Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C008308.321ON84284241260.0
ZYRO0F10340g8.321ON81882012381e-157
Smik_12.1908.321ON85084912031e-152
Suva_10.2208.321ON85485312021e-151
SAKL0H15598g8.321ON78780911761e-148
Skud_12.1968.321ON85485611711e-147
YLR127C (APC2)8.321ON85384611681e-146
TDEL0F044708.321ON80985411591e-145
Kwal_56.239098.321ON77681310331e-127
TBLA0A039208.321ON73270210201e-126
KLTH0G12342g8.321ON77481210221e-126
CAGL0M04235g8.321ON7838179271e-112
Kpol_YGOB_Anc_8.3218.321ON5115428011e-96
NCAS0C032808.321ON8118417689e-89
KNAG0G024308.321ON7976987442e-85
KAFR0H022808.321ON8177247303e-83
Ecym_42528.321ON6896966276e-70
AGL193W8.321ON7096796216e-69
NDAI0G026008.321ON9118775161e-53
KLLA0D16324g8.321ON6976604471e-45
TDEL0E046805.162ON994175810.64
Suva_16.2678.498ON40966761.8
TPHA0C016808.498ON41480716.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C00830
         (842 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.3...  1593   0.0  
ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {...   481   e-157
Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {...   468   e-152
Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {...   467   e-151
SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} simi...   457   e-148
Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {...   455   e-147
YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON} ...   454   e-146
TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {O...   451   e-145
Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {...   402   e-127
TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {O...   397   e-126
KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} simi...   398   e-126
CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa] ...   361   e-112
Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 5...   313   1e-96
NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.3...   300   9e-89
KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {O...   291   2e-85
KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.3...   285   3e-83
Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}...   246   6e-70
AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic ho...   243   6e-69
NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.3...   203   1e-53
KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]...   176   1e-45
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    36   0.64 
Suva_16.267 Chr16 (467433..468662) [1230 bp, 409 aa] {ON} YPL048...    34   1.8  
TPHA0C01680 Chr3 (388203..389447) [1245 bp, 414 aa] {ON} Anc_8.4...    32   6.2  

>TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.321
           YLR127C
          Length = 842

 Score = 1593 bits (4126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 806/842 (95%), Positives = 806/842 (95%)

Query: 1   MQYTEVDSIVGNIYELVDSKSCGXXXXXXXXXXXXNPNDPKSNHQLKPPTXXXXXXXXXX 60
           MQYTEVDSIVGNIYELVDSKSCG            NPNDPKSNHQLKPPT          
Sbjct: 1   MQYTEVDSIVGNIYELVDSKSCGSSDDIDSLLDWLNPNDPKSNHQLKPPTIRLKKVIKKI 60

Query: 61  XXDVNTLGDYDSIETLNSLLRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVP 120
             DVNTLGDYDSIETLNSLLRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVP
Sbjct: 61  LLDVNTLGDYDSIETLNSLLRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVP 120

Query: 121 IFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFS 180
           IFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFS
Sbjct: 121 IFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFS 180

Query: 181 LLSSKQIILNALLDKITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDH 240
           LLSSKQIILNALLDKITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDH
Sbjct: 181 LLSSKQIILNALLDKITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDH 240

Query: 241 EITKVLYKYFEKQFLRIRSEEIFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSE 300
           EITKVLYKYFEKQFLRIRSEEIFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSE
Sbjct: 241 EITKVLYKYFEKQFLRIRSEEIFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSE 300

Query: 301 FQLKVLNLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFA 360
           FQLKVLNLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFA
Sbjct: 301 FQLKVLNLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFA 360

Query: 361 ILDLRTDDIKTNPIVKVDQNXXXXXXXXXXXXHFGINLNFSDVDISDNLENGNNNKNISQ 420
           ILDLRTDDIKTNPIVKVDQN            HFGINLNFSDVDISDNLENGNNNKNISQ
Sbjct: 361 ILDLRTDDIKTNPIVKVDQNLLKLLSEELRESHFGINLNFSDVDISDNLENGNNNKNISQ 420

Query: 421 LDYAGQESSQLLYSQILNRALTWLPESKLVSPNKSIKMMRKKNLLDILFAIFDDHELFLK 480
           LDYAGQESSQLLYSQILNRALTWLPESKLVSPNKSIKMMRKKNLLDILFAIFDDHELFLK
Sbjct: 421 LDYAGQESSQLLYSQILNRALTWLPESKLVSPNKSIKMMRKKNLLDILFAIFDDHELFLK 480

Query: 481 RFVELLKQKLFVIKGYNLEESWVQCLRLFKTKFSPNSLDDAPTSTNLETLTGNNDSMYMT 540
           RFVELLKQKLFVIKGYNLEESWVQCLRLFKTKFSPNSLDDAPTSTNLETLTGNNDSMYMT
Sbjct: 481 RFVELLKQKLFVIKGYNLEESWVQCLRLFKTKFSPNSLDDAPTSTNLETLTGNNDSMYMT 540

Query: 541 NIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYWQYDMKNEKRKTYYGLLNKMDQ 600
           NIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYWQYDMKNEKRKTYYGLLNKMDQ
Sbjct: 541 NIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYWQYDMKNEKRKTYYGLLNKMDQ 600

Query: 601 TLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMSICPFLE 660
           TLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMSICPFLE
Sbjct: 601 TLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMSICPFLE 660

Query: 661 NEGTSSYTLEELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRPLEYLDRSEIIIESPE 720
           NEGTSSYTLEELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRPLEYLDRSEIIIESPE
Sbjct: 661 NEGTSSYTLEELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRPLEYLDRSEIIIESPE 720

Query: 721 SNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENITKCTPDHDKTFNATSQEVSKIKEY 780
           SNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENITKCTPDHDKTFNATSQEVSKIKEY
Sbjct: 721 SNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENITKCTPDHDKTFNATSQEVSKIKEY 780

Query: 781 VLSILTNLGEQNIEKLYNVLQTTSHDTAIKKVSSVTLENIVTELVENGQILCLPNGLYQL 840
           VLSILTNLGEQNIEKLYNVLQTTSHDTAIKKVSSVTLENIVTELVENGQILCLPNGLYQL
Sbjct: 781 VLSILTNLGEQNIEKLYNVLQTTSHDTAIKKVSSVTLENIVTELVENGQILCLPNGLYQL 840

Query: 841 PE 842
           PE
Sbjct: 841 PE 842

>ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {ON}
           similar to uniprot|Q7LGV7 Saccharomyces cerevisiae
           YLR127C
          Length = 818

 Score =  481 bits (1238), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 289/820 (35%), Positives = 444/820 (54%), Gaps = 55/820 (6%)

