DL
Sbjct: 256 GSDGYIYLWDVRTGSVAQTFFV--SDSDINAVQFFK-DGNALASGSDDGIIRLFDL 308

>KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {ON} 
          Length = 446

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 86/190 (45%), Gaps = 38/190 (20%)

Query: 28  LLCSSSNGS-----VNLID--WNSPSIIKKFEV-GETNINSLRVINNDFENGCIFAATSL 79
           L+ S SNGS     + ++D       +++   V G T  +++R     F+N    + +  
Sbjct: 197 LVKSQSNGSEEDSILKIVDNAGKPGEVLRTMHVPGTTVTHTVRF----FDNYTFGSCSDD 252

Query: 80  ASVKIYDVRNGDSPVATI---KNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYF 136
            +++ +D+R  D P+ ++   KN K + F + +  +++ V GT  TGV     I  V + 
Sbjct: 253 NTIRFWDIRTADKPIFSLSEPKNGKLTAFDASQITNELFVTGTS-TGVIKLWDIRSVEFA 311

Query: 137 SK----------PVRA-FVDSHH---DDITDIKFHPSDKNILLSGSTDGYTNIYD----- 177
           +           P++   V+ +H   D + D++F P+  +     +  G  N+Y      
Sbjct: 312 TTDLTHRQNGHDPIQTELVNLYHSGGDSVADVQFSPTSSSEF--ATVGGSGNVYHWDMEF 369

Query: 178 -LAQEDEDEA 186
             +Q D+D+A
Sbjct: 370 FFSQNDDDDA 379

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 66/153 (43%), Gaps = 10/153 (6%)

Query: 37  VNLIDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVAT 96
           +NL D N    +     G  NIN+++   ND     + +A S  S+ +YD+R   +    
Sbjct: 198 INLWDINRSKPLSDLSWGADNINTVKFNQND--ANVLGSAGSDNSIVLYDLRTNSATQKI 255

Query: 97  IKNDK-NSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIK 155
           ++  + NS+  +     + +V        D   + YD+R  S+ +  F D H   + D+ 
Sbjct: 256 VQTMRVNSMCWNPMEAFNFVVASE-----DHNAYYYDMRNMSRALNVFKD-HVSAVMDVD 309

Query: 156 FHPSDKNILLSGSTDGYTNIYDLAQEDEDEALH 188
             P+ + + ++ S D    I+ + +    E  H
Sbjct: 310 ISPTGEEV-VTASYDKTIRIFPINKGHSREIYH 341

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 54/109 (49%), Gaps = 7/109 (6%)

Query: 69  ENGCIFAATSLASVK-IYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAE 127
           ++G +  +T L SV  ++D+R+G S +A   + K    L        +  G+     D  
Sbjct: 321 KDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGLDWSPNGYDIATGS----ADGT 376

Query: 128 MFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIY 176
           + ++DVR     +   + +H+  ++++KF  ++ + L+S S D   NIY
Sbjct: 377 IRLWDVRKVG--ILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIY 423

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 114 MLVCGTELTGVDAEMFIYDVR---YFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTD 170
           + +CGT  +     + IYD+        P+   +  H   I  + F+ +  ++L+SGS D
Sbjct: 181 IAICGTSTS-----VSIYDINKANTLEGPLTTILSKHTRSINSVDFNMAQSSLLISGSQD 235

Query: 171 GYTNIYDL 178
           G   ++DL
Sbjct: 236 GCIKVWDL 243

>SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|Q04305 Saccharomyces cerevisiae
           YMR093W UTP15 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 515

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 70/150 (46%), Gaps = 14/150 (9%)

Query: 32  SSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYDVRNGD 91
           +S+  V +    +  +IK F   +  + S     ND +  C   AT L SV  YD  N  
Sbjct: 58  TSSTRVQIFSSRTRQVIKTFSRFKDVVYSAS-FRNDGKLLCAGDATGLVSV--YDSYNPH 114

Query: 92  SPVATIKNDKN----SVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSH 147
           + + +IK   +    S F  +E++   L+  ++    D  + ++D+ +   PV     + 
Sbjct: 115 TLLLSIKASSHPTHVSKFHPMENK--TLISASD----DRTVRLWDISHAYDPVLELSGAS 168

Query: 148 HDDITDIKFHPSDKNILLSGSTDGYTNIYD 177
            D +  + F P+ ++++++GS DG   IYD
Sbjct: 169 -DYVRSVCFVPNAQHLVVTGSYDGNVRIYD 197

>KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.119
           YGL004C
          Length = 412

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 139 PVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           P+    ++H  DIT +KF PS K ++LS STD    I+ L
Sbjct: 131 PLYKIEEAHFGDITSVKFFPSGK-LILSASTDMRMKIWSL 169

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 51/121 (42%), Gaps = 11/121 (9%)

Query: 71  GCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESR--------HDMLVCGTELT 122
           G + A+ S   +K +D++   +   TI     S+ +             HD L+      
Sbjct: 211 GLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIMMDTNGANDVTWMPLHDSLLAAC--- 267

Query: 123 GVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQED 182
           G   ++ IYD+R   +        H D I   +F+ ++  I+ S  T G  +I+D+ + +
Sbjct: 268 GESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVASADTVGNVHIWDIRKSN 327

Query: 183 E 183
           E
Sbjct: 328 E 328

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 8/66 (12%)

Query: 116 VCGTELTGVDAEMFIYDVRYFSK---PVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGY 172
           +CGT  +     + +YD+   S    P+   +  H   I  + F+ S  N+L+SG  DG 
Sbjct: 199 ICGTSTS-----VSVYDINKTSTIDNPLVTTLSEHTRSINSVDFNMSQTNLLISGGQDGC 253

Query: 173 TNIYDL 178
             ++DL
Sbjct: 254 IKVWDL 259

>TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1124

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 5/96 (5%)

Query: 28  LLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYDV 87
           L   S +  V+  D  SPS  + F      I++   +  +F++  I A++   +V I+D+
Sbjct: 130 LATCSLDTYVHAWDLRSPS--RPFYTTSDWISAASQVKWNFKDSNILASSHGNNVCIWDL 187

Query: 88  RNGDSPVATIKNDK---NSVFLSLESRHDMLVCGTE 120
           RNG  P+ T+K      NSV  +   + +++ C  +
Sbjct: 188 RNGSVPLKTLKGHTGGVNSVDFNRNKKTELMTCSND 223

>ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39706 Saccharomyces cerevisiae
           YAR003W SWD1 Subunit of the COMPASS complex which
           methylates histone H3 on lysine 4 and is required in
           transcriptional silencing near telomeres
          Length = 432

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 61/141 (43%), Gaps = 15/141 (10%)

Query: 91  DSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAF---VDSH 147
           D    +++N  ++  +    R D L  G    GV     IYD+  F +P+      + +H
Sbjct: 18  DKLTHSLENPLHTECVRFSPRGDYLALGCSNGGV----IIYDMDTF-RPICVLGNKMGAH 72

Query: 148 HDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQVINYASIHSCGWLSPKR- 206
              +  I +  SD   LL+GS D    ++DLA     + L QV   + I +C W++  + 
Sbjct: 73  MRSVQSISW-SSDGKYLLTGSRDWSVKLWDLAS--AGQPLKQVRFDSPIWNCQWVNADQF 129

Query: 207 ---IYTLSHMETFAIHELNDK 224
              +  L     F I+  +D+
Sbjct: 130 TCVVTVLEESSAFLIYFAHDQ 150

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%), Gaps = 14/106 (13%)

Query: 89  NGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT---------GVDAEMFIYD--VRYFS 137
           NGD  V  +      V  SL+  HD  + G   +         G D  + I++   +  S
Sbjct: 203 NGD--VKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHS 260

Query: 138 KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDE 183
           +  R  +  H   ++ +KFHPSD+  + S S D    ++D+ +E E
Sbjct: 261 EASRVVLRGHEARVSKVKFHPSDR-FVASASFDMTWRLWDVERETE 305

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 61/128 (47%), Gaps = 11/128 (8%)

Query: 69  ENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGV--DA 126
           E G I +A+    VK++D R+G+  +++I   K++V   L++R      G  L  +  D 
Sbjct: 230 EMGLIASASKDNLVKLWDPRSGNC-ISSILKFKHTV---LKTRFQP-TKGNLLMAISKDK 284

Query: 127 EMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEA 186
              ++D+RY  K +    D    D   +++HP ++++      DG    +DL Q   +  
Sbjct: 285 SCRVFDIRYSMKELMCVRD--ETDYMTLEWHPINESMFTLACYDGSLKHFDLLQNLNEPI 342

Query: 187 LHQVINYA 194
           L   I YA
Sbjct: 343 L--TIPYA 348

>Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W
           (WTM2) - Transcriptional modulator [contig 67] FULL
          Length = 381

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 5/76 (6%)

Query: 125 DAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL-----A 179
           D ++  YD R   KP+    D H   +T     P+ + + ++GS  G   ++DL     A
Sbjct: 186 DNKIRFYDTRGDGKPLWEVCDPHDGRLTCFDVSPALETLFVTGSDTGVLKLWDLRSVIAA 245

Query: 180 QEDEDEALHQVINYAS 195
           Q ++ E +     Y S
Sbjct: 246 QLEQQEPMEIAKLYQS 261

>Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa]
           {ON} YBR175W (SWD3) - YBR175W [contig 22] FULL
          Length = 316

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 115 LVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTN 174
           L+C   +   D  + I+D+   S  +   + +H + +  I   P D +IL SGS DG   
Sbjct: 113 LLCSCSM---DESIKIWDI--LSGTLLRTLSAHSEPVVSIDLPPFDPSILSSGSYDGLIR 167

Query: 175 IYDLA 179
           I+D A
Sbjct: 168 IFDTA 172

>Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {ON}
           YGL004C - Hypothetical ORF [contig 207] FULL
          Length = 417

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 109 ESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGS 168
           ES  D L    +  G+   + IYD +     V   ++ H+ +ITD+KF PS + +LLSGS
Sbjct: 115 ESDGDYLYATGDQGGI---ISIYDSQ---AEVTRTLEGHYAEITDVKFFPSGE-VLLSGS 167

Query: 169 TD 170
            D
Sbjct: 168 AD 169

>Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {ON}
           complement(90370..91632) [1263 nt, 421 aa]
          Length = 420

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 122 TGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           +G D   +I+DVR  +     FV   + D+  +KF   D N +++GS DG   ++DL
Sbjct: 244 SGSDGYTYIWDVRSAASVQSFFV--SNSDVNTVKFFK-DGNSIVTGSDDGTLRMFDL 297

>Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212W
           (REAL)
          Length = 425

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 11/80 (13%)

Query: 33  SNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENG-CIFAATSLASVKIYDVRNGD 91
           S+G   + D  SPS ++ F V +++IN+LR     F++G  I   +    + +YD+R+ D
Sbjct: 250 SDGYTYIWDNRSPSAVQSFYVNDSDINALRF----FKDGMSIVTGSDSGVINMYDLRS-D 304

Query: 92  SPVATIKNDKNSVFLSLESR 111
             +AT      S+F   E R
Sbjct: 305 CSIATF-----SLFRGYEER 319

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%)

Query: 134 RYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           R  S  +   +  H   ITDI FHPS   +L + S D Y + +D+
Sbjct: 100 RTSSNAIEYELHGHFRAITDINFHPSHPELLATCSIDTYVHAWDM 144

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 78/170 (45%), Gaps = 22/170 (12%)

Query: 71  GCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSL--ESRHDMLVCGTELTGVDAEM 128
           G I +A+    +K++D R+G+  V+TI   K++V  +    ++ ++LV  ++    D   
Sbjct: 220 GLIASASKDNLIKLWDPRSGNC-VSTILKFKHTVLKTRFQPTKGNLLVAISK----DKSC 274

Query: 129 FIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALH 188
            ++D+R+  K +    D    D   + +HP ++++   G+ DG    +D+ Q+  +    
Sbjct: 275 RVFDIRHSMKELMVVRD--EVDYMTLLWHPINESVFTVGNYDGSLKHFDILQDLSNPT-- 330

Query: 189 QVINYASIHSCGWLSPKRIYTLSH--METFAIHELNDKSDEL-TEPRPLD 235
                   HS  +   K I ++S+  M T       D++    T  RP D
Sbjct: 331 --------HSIPFAHDKCITSMSYNAMGTVLASASKDRTVRFWTRARPFD 372

>KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {ON}
           Anc_8.631 YOR212W
          Length = 425

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 123 GVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           G D   +I+D+R        FV +   D+  ++F   D N + +GS DG  N+YDL
Sbjct: 247 GSDGYTYIWDIRTPGSVQNFFVSNR--DVNTLQFF-KDGNSIATGSDDGMVNLYDL 299

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 128 MFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           + I D+RY   P+   ++ H   +  +++HP+ +N+LL+   D     +D+
Sbjct: 305 VLILDMRYPGSPILT-LEGHSSAVNQMRWHPTQRNVLLTCGDDCQVLYWDI 354