Query: 36  NPNDPKSNHQLKPPTXXXXXXXXXXXXDVNTL----GDYDSIETLNSLLRYYYIFQVRLN 91
           NPN+P+SNHQ KPPT                +     + D+      L+R +Y++QVRL+
Sbjct: 41  NPNEPQSNHQCKPPTLRLKNSIKMLVNQYYNMELREDERDTGYLFIQLVRQFYVYQVRLH 100

Query: 92  FFSNLQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNL 151
           FF++L ++  FKD+ +L KYYEFP+ +V IF N    W  E + + HYLL  +   R N+
Sbjct: 101 FFASLSNLHTFKDVQRLVKYYEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINV 160

Query: 152 INRLKKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKITMYADKQFTNAWSQR 211
           ++RLK LV EDDFDLA +++KW NE+N S +SS  ++L+ +++KI+ +   Q T  W+ R
Sbjct: 161 VSRLKDLVMEDDFDLAMDVVKWLNESN-SNVSSMDLMLDLIVEKISRFCQDQMTGTWNNR 219

Query: 212 FIIMETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLRIRSEEIFDICVISYP 271
           F+IMET+N+FI  YWS F +LL C ED+HE+T V+Y  FE+QF+++R++EIFDI V  YP
Sbjct: 220 FLIMETFNRFITSYWSQFCLLLACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYP 279

Query: 272 DSKPTIMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTILIAYIKTVKSLLILDP 331
           DSKPT++ELR +L +SK  T I++  LS F+ ++LN SI T   L+AY+KTVK+ L LDP
Sbjct: 280 DSKPTLLELRRVLVKSKDFTQIVVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDP 339

Query: 332 TSRYLQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPIVKVDQNXXXXXXXXXXX 391
           T R L S ++F  PY Q+++D++ +LL+AIL+L++++ +      +D N           
Sbjct: 340 TGRCLNSVSAFVKPYFQERNDLVTVLLYAILELQSEEFEGPARAYLDTNSLNQLSQELKD 399

Query: 392 XHFGINLNFSDVDISDNLENGNNNKNISQLDYAGQESSQLLYSQILNRALTWLPES-KLV 450
             FGI  +F  +  +D L     ++  S    A     +L Y  ++   L W PE    +
Sbjct: 400 PEFGIESSFETIPQADLL-----SRPASTATTAAMLDPRLPYKSVIKNFLQWTPEPMDTI 454

Query: 451 SPNKSIKMMRKKNLLDILFAIFDDHELFLKRFVELLKQKLFVIKGYNLEESWVQCLRLFK 510
           S N S  +   +NLLDIL  +F+  + F+  F+ LL +KL  +K Y L+  W  CLRL K
Sbjct: 455 SKNYSKSLSASRNLLDILMDMFESKDFFVSEFLSLLTRKLLTLKLYTLDRKWSHCLRLLK 514

Query: 511 TKFSPNSLDDAPTS------TNLETLTGNNDSMYMTNIDVMLWDMRGSKKLTEQMHLIDE 564
           TKF P        +                D   + NIDVML D+RGS +L ++MH +  
Sbjct: 515 TKFGPAGAAAVVATGIGGGDGGSIDGVRGGDPSNINNIDVMLRDVRGSSELCKRMHQVAG 574

Query: 565 LDNRINLKIISSLYWQYDMKNEKRKTYYGLLNKMDQTLFNQLDKYSKLYSRLKPGRVLNL 624
           LD RI  K IS LYW  D  +       G   ++D  +  +LDKY ++YS +KPGR L+L
Sbjct: 575 LDQRIYPKFISPLYWNRDNSSN------GWTFQLDPQMALELDKYCQVYSEIKPGRALHL 628

Query: 625 LTDQSTIEIDFNFEDNRTVTCECTFENYMSICPFLENEGTSSYTLEEL-SIITSFGLEDL 683
             DQ  + +  +F+D R   CE T E    I  F  +  T++   E++            
Sbjct: 629 YKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQQFDASTATTTGLTEQMIGARLQMDPARA 688

Query: 684 KISLKFWLDQKILYFDGKTYRPLEYLDRSEIIIESPESNNVNSVMSITNNPLNGFAILGK 743
           + +L+ W+ + +LY+DG  Y+  EYLD      + P  N   S                 
Sbjct: 689 RAALQHWVQEGVLYYDGNAYKTREYLD------DQPAENLPASK---------------- 726

Query: 744 GNDTIDRPSQENITKCTPDHDKTFNATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQ-T 802
                D  +       +PD D    +    + +   ++  +LTNLG   ++K+++ L+ T
Sbjct: 727 -----DSSASSQARTMSPDRDSRLTSI---LEQTWPFIQGMLTNLGALKVKKIHSFLKVT 778

Query: 803 TSHDTAIKKVSSVTLENIVTELVENGQILCLPNGLYQLPE 842
           T  +     V+   LE+ +  LVE  +++C  N  Y+LP+
Sbjct: 779 TPKELGFSMVTPSQLESYLHSLVEEERLICTTNDTYKLPK 818

>Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {ON}
           YLR127C (REAL)
          Length = 850

 Score =  468 bits (1203), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 295/849 (34%), Positives = 448/849 (52%), Gaps = 92/849 (10%)

Query: 36  NPNDPKSNHQLKPPTXXXXXXXXXXXXDVNTLGDYDSIET-------------------- 75
           +PNDPKSNHQL+PP+            +  +   Y  + T                    
Sbjct: 42  SPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQ 101

Query: 76  LNSLLRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNK 135
           L S L+ YYIFQVR +FFS+ ++I Y KDI + E YYEFP+ +VPIF  +   W  ELN 
Sbjct: 102 LLSTLKEYYIFQVRYHFFSHFENINYLKDIQRWENYYEFPLRYVPIFDLDINGWSLELNS 161

Query: 136 IRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDK 195
           +RHYLL  N+ F++NL  RL KL+ +DDFDLA  +I+W N A+ SL SS ++I+NAL +K
Sbjct: 162 LRHYLLNRNMKFKNNLRTRLDKLIMDDDFDLADNLIQWLNSADGSL-SSMELIVNALFNK 220

Query: 196 ITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFL 255
           I  + +   +  W++RF+IMET+NKFIN+YWS F+ L+ C EDDHE+T  ++  FE  FL
Sbjct: 221 INKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCFESNFL 280

Query: 256 RIRSEEIFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTI 315
           RIR++EIFDICV++YP+SK T++EL+ ++   K   NI+   LS+F+  +LN SI T   
Sbjct: 281 RIRTKEIFDICVLAYPNSKVTLLELKKIMKDFKDYANIVTTFLSDFKKYILNPSITTVDA 340

Query: 316 LIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPIV 375
           L+ Y+KT+K+ L+LDPT R L S T+F  PY Q++  ++ +LL+A+LDL  +++K     
Sbjct: 341 LLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVDLLLYAMLDLPEEELKEKITF 400