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 50/123 (40%), Gaps = 25/123 (20%)

Query: 78  SLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVR--Y 135
           SL S+KI       SP   + +D  S  +++              G D  + + DV   Y
Sbjct: 88  SLDSMKITRSMKISSPSYVMDSDSTSTLIAI-------------GGTDGSISVVDVENGY 134

Query: 136 FSKPVRAFVDSHHDDITDIKFHP---SDKNILLSGSTDGYTNIYDLAQEDEDEALHQVIN 192
            +   +     H   I+ +KFH     DK +L SG T+G   ++DL +      LH +  
Sbjct: 135 ITHSFKG----HGGTISSLKFHGELNGDKWLLASGDTNGVAKVWDLVKR---RCLHTMQE 187

Query: 193 YAS 195
           + S
Sbjct: 188 HTS 190

>Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W
           (REAL)
          Length = 467

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 62/128 (48%), Gaps = 11/128 (8%)

Query: 69  ENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGV--DA 126
           E G I +A+    VK++D R+G+  +++I   K++V   L++R      G  L  +  D 
Sbjct: 230 EMGLIASASKDNLVKLWDPRSGNC-ISSILKFKHTV---LKTRFQP-TKGNLLMAISKDK 284

Query: 127 EMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEA 186
              ++D+RY  + +    D    D   +++HP ++++      DG    +DL Q+  +  
Sbjct: 285 SCRVFDIRYSMRELMCVRDE--TDYMTLEWHPINESMFTLACYDGSLKHFDLLQDLNEPI 342

Query: 187 LHQVINYA 194
           L   I YA
Sbjct: 343 L--TIPYA 348

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 54/119 (45%), Gaps = 17/119 (14%)

Query: 82  VKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVR--YFSKP 139
           +KI+ ++ G   V ++K    S  L  +S   +L  G    G D  + + D+   Y +  
Sbjct: 85  LKIFQLKTG-KVVRSMKISSPSYILDTDSTSTLLAVG----GTDGSIIVVDIENGYITHS 139

Query: 140 VRAFVDSHHDDITDIKFHP---SDKNILLSGSTDGYTNIYDLAQEDEDEALHQVINYAS 195
           ++     H   I+ +KF+    S   +L SG T+G   ++DL +    + LH +  + S
Sbjct: 140 LKG----HGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVKR---KCLHTLQEHTS 191

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 61/142 (42%), Gaps = 15/142 (10%)

Query: 52  EVGETNINSLRVINNDFENGCIFAATSLASVKIYDVRNG-------DSPVATIKNDKNSV 104
           E+ E    ++ +  N  + G + +      V+I+D++         D PV  I+ D   V
Sbjct: 187 ELHENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVLNIQFDALGV 246

Query: 105 F-LSLESRHDML--VCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDK 161
             +S    HD L   CG   T     + ++D R   +  R   + H+  +   KF+  + 
Sbjct: 247 NDVSWMPSHDSLFVACGESDT-----LALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNN 301

Query: 162 NILLSGSTDGYTNIYDLAQEDE 183
            +L S  ++G  N++D+   D+
Sbjct: 302 MLLASADSEGLVNMWDIRNLDQ 323

>Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212W
           (REAL)
          Length = 425

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 6/66 (9%)

Query: 33  SNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENG-CIFAATSLASVKIYDVRNGD 91
           S+G   + D  SPS ++ F V +++IN+LR     F++G  I   +    V +YD+R+ D
Sbjct: 250 SDGYTYIWDNRSPSAVQSFYVNDSDINALRF----FKDGMSIVTGSDSGVVNMYDLRS-D 304

Query: 92  SPVATI 97
             +AT 
Sbjct: 305 CSIATF 310

>NDAI0F00920 Chr6 complement(225382..226440) [1059 bp, 352 aa] {ON}
           Anc_5.615 YOR026W
          Length = 352

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 45/96 (46%), Gaps = 5/96 (5%)

Query: 276 EIMNTENHIIIPNAHGDEVIRDVFIPPGN---LNNHSDIIYSCGEDGNVNIWHAPRCSSI 332
           E  N E+       H   ++   F+ P N    + H++I+Y+ G DG V++W+      I
Sbjct: 240 EYFNDESKKFAFRCHRMNLVDMQFVFPVNTLSFDPHNNILYTGGSDGCVSVWNLDSQKKI 299

Query: 333 LNVSKDFWNATEQLDVLSDDYNMLVGRNNEQYGENS 368
               K  +N    + +++D+  + V  +++ +  N+
Sbjct: 300 KQFPK--FNENSVVKIVTDERMLCVATSDDSFKTNA 333

>Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W
           (REAL)
          Length = 322

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 45/87 (51%), Gaps = 5/87 (5%)

Query: 20  LKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSL 79
           L  L  R L+ ++++G++  I W++    +KF     N +S+  +   + +  I A+ S 
Sbjct: 235 LLELSDRFLVSAAADGTI--IGWDASDYSRKFSYKHANFSSITAL---YVSDIILASGSE 289

Query: 80  ASVKIYDVRNGDSPVATIKNDKNSVFL 106
           + + IY++R+G    + I  D + + L
Sbjct: 290 SQLNIYNLRSGQLVHSNILEDADQICL 316

>SAKL0D04532g Chr4 complement(362288..363961) [1674 bp, 557 aa] {ON}
           similar to uniprot|P38222 Saccharomyces cerevisiae
           YBR030W Hypothetical ORF
          Length = 557

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 59/141 (41%), Gaps = 26/141 (18%)

Query: 72  CIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAE--MF 129
           CI  A+ L  + ++ +++       ++  KN++F S  S    L+   E+ G+ A    F
Sbjct: 28  CIIKASPLGGLGVFAIQDIHKGRVLLRIPKNAIFSSSNSSVANLLLDEEVDGMLALNIAF 87

Query: 130 IYDVRYFS---------KPVRAFVDSHHDDITDIKFHPS-----DKNILLSGSTDGYTNI 175
           IY+   F          K +R      HD+  D+   PS     +KN L   + D    +
Sbjct: 88  IYETTVFKERSHWYPYLKSIRI-----HDETGDLYLPPSCWPAEEKNALKGTTID---TL 139

Query: 176 YD--LAQEDEDEALHQVINYA 194
           YD    QE+ +E     +N A
Sbjct: 140 YDALAPQEELEEGFEIAVNLA 160

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 60/153 (39%), Gaps = 19/153 (12%)