Query: 376 KVDQNXXXXXXXXXXXXHFGINLNFSDVDISDNLENGNNNKN---ISQLDYAGQE----- 427
           KVD                   L+ SD+    N+   N NK    +  L   G+      
Sbjct: 401 KVDIKALISLVD---------TLHDSDISQFTNVMKRNKNKKGPFLWNLKVKGKNGPSPT 451

Query: 428 SSQLLYSQILNRALTWLPESKLVSPNKSIKMMRKKNLLDILFAIFDDHELFLKRFVELLK 487
           S  ++Y  ILN  LTW+PE   + P        K NL ++L  +F+  E F+  F  LL 
Sbjct: 452 SQTMIYQHILNYYLTWVPEPNDMIPGSVKSSCIKTNLFEVLLDLFESREFFISEFRNLLT 511

Query: 488 QKLFVIKGYNLEESWVQCLRLFKTK-----------FSPNSLDDAPTSTNLETLTGNNDS 536
            +LF +K Y L++ W QCL+L + K           +  N +   P +T     + + D 
Sbjct: 512 DRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLPETT---APSADADQ 568

Query: 537 MYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYWQY--DMKNEKRKTYYGL 594
             + +IDVMLWD++ S++L  +MH +  LD  I  K IS LYW+Y  DM++    T++  
Sbjct: 569 SNLNSIDVMLWDIKCSEELCRKMHEVAGLDPAIFPKFISLLYWKYNCDMQSSNELTFHLP 628

Query: 595 LNKMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMS 654
           ++     L  +L KYS +YS+LKPGR L L  DQ  +EI+ NF+D R +  + + E    
Sbjct: 629 IH-----LKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKLVLDVSLEQCSV 683

Query: 655 ICPFLENEGTS-SYTLEELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRPLEYLDRSE 713
           I  F   +  S S TLE+LS   +     L   L FW+ + ++                 
Sbjct: 684 INQFDSTDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVI----------------- 726

Query: 714 IIIESPESNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQ-ENITKCTPDHDKTFNATSQ 772
                   +  N V S+  N    F  + K     D P + EN  +   +  +       
Sbjct: 727 --------SKENGVYSVIENCETDFDKVHK-----DIPMETENNNRGLRNESEAERKCEL 773

Query: 773 EVSKIKEYVLSILTNLGEQNIEKLYNVLQ-TTSHDTAIKKVSSVTLENIVTELVENGQIL 831
            + +   ++  +L NLG   + K+++ L+ T   D    +VS   LE  ++ L + G++ 
Sbjct: 774 TLQRSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRVSLQQLEQYLSALADEGRLK 833

Query: 832 CLPNGLYQL 840
            + NG Y++
Sbjct: 834 YIANGSYEI 842

>Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  467 bits (1202), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 298/853 (34%), Positives = 448/853 (52%), Gaps = 98/853 (11%)

Query: 37  PNDPKSNHQLKPPTXXXXXXXXXXXXDVNTLGDYDSIETLN------------------- 77
           P+DPKSNHQL+PP+            +      Y ++ T                     
Sbjct: 43  PDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQANNSIVNEGNTNKELQLQF 102

Query: 78  -SLLRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKI 136
            S  + YYIFQVR +FF +  SI Y KDI + E YYEFP+ +V IF  N   W  ELN +
Sbjct: 103 ISTFKEYYIFQVRYHFFLHFSSINYLKDIQRWENYYEFPLRYVSIFDLNVNGWTLELNSL 162

Query: 137 RHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKI 196
           RHYLL  N  F++NL  RL KL+ +DDFDLA  +I+W N AN SL SS  +I+NAL DKI
Sbjct: 163 RHYLLNRNTKFKNNLRTRLNKLIIDDDFDLASNLIRWLNSANGSL-SSMDLIVNALFDKI 221

Query: 197 TMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLR 256
           +M+ +   +  W++RF+IMET+NKFIN+YWS F+ L+ C EDDHE+T  ++  FE  FLR
Sbjct: 222 SMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELIGCPEDDHELTTTVFNCFESNFLR 281

Query: 257 IRSEEIFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTIL 316
           IR++EIFDICV++YP SK T++EL+ ++   K  TNI+   LS+F+  +LN SI T   L
Sbjct: 282 IRTKEIFDICVLAYPGSKITLLELKKIMKDFKDYTNIVTTFLSDFKKHILNPSITTVDAL 341

Query: 317 IAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPIVK 376
           ++Y+KT+K+ L+LDPT R L S T+F  PY Q++  ++ +LL+AILDL  +++K     K
Sbjct: 342 LSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAILDLPEEELKEKISFK 401

Query: 377 VDQNXXXXXXXXXXXXHFGINLNFSDVD-ISDNLENGNNNKNIS---QLDYAGQE----- 427
           VD                   L+ SD+D I++  ++ + NK  S    L   G++     
Sbjct: 402 VDMKALLLLVET---------LHDSDIDQITNTPKSKDKNKGGSFPWNLHVKGKKEKNGS 452

Query: 428 ---SSQLLYSQILNRALTWLPESKLVSPNKSIKMMRKKNLLDILFAIFDDHELFLKRFVE 484
              +  +LY  ILN  LTW+PE   + P        K NL ++L  +F+  E F+  F  
Sbjct: 453 SSITQSMLYEHILNYYLTWVPEPNDMIPGNIKSSSIKTNLFEVLLDLFESREFFISEFRN 512

Query: 485 LLKQKLFVIKGYNLEESWVQCLRLFK-----------TKFSPNSLDDAPTSTNLETLTGN 533
           LL  +LF +K Y L+  W +CL+L +           T +  N +   P +T       +
Sbjct: 513 LLTDRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTNYIANGIIGLPQTT---APAAD 569

Query: 534 NDSMYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYWQY--DMKNEKRKTY 591
            D   + +IDVMLWD++ S++L  +MH +  LD  I  K IS LYW++  D  N    T+
Sbjct: 570 ADLSNINSIDVMLWDIKCSEELCLKMHEVAGLDPAIYPKFISLLYWKHNGDTNNANELTF 629

Query: 592 YGLLNKMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFEN 651
           +     +   L N+L KYS +YS+LKPGR L L  DQ  IE++ +F D R +  + + E 
Sbjct: 630 H-----LPGNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGRKLVLDVSLEQ 684

Query: 652 YMSICPFLENEGTSSY-TLEELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRPLEY-- 708
              I  F   +G   Y +LE+LS   +     L   L FW+ + +L  +   Y  +EY  
Sbjct: 685 CSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVLSEENGVYSVIEYSR 744

Query: 709 LDRSEIIIESPESNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENITKCTPDHDKTFN 768
            D ++  IE P  N  N      NN L       +    ++R  +  + +  P       
Sbjct: 745 TDFNQTQIEFPMKNENN------NNEL-------RDETEVERKCELILERSLP------- 784

Query: 769 ATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQ-TTSHDTAIKKVSSVTLENIVTELVEN 827
                      ++  +L NLG   + K+++ L+ T   +    +++ + LE  +  L + 
Sbjct: 785 -----------FIEGMLANLGAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADE 833

Query: 828 GQILCLPNGLYQL 840
           G++  + NG Y+L
Sbjct: 834 GKLKYITNGSYEL 846

>SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 787

 Score =  457 bits (1176), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 277/809 (34%), Positives = 429/809 (53%), Gaps = 64/809 (7%)

Query: 36  NPNDPKSNHQLKPPTXXXXXXXXXXXXDVNTLGDYDSIETLNSLLRYYYIFQVRLNFFSN 95
           NPN+P SNHQL+PP+                + + D       LLR + + Q R++FFSN
Sbjct: 37  NPNEPNSNHQLRPPSLRLKNGIKL------VVNNEDVPPGFVHLLRQFVLLQTRIHFFSN 90

Query: 96  LQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRL 155
             SIT FKDI +LEKYYEFP+ ++ IF  +   W  E+N  RHYL+  N  F  N+ +R+
Sbjct: 91  FNSITSFKDIQRLEKYYEFPLKYINIFTPDE--WFIEMNGFRHYLMSKNRIFGDNIKHRV 148

Query: 156 KKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKITMYADKQFTNAWSQRFIIM 215
           ++L+ EDDFD+A +I  W  E     L S  ++L  L+DKI  ++ +     W+QRF++M
Sbjct: 149 RQLIMEDDFDMAWKIYTWLTETMGHQLVS--LLLEILMDKIADFSKQNMMGKWTQRFLVM 206

Query: 216 ETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLRIRSEEIFDICVISYPDSKP 275
           ET+N FI KYWS FA  L C EDDHEIT  ++  FEK+F++IR+ EI++ICV+ YP SKP
Sbjct: 207 ETFNTFITKYWSTFAQALRCPEDDHEITTEIFHCFEKEFVKIRTSEIYEICVLEYPHSKP 266

Query: 276 TIMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTILIAYIKTVKSLLILDPTSRY 335
            ++ELR ++  S   + ++I  LS+F+ K++N S+ T  IL++YI+T+KS L +DP  RY
Sbjct: 267 ALLELRNVMKTSADYSKLMIEFLSKFESKLMNPSVTTTEILLSYIRTIKSFLTVDPAGRY 326

Query: 336 LQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPIVKVDQNXXXXXXXXXXXXHFG 395
           LQS T++  PYL+++ D +  LL+A+L+L   +I        D N               
Sbjct: 327 LQSVTAYIKPYLRERRDTVVHLLYAMLELDESEID-------DAN---VSLNMPILTELS 376

Query: 396 INLNFSDVDISDNLENGNNNKNISQLDYAGQESSQLLYSQILNRALTWLPESKLVSPNKS 455
             L   D  I D       NK +        +  + L  Q+LN  L W PE   V+  K 
Sbjct: 377 KELKDPDFGIEDADSKSRKNKLMVTDSSPVFKVEKPLCEQVLNYFLQWTPEPSDVAHRKP 436

Query: 456 IKMMRKKNLLDILFAIFDDHELFLKRFVELLKQKLFVIKGYNLEESWVQCLRLFKTKFSP 515
                 K+LLDIL  IFD  ++F+  F+ L  +KL  +K Y LE  W++ LRL K KF  
Sbjct: 437 NNTFVNKSLLDILLDIFDSKDVFISEFLSLFTKKLLGLKYYKLETKWIKILRLLKKKFGH 496

Query: 516 NSLDDAPTSTNLETLTGNNDSMYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIIS 575
            S                 D+  + NID+ML D++ S +L  +MH +  LD+R+  K IS
Sbjct: 497 TSFPQHQF----------QDTSNINNIDIMLRDVKTSYELISKMHEVAGLDDRVFPKFIS 546

Query: 576 SLYWQYDMKNEKRKTYYGLLNKMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDF 635
            L+W   ++ E          ++   L  +++KYS++YS+LKPGR L+L  DQ T+E+D 
Sbjct: 547 YLFWNSALEAETSDF------QLPGWLETEIEKYSEVYSQLKPGRRLHLYKDQGTVELDL 600

Query: 636 NFEDNRTVTCECTFENYMSICPFLENEGTSSYTLEELSIITSFGLEDLKIS--LKFWLDQ 693
            F+D R ++CE        I  F ++       +E+  I+ +  +E   ++  L+FW  +
Sbjct: 601 EFKDGRKISCEVPLNKAAVISCFDQDTALKGLAVEQ--IVDNVKMEKALVTSILQFWCKK 658

Query: 694 KILYFDGK--TYRPLEYLDRSEIIIESPESNNVNSVMSITNNPLNGFAILGKGNDTIDRP 751
             +Y+D +  TYR LEY + +  +       + ++V+S   N   G   +   ++  D+ 
Sbjct: 659 NAIYYDDRYNTYRVLEYYEPNSAL-------SASTVISSKGNTNGGINPMDDQDNAGDKQ 711

Query: 752 SQENITKCTPDHDKTFNATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQTTSHDTAIKK 811
            QE I               Q +SKI  ++  +LTNLG    EK+++ L+          
Sbjct: 712 QQEFI---------------QSMSKIWPFIQGMLTNLGSMKPEKIHSFLKMAVPKDIGYT 756

Query: 812 VSSVTLENIVTELVENGQILCLPNGLYQL 840
            +   LE+ +  LV+  ++  +PNG Y+L
Sbjct: 757 ATVNQLESYLNVLVDEDKLAAVPNGSYKL 785

>Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  455 bits (1171), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 280/856 (32%), Positives = 451/856 (52%), Gaps = 98/856 (11%)

Query: 36  NPNDPKSNHQLKPPTXXXXXXXXXXXXD---VNTLGDYDSIETLNSL------------- 79
           +PNDPKSNHQL+PP+            +    ++ G  +S +T+N++             
Sbjct: 42  SPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQTINAVAGEGNTNKELQLQ 101

Query: 80  ----LRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNK 135
               L+ YY+FQVR +FF     I Y KDI + E YYEFP+ +VPIF  +   W  ELN 
Sbjct: 102 LLSTLKEYYVFQVRYHFFLRFNDIIYLKDIQRWENYYEFPLRYVPIFDLSVNDWSLELNS 161

Query: 136 IRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDK 195
           +RHY+L  N+ F++NL  RL KL+ +DDFDLA  +I+W N AN SL SS ++I+NAL +K
Sbjct: 162 LRHYMLNRNIKFKNNLRVRLNKLIMDDDFDLAGNLIRWLNFANGSL-SSMELIVNALFNK 220