Query: 73  IFAATSLASVKIYD-VRNGDSPVATIKNDKNSVFL-----SLESRHDMLVCGTELTGVDA 126
           I  A+S  SV I+D  + G SP++ ++    +  L     S       L    ++ G+ A
Sbjct: 134 ISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVALDWNRQIEGILA 193

Query: 127 EMF------IYDVRYF-------SKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYT 173
             +      I+D++ F       S+P   F+D+      D+ + PS   +L     D   
Sbjct: 194 STYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLLSIAREDNIM 253

Query: 174 NIYDLAQEDEDEALHQVINYASIHSCGWLSPKR 206
            ++D              N+AS  +C   +P +
Sbjct: 254 TLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQ 286

>KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} similar
           to uniprot|P18851 YOR212W Saccharomyces cerevisiae STE4
           G protein beta subunit
          Length = 421

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 123 GVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           G D  ++I+D R  +     FV     D++ +KF  ++ N +L+G+ DG   ++DL
Sbjct: 239 GSDGYVYIWDTRMRTAGQSFFVS--ESDVSTLKFF-NNGNAILTGTDDGIARMFDL 291

>TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.450
           YMR102C
          Length = 945

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 138 KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
           K +R F  SH D +T +KFHP D    +SG  D    ++ +  E
Sbjct: 440 KSLRTF--SHPDFVTTVKFHPIDDRFFISGCIDQKCRLWSILDE 481

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 32.0 bits (71), Expect = 3.3,   Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 53/112 (47%), Gaps = 4/112 (3%)

Query: 77  TSLASVKIYDVRNGDS--PVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVR 134
           +S +S++++ +   DS  P+A+++ D  S F  L+  H+  +    L     E++  +  
Sbjct: 37  SSDSSLELWSLLASDSEKPIASLQVD--SKFNDLDWSHNNKIIAGALDNGSLELYSTNEV 94

Query: 135 YFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEA 186
             +    A   +H   +  +KF+    N+L SG  +G   I+D+ +  E  A
Sbjct: 95  NDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPA 146

>TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817
           YML102W
          Length = 560

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 127 EMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGY 172
           E+ IYD    SKP+    + H+  +TD+ +   D N+L+  STDG+
Sbjct: 369 EVLIYDTES-SKPIAVIGNLHYTPLTDLAWS-EDGNLLMVSSTDGF 412

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 127 EMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
            + I D+R    PV   ++ H   +  +++HPS +N+LLS + D     +DL
Sbjct: 378 RVLILDMRNPGSPV-LVLEGHSAAVNQMRWHPSKRNVLLSCADDCQVLYWDL 428

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 52/119 (43%), Gaps = 12/119 (10%)

Query: 69  ENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNS----VFLSLESRHDMLVCGTELTGV 124
           E  C  A +    + I++ +   +PV T +   +     +  S +SRH  LV G    G 
Sbjct: 192 EGTCTAAGSWAGDISIFNTKTL-APVITSRETHSGKISGIDWSSDSRH--LVSG----GE 244

Query: 125 DAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDE 183
           D  + +Y+    S  V      H   +T++KFHPS K I  S S D    ++D+    E
Sbjct: 245 DGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKYI-GSASFDTTWRLWDIVTNSE 302

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 53/111 (47%), Gaps = 7/111 (6%)

Query: 70  NGC-IFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEM 128
           NGC IF  +S  + +++D+  G+S    I +    + +++      L  G+E    D  +
Sbjct: 648 NGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSE----DGVI 703

Query: 129 FIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
            I+D+    K ++  +      +  + ++  + NIL+SG +D    I+DL 
Sbjct: 704 HIWDIGT-GKSLKKLIGHGKSAVNSLSYN-KESNILVSGGSDNSVRIWDLT 752

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1290

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 8/66 (12%)

Query: 116 VCGTELTGVDAEMFIYDVR---YFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGY 172
           +CGT  +     + IYD+        P    +  H   I  + F+ +  ++L+SGS DG 
Sbjct: 183 ICGTSTS-----VSIYDINRANLVDGPASMVLSKHTRSINSVDFNMAQTSLLISGSQDGC 237

Query: 173 TNIYDL 178
             ++DL
Sbjct: 238 IKVWDL 243

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 23/44 (52%)

Query: 135 YFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           +  K ++  +D H +  T + F P+  N+LLSG  D    ++D 
Sbjct: 142 FLPKKIKYAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDF 185

>CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa]
           {ON} similar to uniprot|P07834 Saccharomyces cerevisiae
           YFL009w CDC4 cell division control
          Length = 795

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 61/131 (46%), Gaps = 10/131 (7%)

Query: 20  LKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSL 79
           L  L  + L+ ++++GS  L  W+S    +KF       N+L  I   +    I  + S 
Sbjct: 629 LLKLSDKFLVSAAADGS--LRGWDSSDYSRKFAYHH---NNLSAITTFYMTDNILVSGSE 683

Query: 80  ASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKP 139
               IY++R G    + I ND + ++ S+  + ++LV   E    D + F+ ++  FSK 
Sbjct: 684 GQFNIYNLRTGKLIHSNILNDADQIW-SVNFKGNILVAAVE---KDGQSFV-EILDFSKK 738

Query: 140 VRAFVDSHHDD 150
              F  + H++
Sbjct: 739 QVTFSSALHNE 749

>TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {ON}
           Anc_8.631 YOR212W
          Length = 417

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 300 IPPGNLNNHSDIIYSCGEDGNVNIW 324
           +PP N  N S++  SCG DG   IW
Sbjct: 227 LPPHNTENSSNLFASCGSDGYAYIW 251

>TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {ON}
           Anc_8.717 YOR269W
          Length = 515

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 75  AATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVR 134
           + TSLAS    D    DSP  TI  D     + L     M+  GT+      +++ YD+ 
Sbjct: 131 SVTSLAS---RDWLPSDSPFGTIMLDSMVTAIKLHPYLSMVFIGTDY----GKLYAYDIF 183

Query: 135 YFSKPVRAFVDSHHDDITDI 154
               PV A + SH   IT I
Sbjct: 184 TMDLPV-AVIQSHTKSITSI 202

>NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534
          Length = 472

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 5/73 (6%)

Query: 106 LSLESRHDMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILL 165
           L   + +D++V G E    DA + ++  +       A +  H   + ++KFHPS+K  + 
Sbjct: 235 LDWNTSYDLIVSGAE----DALVKLHTYKEGRLETAAVLQGHEGRVVNVKFHPSNK-FIA 289

Query: 166 SGSTDGYTNIYDL 178
           S S D    ++D+
Sbjct: 290 SASFDQTWRLWDV 302

>TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7.405
           YER107C
          Length = 361