Query: 196 ITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFL 255
           I  + +   +  W++RF+IMET+NKFIN+YWS F  L+ C EDDHE+T  ++  FE  FL
Sbjct: 221 IEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCPEDDHELTTTVFNCFESNFL 280

Query: 256 RIRSEEIFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTI 315
           RIR+ EIFDICV++YPDSK  ++EL+ ++   K  TNI+ + LS+F+  +LN SI T   
Sbjct: 281 RIRTREIFDICVLAYPDSKVALLELKKIMKDFKDYTNIVTKFLSDFKKYILNPSITTVDA 340

Query: 316 LIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPIV 375
           L+ Y+KT+K+ L+LDPT R L S  +F  PY Q++  ++ +LL+A+LDL  +++K     
Sbjct: 341 LLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLYAMLDLPEEELKEKITF 400

Query: 376 KVDQNXXXXXXXXXXXXHFGINLNFSDVDISDNLENGNNNKNISQLDYAGQESSQ----- 430
           KVD                G N      D   + +    +  +  L   G++ +      
Sbjct: 401 KVDMKALLSLVDILHDYDIGQN-----TDAHKSKDKNKRSPFLWNLKVKGKKETNEDPLA 455

Query: 431 ---LLYSQILNRALTWLPESKLVSPNKSIKMMRKKNLLDILFAIFDDHELFLKRFVELLK 487
              +LY  +LN  LTW+PE   + P        K NL +IL  +F+  E F+  F  LL 
Sbjct: 456 RQTMLYEHVLNHYLTWVPEPNDIIPGSVKSSYIKTNLFEILLDLFESREFFISEFRNLLT 515

Query: 488 QKLFVIKGYNLEESWVQCLRLFKTK-----------FSPNSLDDAPTSTNLETLTGNNDS 536
            +L  +K Y L++ W QCL+L + +           +  N +   P +T       + D 
Sbjct: 516 DRLSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITNGILGLPETT---APAADADQ 572

Query: 537 MYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYWQY--DMKNEKRKTYYGL 594
             + +IDVMLWD++ S++L  +MH +  LD  +  K IS LYW++  D +N K   +   
Sbjct: 573 SNLNSIDVMLWDIKCSEELCRKMHEVAGLDPTVFPKFISLLYWKHNGDTQNPKDSKF--- 629

Query: 595 LNKMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMS 654
             ++   L  +L KYS +YS++KPGR L L  DQ  +E++ +F D R +  + + E Y  
Sbjct: 630 --RIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFRDGRKLVLDVSLEQYSV 687

Query: 655 ICPF-LENEGTSSYTLEELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRPLEYLD--- 710
           +  F   N+   + +L++LS   +     L   L FW+ + +L  +G+ Y  +EY D   
Sbjct: 688 MNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEGEVYSVIEYSDTGF 747

Query: 711 ---RSEIIIESPESNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENITKCTPDHDKTF 767
              + +++++     NVN+     NN L       +    +++  +  + +  P      
Sbjct: 748 SQTQKDVLMK-----NVNN-----NNEL-------RDESEVEKKCELTLQRSLP------ 784

Query: 768 NATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQ-TTSHDTAIKKVSSVTLENIVTELVE 826
                       ++  +L NLG   + K+++ L+ T   D    +++ + LE  +  L +
Sbjct: 785 ------------FIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTD 832

Query: 827 NGQILCLPNGLYQLPE 842
            G++  + NG Y++ +
Sbjct: 833 EGKLKYIANGSYEIAK 848

>YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON}
           APC2Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; component of the catalytic core of the
           APC/C; has similarity to cullin Cdc53p
          Length = 853

 Score =  454 bits (1168), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 290/846 (34%), Positives = 441/846 (52%), Gaps = 83/846 (9%)

Query: 36  NPNDPKSNHQLKPPTXXXXXXXXXXXXDVNTLGDYDSIET-------------------- 75
           +PND KSNHQL+PP+            +  T   Y  I T                    
Sbjct: 42  SPNDAKSNHQLRPPSLRIKNIIKVLFPNNATTSPYSMINTSQANNSIVNEGNTNKELQLQ 101

Query: 76  LNSLLRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNK 135
           L S L+ +YIFQVR +FF +  +I Y KDI + E YYEFP+ +VPIF  N   W  ELN 
Sbjct: 102 LFSTLKEFYIFQVRYHFFLHFNNINYLKDIQRWENYYEFPLRYVPIFDVNVNDWALELNS 161

Query: 136 IRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDK 195
           +RHYLL  N+ F++NL  RL KL+ +DDFDLA  +I+W   AN SL SS ++I+NAL  K
Sbjct: 162 LRHYLLNRNIKFKNNLRTRLDKLIMDDDFDLADNLIQWLKSANGSL-SSTELIVNALYSK 220

Query: 196 ITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFL 255
           I  + +   +  W++RF+IMET+NKFIN+YWS F+ L+ C EDDHE+T  ++  FE  FL
Sbjct: 221 INKFCEDNMSRVWNKRFMIMETFNKFINQYWSQFSKLVGCPEDDHELTTTVFNCFESNFL 280

Query: 256 RIRSEEIFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTI 315
           RIR+ EIFDICV++YPDSK T++ELR ++   K  TNI+   LS+F+  +LN S+ T   
Sbjct: 281 RIRTNEIFDICVLAYPDSKVTLLELRKIMKDFKDYTNIVTTFLSDFKKYILNPSVTTVDA 340

Query: 316 LIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPIV 375
           L+ Y+KT+K+ L+LDPT R L S T+F  PY Q++  ++ +LL+A+LDL  +++K     
Sbjct: 341 LLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAMLDLPEEELKEKINF 400

Query: 376 KVDQNXXXXXXXXXXXXHFGINLNFSDVDISDNLENGNNNKN---ISQLDYAGQES---- 428
            VD                   L+ SD++   N+   + NK    +  L   G+      
Sbjct: 401 NVDMKALLSLVDT---------LHDSDINQDTNITKRDKNKKSPFLWNLKVKGKRELNKD 451

Query: 429 ----SQLLYSQILNRALTWLPESKLVSPNKSIKMMRKKNLLDILFAIFDDHELFLKRFVE 484
                 +LY  ILN  + W+PE   + P        K NL ++L  +F+  E F+  F  
Sbjct: 452 LPIRHAMLYEHILNYYIAWVPEPNDMIPGNIKSSYIKTNLFEVLLDLFESREFFISEFRN 511

Query: 485 LLKQKLFVIKGYNLEESWVQCLRLFK---TKFSPNSLDDAPTSTNLETL-----TGNNDS 536
           LL  +LF +K Y L+E W +CL+L +    KF+  S  +  T+  L  L       + D 
Sbjct: 512 LLTDRLFTLKFYTLDEKWTRCLKLIREKIVKFTETSHSNYITNGILGLLETTAPAADADQ 571

Query: 537 MYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYWQYDMKNEKRKTYYGLLN 596
             + +IDVMLWD++ S++L  +MH +  LD  I  K IS LYW+Y+   +       L  
Sbjct: 572 SNLNSIDVMLWDIKCSEELCRKMHEVAGLDPIIFPKFISLLYWKYNCDTQGSN---DLAF 628

Query: 597 KMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMSIC 656
            +   L  +L KYS +YS+LKPGR L L  D+  +EI   F+D R +  + + E    I 
Sbjct: 629 HLPIDLERELQKYSDIYSQLKPGRKLQLCKDKGKVEIQLAFKDGRKLVLDVSLEQCSVIN 688

Query: 657 PF-LENEGTSSYTLEELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRPLEYLDRSEII 715
            F   N+     +LE+LS   +     L   L FW+ + +L  +  TY  +E+   SE+ 
Sbjct: 689 QFDSPNDEPICLSLEQLSESLNIAPPRLTHLLDFWIQKGVLLKENGTYSVIEH---SEMD 745

Query: 716 IESPESNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENITKCTPDHDKTFNATSQEVS 775
            +  +     + M I N+    + +    +  I+R  +  + +  P              
Sbjct: 746 FDQAQKT---APMEIENS---NYEL--HNDSEIERKYELTLQRSLP-------------- 783

Query: 776 KIKEYVLSILTNLGEQNIEKLYNVLQ-TTSHDTAIKKVSSVTLENIVTELVENGQILCLP 834
               ++  +LTNLG   + K+++ L+ T   D    +++   LE  +  L + G++  + 
Sbjct: 784 ----FIEGMLTNLGAMKLHKIHSFLKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIA 839

Query: 835 NGLYQL 840
           NG Y++
Sbjct: 840 NGSYEI 845

>TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {ON}
           Anc_8.321 YLR127C
          Length = 809

 Score =  451 bits (1159), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 293/854 (34%), Positives = 464/854 (54%), Gaps = 69/854 (8%)

Query: 4   TEVDSIVGNIYELVDSKSCGXXXXXXXXXXXXNPNDPKSNHQLKPPTXXXXXXXXXXXXD 63
           +E+  I+ +I E+      G            NPN+ +SNH ++PP              
Sbjct: 7   SELPVIIDSIKEVALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQ 66

Query: 64  VNTLGDYDSIET---------LNSLLRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEF 114
               G     +          L + LR +YI+QVR++FF++   I  FKDI +LEKYY  
Sbjct: 67  YYNSGYISGSDGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVS 126

Query: 115 PILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWS 174
           P+ ++ +F ++ Y W  E + +RHYLL  N+ F +N+  R++ L  +DDF+   E++ W 
Sbjct: 127 PLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQDDFEYVAEMLDWV 186

Query: 175 NEANFSLLSSKQIILNALLDKITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLN 234
            +A+ SL SSK I+L+ ++ K+  + D      + + +++M+T+NKFI KYWSNFA LL 
Sbjct: 187 EKAHTSL-SSKDILLDLIIAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLG 245

Query: 235 CAEDDHEITKVLYKYFEKQFLRIRSEEIFDICVISYPDSKPTIMELRGLLTQSKISTNIL 294
           C +DDH +T V+Y  FEKQF+RIR++E+FDI V  +P+SKPTI+E+R L+T S     I+
Sbjct: 246 CPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTDFKTIV 305

Query: 295 IRLLSEFQLKVLNLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDII 354
           I  LS F+ KVLN S+ T   L+AY+K+VK+ L LDP+ RYLQS  SF     Q++SD++
Sbjct: 306 IAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLV 365

Query: 355 YILLFAILDLRTDDIKTNPIVKVDQNXXXXXXXXXXXXHFGINLNFSDVDISDNLENGNN 414
            ILL+AILDL+ D +  + I +VD                GI    +D+   DNL   N 
Sbjct: 366 VILLYAILDLQLDGLVGSHI-QVDPVCLKALASELRDPELGIE---NDIYPDDNL--ANV 419

Query: 415 NKNISQLDYAGQESSQLLYSQILNRALTWLPESKLVSPNK-SIKMMRKKNLLDILFAIFD 473
              +++L+Y G     L Y +++ R L+W P+ + ++P   S +     +LLDIL  +F+
Sbjct: 420 ATGMAKLNYEG----CLPYEEVMQRFLSWNPDPRDMAPRAISKQSPSHMSLLDILMELFE 475

Query: 474 DHELFLKRFVELLKQKLFVIKGYNLEESW---VQCLRLFKTKFSPNSLDDAPTSTNLETL 530
             + F+  F++LL ++L  +K YNL+ +W   +Q L+    + +PN +  APT     + 
Sbjct: 476 SKDFFVSEFLKLLTKRLLSLKFYNLDRNWSKCLQLLKKKLARGAPN-ISLAPTGQQNNSE 534

Query: 531 TGNNDSMYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYW--QYDMKNEKR 588
            G++ S   +N DVMLWD++ S +L +QMH +  LD RI  K IS LYW  Q + KN+  
Sbjct: 535 RGDDYSNINSN-DVMLWDVKLSYELCKQMHQVSGLDQRIYPKFISYLYWNCQLESKND-- 591

Query: 589 KTYYGLLNKMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECT 648
                   ++ + L ++ +KYS++YS +K GR L LL DQ  IE+D  F+D R + C+ T
Sbjct: 592 -------FEIPEPLNSEFEKYSRVYSEVKAGRALKLLKDQGVIELDLEFKDGRVLQCDVT 644

Query: 649 FENYMSICPFLENEGTSSYTLEELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRPLEY 708
            E Y  I  F E+   +    E +S+  +  +  +K +L+FW+++ +LY     Y   E 
Sbjct: 645 LEQYAVIQQFDEDSYANRLMAETISLYLNMEISRVKSALQFWVEKGVLYQVDAFYATQE- 703

Query: 709 LDRSEIIIESPESNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENITKCTPDHDKTFN 768
             R +  I++ +S++V S                + N+TI    +E  T       KT N
Sbjct: 704 -SRQDSNIKTAKSDSVGSFF--------------EKNETI---IEEETTL-----SKTLN 740

Query: 769 ATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQ-TTSHDTAIKKVSSVTLENIVTELVEN 827
           A       I  +V  +LTNLG     K+++ L+ T   +     V+   LE+ +  LVE 
Sbjct: 741 A-------IWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSLVEE 793