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 59/119 (49%), Gaps = 14/119 (11%)

Query: 69  ENGCIFAATSL-ASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT--GVD 125
           +N  +F+A+S    VKI+++ NG+ P A  +   ++  LS     D    GT++   G D
Sbjct: 44  QNEFVFSASSWDGKVKIWNINNGN-PQAVAQYSHSAPVLSTRWSGD----GTKVASGGCD 98

Query: 126 AEMFIYDVRYFSKPVRAFVDSHHDDITDIKF---HPSDKNILLSGSTDGYTNIYDLAQE 181
             + ++D+   +      V +H   I +++F    P++   L++GS D     +DL Q+
Sbjct: 99  NIVKLFDL---TTNQEQQVGTHDSAIKNLRFVNCGPTNSQCLVTGSWDKTIKYWDLRQQ 154

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 85/198 (42%), Gaps = 36/198 (18%)

Query: 18  LELKPLY--SRGLLCSSSNGSV---------NLIDWN--SPSIIKKFE-VGETNINSLRV 63
           + L P+Y  S  +   S NG++         N+ID    S +II +     E  I +L++
Sbjct: 10  VSLNPIYAGSSAVATVSENGTILATPMLDEINIIDLTPGSRNIIHRISNEDEQEITALKL 69

Query: 64  INNDFENGCIFAATSLASV-KIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
                 +G      S A + KI+ ++ G   V ++K    S  L  +S   +L  G    
Sbjct: 70  T----PDGQYLTYVSQAQLLKIFHLKTG-KVVRSMKISSPSYILDADSTSTLLAVG---- 120

Query: 123 GVDAEMFIYDVR--YFSKPVRAFVDSHHDDITDIKFHP---SDKNILLSGSTDGYTNIYD 177
           G D  + + D+   Y +   +     H   I+ +KF+    S   +L SG T+G   ++D
Sbjct: 121 GTDGSIIVVDIENGYITHSFKG----HGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWD 176

Query: 178 LAQEDEDEALHQVINYAS 195
           L +    + LH +  ++S
Sbjct: 177 LVKR---KCLHTLQEHSS 191

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 35/78 (44%), Gaps = 14/78 (17%)

Query: 289 AHGDEVIRDVFIPPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVS---KDFWNATEQ 345
           AH D +++  F+P       S   +SCG+DG V  W   +   I  ++   K+ W     
Sbjct: 607 AHSDSIMKVAFLP------ESHNFFSCGKDGLVKYWDGDKFECIQKLAAHQKEVWTI--- 657

Query: 346 LDVLSDDYNMLVGRNNEQ 363
              +S D   +V  +++Q
Sbjct: 658 --AISHDGTFVVSASHDQ 673

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1321

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 8/68 (11%)

Query: 114 MLVCGTELTGVDAEMFIYDVRYFSK---PVRAFVDSHHDDITDIKFHPSDKNILLSGSTD 170
           + +CGT  +     + IYD+   S    PV   +  H   I  + F+    ++L+SG  D
Sbjct: 193 VAICGTSTS-----VAIYDINKTSAIDNPVVTSLSEHTRSINSVDFNMVQTSLLISGGQD 247

Query: 171 GYTNIYDL 178
           G   I+DL
Sbjct: 248 GCIKIWDL 255

>KLTH0A07634g Chr1 complement(642477..643940) [1464 bp, 487 aa] {ON}
           similar to uniprot|P53741 YNR051C Saccharomyces
           cerevisiae BRE5 Ubiquitin protease cofactor
          Length = 487

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 24/65 (36%), Gaps = 8/65 (12%)

Query: 196 IHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIRGQWDCDYVVDLYPGY 255
           I   G+   K  Y   H + F +H L   + ELT         +  Q D DY  D  P  
Sbjct: 7   IQEVGYAFLKTYYQRMHQDPFKVHHLYSTTAELTH--------VNYQMDFDYTADTLPTT 58

Query: 256 VAMGK 260
              GK
Sbjct: 59  KLTGK 63

>Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W
           (REAL)
          Length = 391

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 6/104 (5%)

Query: 20  LKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSL 79
           L  L  + L+ ++++G VN+ D NS  +   F+    N NS  +   +  +  I  + S 
Sbjct: 282 LLRLSDKFLVSAAADGVVNVWDANSYLLKHSFD----NTNSCSITALEITD-VILLSGSQ 336

Query: 80  ASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTG 123
           + +K+YD+R+G    +   ND N ++ S++ +   LV   E  G
Sbjct: 337 SLLKMYDLRSGLCFYSDTLNDANQIW-SVKLKGQTLVAAVERDG 379

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 63/146 (43%), Gaps = 14/146 (9%)

Query: 66  NDFENGCIFAATSLASVKIYDVRNGD-------SPVATIKNDKNSVF-LSLESRHDMLVC 117
           N  + G +  + S     I+DV+           P  T+  D N    L     HD +  
Sbjct: 203 NKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVTFDSNGCNDLDWMPMHDSMFI 262

Query: 118 GTELTGVDAEMFIYDVRY-FSKPVRAFVDSHHDD-ITDIKFHPSDKNILLSGSTDGYTNI 175
                G   ++ ++D+R    K V +  +  H+D I   KF+P +  ++ S  T G  N+
Sbjct: 263 AC---GESNKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFNPGNSLLVASADTCGRINL 319

Query: 176 YDLAQEDEDEALHQVINYASIHSCGW 201
           +D+ + D+ E +  + + +SI +  W
Sbjct: 320 WDIRKLDQ-EPISTMQHGSSISTIEW 344

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 2/72 (2%)

Query: 123 GVDAE-MFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
           G+D + + I D+R    PV   +  H   +  IK+HPS   +LLS   D     +DL  E
Sbjct: 433 GLDKKAILILDMRNPGVPV-LVLSGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDLNSE 491

Query: 182 DEDEALHQVINY 193
              +  H   N+
Sbjct: 492 LNPKVTHLARNH 503

>AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL247C
          Length = 438

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 42/98 (42%), Gaps = 8/98 (8%)

Query: 128 MFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEAL 187
           + I D+RY   P+   ++ H   +  +K+HPS  N+L +   D     +DL      E L
Sbjct: 324 VIILDMRYPGSPM-LLLEGHAAPVNQLKWHPSKPNVLATCGDDCQILYWDLL-----ELL 377

Query: 188 HQVINYASIHSCGWLSPKRIYTLS--HMETFAIHELND 223
                +  +    W +   + TL    M   A +E+N+
Sbjct: 378 SASQVWTGLTQQRWSTTSTVRTLETPQMSYTAQYEVNN 415