Query: 828 GQILCLPNGLYQLP 841
            ++ C  +G Y+LP
Sbjct: 794 ERLACTTSGSYKLP 807

>Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {ON}
           YLR127C (APC2) - subunit of the anaphase promoting
           complex (APC) [contig 171] FULL
          Length = 776

 Score =  402 bits (1033), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 252/813 (30%), Positives = 416/813 (51%), Gaps = 86/813 (10%)

Query: 36  NPNDPKSNHQLKPPTXXXXXXXXXXXXDVNTLGDYDSIETLNSLLRYYYIFQVRLNFFSN 95
           NPN+P SNHQL+PP+             +N  G+  +   L  +LR Y IFQ R +FF++
Sbjct: 37  NPNEPTSNHQLRPPSLRLKSAIKIL---INENGNGPA---LTDILRQYLIFQTRKHFFAH 90

Query: 96  LQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRL 155
             S+ +FKD+ KLE+YYEFP+  V +F  N   W  E+N +R+YL+  NL F  N   RL
Sbjct: 91  YYSLCHFKDVQKLERYYEFPLRFVRLF--NREEWAEEINGLRNYLISKNLVFNRNARLRL 148

Query: 156 KKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKITMYADKQFTNAWSQRFIIM 215
           ++LV EDDF++A ++ +W   A   LL+   ++++A+L K+  +A K    AWS+RF+ +
Sbjct: 149 RQLVLEDDFEMACKLYEWLCRAEGRLLT--HLLVDAVLSKVKAFALKHMEEAWSKRFVTV 206

Query: 216 ETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLRIRSEEIFDICVISYPDSKP 275
           E YN FI+KYWS  + +L C EDDH++T  +Y+ FE++F+RIR+++ F I V  YP+S+P
Sbjct: 207 ELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYRCFEEEFIRIRTQQAFKIFVTGYPESEP 266

Query: 276 TIMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTILIAYIKTVKSLLILDPTSRY 335
           T++ELR +L      T ++  LLS+F+ ++LN SI T  IL++Y+K +KS+L +D + RY
Sbjct: 267 TLLELRSVLKTPAKYTQLVTELLSQFEARMLNPSITTAEILLSYVKAIKSILTIDVSFRY 326

Query: 336 LQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPIVKVDQNXXXXXXXXXXXXHFG 395
            Q  T F  P+L ++ D +   L+A+L L   + +         +            H  
Sbjct: 327 FQLLTDFVRPFLMERRDTVVTFLYAMLGLDASETRGPKPTGAHASIASQLSAELKDSHQP 386

Query: 396 INLNFSDVDISDNLENGNNNKNISQLDYAGQESSQLLYSQILNRALTWLPE-SKLVSPNK 454
           I  +  D      ++           D A     + +Y Q++N  L W PE S  +  N 
Sbjct: 387 IFRSALDKSAQSPVD-----------DMASVNPKEPVYQQVINFYLHWTPEPSDSIQANN 435

Query: 455 SIKMMRKKNLLDILFAIFDDHELFLKRFVELLKQKLFVIKGYNLEESWVQCLRLFKTKFS 514
           S  +M  K L DI+  +FD  ++ +  F+ L   KL  +KGY LE++WV+ L++ K +F 
Sbjct: 436 SDTLM-NKGLFDIIVELFDSKDIIIGEFLTLFTDKLLDLKGYRLEQNWVKSLKILKNRFD 494

Query: 515 PNSLDDAPTSTNLETLTGNNDSMYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRINLKII 574
             +  +A   +N+             NIDVML D++ S++L  QMH + E+   +    I
Sbjct: 495 FKNYSNAQGVSNI------------NNIDVMLRDVKHSEELCAQMHSVPEISREVIPMFI 542

Query: 575 SSLYWQYDMKNEKRKTYYGLLNK---MDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTI 631
           S L+W    K       +  L K   +   L +++ KY  +Y+++KPGR L L  +QST+
Sbjct: 543 SYLFWNAGSK-------FSTLPKDCRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQSTV 595

Query: 632 EIDFNFEDNRTVTCECTFENYMSICPFLENEGTSSYTLEELSIITSFGLEDLKI--SLKF 689
            +  +F D R +  E + +    +    E  G S        I+ + GLE  ++  +L+F
Sbjct: 596 VLQLHFADKRVMDFEVSMDKSSVLACVAETTGISRD-----KIVEATGLEKAQVDQNLRF 650

Query: 690 WLDQKILYFDGKT--YRPLEYLDRSEIIIESPESNNVNSVMSITNNPLNGFAILGKGNDT 747
           WLD  +L FD KT  Y  LE  D       +  ++   + M   +   + F         
Sbjct: 651 WLDASVLRFDSKTSLYSSLERQD-------TDNASEREAQMRAEDQARSAF--------- 694

Query: 748 IDRPSQENITKCTPDHDKTFNATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQTTSHDT 807
            D   Q+ +               + + K+  ++  +LTNLG   +EK+++ L+      
Sbjct: 695 -DSQQQQFV---------------ESMEKVWPFIRGMLTNLGTLKVEKIHSFLKVAVPKE 738

Query: 808 AIKKVSSVTLENIVTELVENGQILCLPNGLYQL 840
                ++  LE  +  LV+  +++C  N  ++L
Sbjct: 739 IGFNATTAQLEAYLRLLVDENKLVCSANNAFKL 771

>TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {ON}
           Anc_8.321 YLR127C
          Length = 732

 Score =  397 bits (1020), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 247/702 (35%), Positives = 393/702 (55%), Gaps = 40/702 (5%)

Query: 36  NPNDPKSNHQLKPPTXXXXXXXXXXXXDVNTLGD-YDSIET-LNSLLRYYYIFQVRLNFF 93
           +PNDP SNH L PPT              +   D  +SI+  + + L+ +Y++QVR  FF
Sbjct: 41  DPNDPNSNHHLHPPTLQLKTIIKQITPSSDIYKDPSNSIKNNIQNWLKLFYVYQVRTYFF 100

Query: 94  SNLQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNLIN 153
             + +I  +KD+IKLEKYY+FP+  +P+F      W  EL  +RHY+L  N  F   +I 
Sbjct: 101 KKIDNIRQYKDMIKLEKYYQFPLQFIPLFTFQE--WCFELLSLRHYILHQNKEFTQKIIL 158

Query: 154 RLKKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKITMYADKQFTNAWSQRFI 213
            L++L+KE+DF+ + +I+ W  E + +LLS +  IL+ LL+KIT+Y ++     W++R++
Sbjct: 159 ELRQLIKEEDFETSLDIVTWIREVDSNLLS-ENFILDILLEKITLYCEQTMKGNWTRRYL 217

Query: 214 IMETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLRIRSEEIFDICVISYPDS 273
           +METYN F+  YW NF  LLNC ED+H+IT +L+KYFEKQF++IR +EIF IC++SYPD+
Sbjct: 218 VMETYNTFMMNYWLNFTQLLNCKEDNHKITNILFKYFEKQFIKIRIQEIFKICILSYPDT 277