>ACR194C Chr3 complement(690186..691727) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL156W
          Length = 513

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 120 ELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPS-DKNILLSGSTDGYTNIYDL 178
           E+  +  EM +     F     A V   H+ +T + FHPS +K +++ G T G   ++++
Sbjct: 160 EVQRLREEMRLQQYDVFDPKELAIV---HERVTALCFHPSQEKKLIVGGDTAGTVGLWNV 216

Query: 179 AQEDED 184
           A E+ D
Sbjct: 217 ADENPD 222

>TBLA0D02160 Chr4 complement(544468..546117) [1650 bp, 549 aa] {ON}
           Anc_8.150 YGL190C
          Length = 549

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 39/94 (41%), Gaps = 14/94 (14%)

Query: 17  CLELKPLYSRGLLCSSSNGSVNLIDWNS-------PSIIKKFEVGETNINSLRVINNDFE 69
           C +  P +    + SSS G++ L D  +       P I ++F +   N N    I +   
Sbjct: 256 CADFHPQFCNLFMYSSSKGTIRLCDMRTNALCDYKPKIFEEF-LDPNNHNFFTEITSSIS 314

Query: 70  ------NGCIFAATSLASVKIYDVRNGDSPVATI 97
                 NG   A+    +VKI+D+     P+ TI
Sbjct: 315 DVKFSPNGRYIASRDYLTVKIWDINMDSKPIKTI 348

>Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429W
           (REAL)
          Length = 645

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 138 KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           KPV+ F+  H   +  I +HP  KN+L S S D    ++D+
Sbjct: 131 KPVK-FLTGHARKVGHILYHPVAKNVLASSSGDNTVKLWDV 170

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1120

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 5/113 (4%)

Query: 73  IFAATSLAS-VKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIY 131
           I A  S+ + V  +D+R+   P  +  + K+S      +  D+ +  +   G D  +FI+
Sbjct: 129 ILATCSIDTYVHAWDMRSPQRPFYSTSSWKSSAAQVKWNHSDVNIMASS-HGDD--VFIW 185

Query: 132 DVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDED 184
           D+R  S P+   + SH   +  I F+      ++S S DG    +D ++  ED
Sbjct: 186 DLRNGSTPLFK-LSSHESSVNSIDFNRFRSTEIMSSSNDGTVKFWDYSRNVED 237

>KLLA0F27159g Chr6 (2508838..2510568) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q12308 Saccharomyces cerevisiae YPL007C TFC8
           One of six subunits of RNA polymerase III transcription
           initiation factor complex (TFIIIC) part of TFIIIC TauB
           domain that binds BoxB promoter sites of tRNA and other
           genes linker between TauB and TauA domains human homolog
           is TFIIIC-90
          Length = 576

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 12  GNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENG 71
             +NW   L+   +  L+CS+S   V LID  S +I K  E  + +I+ ++ + N     
Sbjct: 180 SENNWVTLLR-YQNEKLICSNSQNEVYLIDLASSTIKKISEATKFSISDIQFVGNR---- 234

Query: 72  CIFAATSLASVKIYDVRNGD 91
                TSL S+  YD+ N D
Sbjct: 235 --VLITSLGSIHCYDI-NAD 251

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 28/143 (19%), Positives = 65/143 (45%), Gaps = 14/143 (9%)

Query: 69  ENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLES--------RHDMLVCGTE 120
           +NG + ++ S  S+KI+D+        T++ ++ ++    E          HD +     
Sbjct: 200 KNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFDPEGCNEVTWMVNHDSIFAACS 259

Query: 121 LTGVDAEMFIYDVRYFSKPVRAF--VDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
            +    ++ ++DVR   + ++    + +H   I   KF+  +  +L S  + G  N++D+
Sbjct: 260 ESN---KLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDMLLASADSTGKINMWDI 316

Query: 179 AQEDEDEALHQVINYASIHSCGW 201
            + D+ E +    + +SI +  W
Sbjct: 317 RKLDK-EPIKSFNHNSSISTLEW 338

>Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AER255C
          Length = 471

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%)

Query: 135 YFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQE 181
           Y  K +    D H +  T +KF P   ++ LSG  D    I+DL  +
Sbjct: 165 YLPKKIINVYDGHENGTTALKFLPKSGHLFLSGGNDNKLKIWDLYHD 211

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 53/119 (44%), Gaps = 17/119 (14%)

Query: 82  VKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVR--YFSKP 139
           +KI+ ++ G   V ++K    S  L  +S   +L  G    G D  + + D+   Y +  
Sbjct: 85  LKIFHLKTG-KVVRSMKISSPSYILDADSTSTLLAVG----GTDGSIIVVDIENGYITHS 139

Query: 140 VRAFVDSHHDDITDIKFHP---SDKNILLSGSTDGYTNIYDLAQEDEDEALHQVINYAS 195
            +     H   I+ +KF+    S   +L SG T+G   ++DL +    + LH +  + S
Sbjct: 140 FKG----HGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKR---KCLHTLQEHTS 191

>KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa]
           {ON} similar to uniprot|P38123 Saccharomyces cerevisiae
           YBR175W SWD3 Subunit of the COMPASS complex which
           methylates histone H3 on lysine 4 and is required in
           transcriptional silencing near telomeres
          Length = 316

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 124 VDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           +D  + ++D+   +  +   + +H + +  I   P D +IL SGS DG   I+D A
Sbjct: 119 MDESIKVWDI--LTGTLLRTLSAHSEPVVSIDIPPFDPSILSSGSYDGLIRIFDTA 172

>TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.247
           YKR036C
          Length = 719

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 47/110 (42%), Gaps = 19/110 (17%)

Query: 15  NWCLELKPL------YSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDF 68
           N  L  KPL      +   L   + +G V L D  S   ++  E     + +L+     F
Sbjct: 555 NQLLGEKPLVGAIQCFDAALATGTKDGIVRLWDLRSGVPVRTLEGHTDAVTALK-----F 609

Query: 69  ENGCIFAATSLASVKIYDVRNG--------DSPVATIKNDKNSVFLSLES 110
           ++  I  A+S   V+I+D+R G        + P+ ++  D  S+  S ++
Sbjct: 610 DSSSIVTASSDKQVRIWDLRTGTLSNAFALEKPITSLDFDSTSIICSTKT 659

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 67/148 (45%), Gaps = 13/148 (8%)

Query: 37  VNLIDWNSPSIIKKFEVGETNINSLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVAT 96
           V+ I W  PS+ +  +   T+ +SLR+ + + E+  +    +L+  K  D  +  S   T
Sbjct: 156 VSNIQW-LPSVQQPRKFA-TSSDSLRIWSLNEEDSSLTEQVNLSLCKYNDQHHSLSKNTT 213

Query: 97  IKNDKNSVFLSLESRH------DMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDD 150
             +D    F  + S H      ++L+  +    +D    ++D++  S  VR  + +H  +
Sbjct: 214 SSSDILGQFPPVTSFHWNPIDTNLLISSS----IDTTCIVWDLQS-SNYVRTQLIAHDSE 268

Query: 151 ITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           + D+KF      +  S   DG   ++DL
Sbjct: 269 VFDVKFLAHSTQLFASCGGDGSVRVFDL 296

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 128 MFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           + I D+R    PV   ++ H   +  IK+HP   N+LLS   D     +DL
Sbjct: 351 ILILDMRNPGSPVLT-LEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDL 400

>KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 aa]
           {ON} similar to uniprot|P41811 Saccharomyces cerevisiae
           YGL137W SEC27 Involved in beta'-subunit of yeast
           coatomer
          Length = 875

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 10/66 (15%)

Query: 15  NWCLELK----PLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNI------NSLRVI 64
           +W + L+     LY+  LL   ++G V   DW+S S++++ +V   ++        L +I
Sbjct: 427 SWSIPLEFGVEKLYAGALLGVKADGFVYFFDWDSGSLVRRIDVDANDVVWSENGELLMII 486

Query: 65  NNDFEN 70
           NN  EN
Sbjct: 487 NNVDEN 492

>KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] {ON}
            some similarities with uniprot|P38873 Saccharomyces
            cerevisiae YHR186C KOG1 Subunit of TORC1 a rapamycin-
            sensitive complex involved in growth control that
            contains Tor1p or Tor2p Lst8p and Tco89p contains four
            HEAT repeats and seven WD-40 repeats may act as a
            scaffold protein to couple TOR and its effectors
          Length = 1506

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 151  ITDIKF-HPSDKNILLSGSTDGYTNIYDLAQEDED 184
            ITD+KF +  D  +LL+GS+DG  NIY    + ED
Sbjct: 1212 ITDMKFLNDDDTPLLLAGSSDGIVNIYKDFHDTED 1246

>CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} similar
           to uniprot|P38123 Saccharomyces cerevisiae YBR175w
          Length = 316

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 122 TGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           + +D  + ++DV   +  V   + +H + +  I    +D +IL SGS DG   I+D A
Sbjct: 114 SSMDESIKVWDV--LTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSHDGLIRIFDTA 169

>TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.67
           YFL009W
          Length = 732

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 75/167 (44%), Gaps = 21/167 (12%)

Query: 121 LTGVDAEMFIYDVRYFSKPVRAFVD---SHHDDITDIKFHPSDKNILLSGSTDGYTNIYD 177
           +TG D +M    +R +    + FV+    H+  +  +K+   +  IL+SGSTD    I+D
Sbjct: 347 ITGADDKM----IRIYDAVTKKFVNELRGHNGGVWALKY--DENGILVSGSTDRSVRIWD 400

Query: 178 LAQEDEDEALHQVINYAS----IHSCGWLSPKRIYTLSHMETFAIHELNDKSD-ELTEPR 232
           +   D     H    + S    +H   + + K + T S   T  + +L +K + E  +  
Sbjct: 401 I---DLGVCTHVFKGHTSTVRCLHIVKYKNIKYVVTGSRDNTLHVWKLPNKCNTEDKDKY 457

Query: 233 PLDFGDIRGQWDCDYVVDLYPGYVAMGKSAENAGELKICG-FENEIM 278
           P+ +       +  Y V +  G++A  ++    G + I G ++N +M
Sbjct: 458 PIVYDSTE---ENPYFVGILRGHLASVRTVSGYGNIIISGSYDNTLM 501

>TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.123
           YAR003W
          Length = 437

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 2/45 (4%)

Query: 157 HPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQ--VINYASIHSC 199
           HP   NIL++G++ G+ N Y LA  + +E +++  +I+   I +C
Sbjct: 176 HPKYDNILVTGTSKGWINFYLLADSNSNENVNETKLIHSVKIGNC 220

>SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1261

 Score = 30.8 bits (68), Expect = 8.3,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 58/128 (45%), Gaps = 21/128 (16%)

Query: 63  VINNDFENGCI--FAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120
           ++    +NG +  F+   L SV    +    +PV T+K           ++ D ++C  +
Sbjct: 76  ILAGALDNGIVEFFSPKELKSVA--KISKHTTPVNTLK---------FNAKQDNVLCSGD 124

Query: 121 LTGVDAEMFIYDVRYFSK----PVRAFVD-SHHDDITDIKFHPSDKNILLSGSTDGYTNI 175
             G   E+FI+D+   +     P    V  +  D++  + ++ S  ++  S  + GYT+I
Sbjct: 125 SRG---EIFIWDINKITSSGYVPFSPGVAMTPIDEVYSLAWNQSLAHVFASAGSSGYTSI 181

Query: 176 YDLAQEDE 183
           +DL  + E
Sbjct: 182 WDLKAKKE 189

>NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 75/174 (43%), Gaps = 32/174 (18%)

Query: 28  LLCSSSNGS-----VNLID-WNSPS-IIKKFEV-GETNINSLRVINNDFENGCIFAATSL 79
           ++ S SNGS     + +ID    PS I++   V G T  +S+R  +N      +FA+ S 
Sbjct: 179 VVKSQSNGSEEDSILKIIDNAGKPSEILRTIHVPGTTVTHSVRFFDNH-----MFASCSD 233

Query: 80  ASV-KIYDVRNGDSPVATIKNDKNSVFLSLES---RHDMLVCGT--------ELTGVDAE 127
            +V + +D R  D P+  + + +N    S ++     D+ V G         +   V+A 
Sbjct: 234 DNVLRFWDTRTNDKPLWVLADPQNGRLTSFDASSVSSDLFVTGFSTGLIKLWDARAVEAA 293

Query: 128 MFIYDVRY-----FSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIY 176
              +  R        K +  F  S  D + D++F P+    +L  +  G  N+Y
Sbjct: 294 TLDFTNRQNGEEPIQKEIANFYHSGGDSVVDVQFSPTSPTEVL--TVGGSGNVY 345

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 30.8 bits (68), Expect = 8.5,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 48/101 (47%), Gaps = 4/101 (3%)

Query: 80  ASVKIYDVRNGDS--PVATIKNDKNSVFLSLESRHDMLVCGTELTGVDAEMFIYDVRYFS 137
           +S++++ +   DS  P+A+++ D  S F  L+  H+  +    L     E++  +    +
Sbjct: 40  SSLELWSLLAADSEKPIASLQVD--SKFNDLDWSHNNKIIAGALDNGSLELYSTNEANNA 97

Query: 138 KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
               A   +H   +  +KF+    N+L SG  +G   I+D+
Sbjct: 98  INSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDM 138

>Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}
           similar to Ashbya gossypii AGL190W
          Length = 374

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 38/203 (18%), Positives = 74/203 (36%), Gaps = 34/203 (16%)

Query: 12  GNDNWCLELKPLYSRGLLCSSS-------NGSVNLIDWNSPSIIKKFEVGETNINSLRVI 64
           G   + ++  P +   L  ++        NG + ++D      I +     T      V 
Sbjct: 9   GYSGYAVQYSPFFDNKLAVATGSNFGLVGNGKLFILDITPQGKIVESNSFLTKDGLFDVA 68

Query: 65  NNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVF------------------- 105
            N+     + AA    S++++D+     PVA  +  +  VF                   
Sbjct: 69  WNELHENQVLAAQGDGSLRLFDINLQKYPVAIFQEHEREVFSCNWNLIDKQTFLSSSWDG 128

Query: 106 -------LSLESRHDMLVCGTELTG-VDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFH 157
                     +S   +L   T  T  VD+ +   DV   ++    +  ++ D I    + 
Sbjct: 129 TVKIWSPARKQSLRTLLPTPTNNTVLVDSTVLKQDVPVSNQAQHKYSSNNKDCIYQALYS 188

Query: 158 PSDKNILLSGSTDGYTNIYDLAQ 180
           P D N+++S S + Y +I+D+ Q
Sbjct: 189 PHDSNLVMSCSGNSYVSIFDIRQ 211

>KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, 697
           aa] {ON} similar to uniprot|Q06440 Saccharomyces
           cerevisiae YLR429W CRN1 Coronin cortical actin
           cytoskeletal component that associates with the
           Arp2p/Arp3p complex to regulate its activity
          Length = 697

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 5/63 (7%)

Query: 147 HHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQEDEDEALHQVINYASIHSCGWLSPKR 206
           H   + D  F P + NI+ SGS DG   I+++    ED + H   N  S      L PK+
Sbjct: 80  HTAHVLDTDFDPFNDNIIASGSDDGKIGIWEIP---EDYSFHHYTN--SEGEPKDLQPKK 134

Query: 207 IYT 209
             T
Sbjct: 135 FLT 137

>Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W
           (REAL)
          Length = 423

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 11/78 (14%)

Query: 33  SNGSVNLIDWNSPSIIKKFEVGETNINSLRVINNDFENG-CIFAATSLASVKIYDVRNGD 91
           S+G   + D  SPS ++ F V +++IN+LR     F++G  I   +    + +YD+R+ D
Sbjct: 250 SDGYTYIWDNRSPSAVQSFYVNDSDINALRF----FKDGMSIVTGSDNGVINMYDLRS-D 304

Query: 92  SPVATIKNDKNSVFLSLE 109
             +A+      S+F S E
Sbjct: 305 CSIASF-----SLFRSYE 317

>Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {ON}
           complement(76168..77499) [1332 nt, 444 aa]
          Length = 443

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 144 VDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           + +H   I+ +K H S K  L+SG  DG ++I+DL+
Sbjct: 240 IQAHRTSISCLKMHKSGK-FLISGGEDGISSIWDLS 274

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 53/122 (43%), Gaps = 5/122 (4%)

Query: 64  INNDFENGCIFAATSLAS-VKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTELT 122
           IN + EN  I A  S+ + V  +D+R+   P  +    ++S      +  D  +  +   
Sbjct: 119 INFNPENPDILATCSIDTYVHAWDMRSPHKPFYSTSAWRSSASQVKWNFKDSNILASSHG 178

Query: 123 GVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQED 182
               ++FI+D+R  S P+   V  H   +  I F       ++S S DG    +D +  +
Sbjct: 179 N---DVFIWDLRNGSTPLCQLV-GHESSVNSIDFSRFKSTEIMSSSNDGTVKFWDYSVNN 234

Query: 183 ED 184
           ED
Sbjct: 235 ED 236

>TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON}
           Anc_8.585 YBR175W
          Length = 319

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 122 TGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLA 179
           + +D  + I+DV   +  V   V +H + +  I     D  I+ SGS DG   ++D A
Sbjct: 116 SSMDESIKIWDV--LNGSVMRTVAAHSESVVSIDIPADDSTIVCSGSYDGLIRVFDTA 171

>NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa]
           {ON} Anc_3.259 YDR030C
          Length = 478

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 145 DSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180
           +SHH  IT +K++  D  +  +GS D    I+D  Q
Sbjct: 170 ESHHGGITTMKWYGEDNGMFFTGSNDKIIKIWDTNQ 205

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 9/113 (7%)

Query: 73  IFAATSLA-SVKIYD-----VRNGDSPVATIKNDKNSVFLSLE-SRHDMLVCGTELTGVD 125
           +F   SLA S  IY+     V    +   T  +  +   L LE S +D  V  T      
Sbjct: 314 VFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLAT-FAADS 372

Query: 126 AEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
            ++ I D+R    P+   +  H   +  IK+HP+ +N+LLS   D     +DL
Sbjct: 373 NKIIILDMRNPESPILN-LQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDL 424

>NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {ON}
           Anc_8.316 YDR142C
          Length = 375

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 149 DDITDIKFHPSDKNILLSGSTDGYTNIYDL 178
           D I   +F P D N+L+  S D YT I+DL
Sbjct: 185 DCIYQSQFSPHDPNLLICCSGDSYTTIFDL 214

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 8/68 (11%)

Query: 114 MLVCGTELTGVDAEMFIYDVRYFS---KPVRAFVDSHHDDITDIKFHPSDKNILLSGSTD 170
           + +CGT  +     + IYD+   S    P+   +  H   I  + F+    ++L+SG  D
Sbjct: 199 IAICGTSTS-----VSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQD 253

Query: 171 GYTNIYDL 178
           G   ++DL
Sbjct: 254 GCIKVWDL 261

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,107,834
Number of extensions: 2454400
Number of successful extensions: 9552
Number of sequences better than 10.0: 323
Number of HSP's gapped: 9653
Number of HSP's successfully gapped: 370
Length of query: 413
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 301
Effective length of database: 40,638,807
Effective search space: 12232280907
Effective search space used: 12232280907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)