Query: 274 KPTIMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTILIAYIKTVKSLLILDPTS 333
           KPT++ELR LL        +++  LS F+  VL  +I T   L+AYI+TVKS  ILDP+ 
Sbjct: 278 KPTLLELRNLLVTYNFFQKLVVNFLSAFERIVLTPTINTIDCLLAYIRTVKSFQILDPSG 337

Query: 334 RYLQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPI--VKVDQNXXXXXXXXXXX 391
           RYL S T++ NP+ +++  +  ILL AIL L   D++ N I  +KV              
Sbjct: 338 RYLYSITNYINPHFRERKMLAPILLHAILALPKIDLE-NAIYPIKVSSISLKLIINELED 396

Query: 392 XHFGIN---------LNFSDVDISDNLENGNNNKNISQL--DYAGQES-SQLLYSQILNR 439
              GI            F+++       N N+++ +  L  + + ++S S LL  +++ +
Sbjct: 397 PELGIENTSTKKNSIKKFNEILSPKRFNNHNSSEYLPDLLQNTSSEDSNSTLLVQKVVKQ 456

Query: 440 ALTWLPESKLVSPNKSIKMMRKKNLLDILFAIFDDHELFLKRFVELLKQKLFVIKGYNLE 499
            LTW+P    ++ N + K+    NLLDIL  IF+  E  L  F +LL ++L + K Y LE
Sbjct: 457 FLTWVPIPNDIATNDTKKLYSSTNLLDILLNIFESKEFLLTEFSKLLSKRLLITKNYKLE 516

Query: 500 ESWVQCLRLFKTKFSPNSLDDAPTSTNLETLTG--NNDSMYMTNIDVMLWDMRGSKKLTE 557
             W  CL+L + +FS  S  D  T+TNL       N +++ +TN++VML D+  S +L +
Sbjct: 517 GKWGACLQLLRKRFSSGS--DNYTNTNLADTDNLVNGENLKITNMNVMLSDLNYSSELCK 574

Query: 558 QMHLIDELDNRINLKIISSLYWQYDMKNE-------KRKTYYGLLNKMDQTLFNQLDKYS 610
             H  + ++ R+  K ISS YW  D+ +E       +   ++    ++  +L    ++Y+
Sbjct: 575 IFHHANGVNTRVYPKFISSHYW-VDLDDENVSNGPNEETNHF----QIPPSLLGYFEEYA 629

Query: 611 KLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMSICPFLEN----EGTSS 666
           KLY  L  GR +++  ++  IEI  +FED R +  + T   Y  +    E     +    
Sbjct: 630 KLYEDLNEGRKVDIWPNEGVIEIKLSFEDGRVLEIDATLPQYALLQYIQEKNAIMQNNQG 689

Query: 667 YTLEELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRPLEY 708
           +T+ ELS+  +  L+++   + FWL + +L      Y  LEY
Sbjct: 690 FTVNELSVPLNLSLQNVTELVDFWLKKNVLKKVDDKYSILEY 731

>KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 774

 Score =  398 bits (1022), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 257/812 (31%), Positives = 409/812 (50%), Gaps = 79/812 (9%)

Query: 36  NPNDPKSNHQLKPPTXXXXXXXXXXXXDVNTLGDYDSIETLNSLLRYYYIFQVRLNFFSN 95
           NPN+P SNHQ++PP+             V T       E+   LL  Y IFQ R +FF N
Sbjct: 37  NPNEPGSNHQMRPPSLRVKSAIKSLLNGVVT------SESFIDLLGKYMIFQTRKHFFLN 90

Query: 96  LQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRL 155
            QS+ YFKD+ KLE+YYEFP  +V IF +    W  E++ +R+YL+R N   ++N+  RL
Sbjct: 91  YQSLLYFKDVQKLERYYEFPTRYVNIFSSEE--WCDEMSGLRNYLIRQNSGLKNNIQLRL 148

Query: 156 KKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKITMYADKQFTNAWSQRFIIM 215
           ++LV EDDFD+A +I +W  +A   LL   +I+++ LL K+ ++A K   +AW+QRF IM
Sbjct: 149 EQLVHEDDFDMACKIYEWLCQAEGRLLP--EILVDVLLSKVKLFASKNMNSAWTQRFTIM 206

Query: 216 ETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLRIRSEEIFDICVISYPDSKP 275
           E YN F+  YWS F  +L C EDDHEIT  +Y+ FE++F+RIR+ ++FDI V  +P +KP
Sbjct: 207 EAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTKP 266

Query: 276 TIMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTILIAYIKTVKSLLILDPTSRY 335
           T++ELR +L  S   T ++   L +F+ K+LN SI T  IL++Y++ +KS+LI+D + RY
Sbjct: 267 TLLELRSVLKTSVKYTELITEFLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFRY 326

Query: 336 LQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPIVKVDQNXXXXXXXXXXXXHFG 395
            Q  T+F  PYL ++ D +   L+A+L L   D+ +        +            H  
Sbjct: 327 FQLLTNFVRPYLMERHDTVATFLYAMLGLDASDLSSKNSTSTHMSIASQLSAELRGSHQP 386

Query: 396 INLNFSDVDISDNLENGNNNKNISQLDYAGQESSQLLYSQILNRALTWLPESKLVSPNKS 455
           I+   S      NL +G +  +++  + A        Y QI++  L W PE     P  S
Sbjct: 387 IS---SSTAERGNLPHGKHALSMNPYEPA--------YQQIIDYYLHWNPE-----PADS 430

Query: 456 I-----KMMRKKNLLDILFAIFDDHELFLKRFVELLKQKLFVIKGYNLEESWVQCLRLFK 510
           I     + +  K L DI+  +FD  ++ ++ F+ L  +KL  ++GY LE +WVQ L++ K
Sbjct: 431 IQANNDQALISKELFDIIVELFDSKDVIVREFLGLFTRKLLGLRGYKLESNWVQSLKVVK 490

Query: 511 TKFSPNSLDDAPTSTNLETLTGNNDSMYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRIN 570
            K    +   A   +N+             NIDVML D++ S++L   MH    L +RI 
Sbjct: 491 KKLDFKTYSSAQEFSNI------------NNIDVMLRDVKHSEELCSLMHEKLGLSDRII 538

Query: 571 LKIISSLYWQYDMKNEKRKTYYGLLNKMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQST 630
            K +S L+W            + L  +++  + N    Y K Y+ +K GR L L  +QS 
Sbjct: 539 PKFVSYLFWNAHSDFSALPKDHPLPKELEADINN----YKKAYTNVKKGRKLRLHPEQSI 594

Query: 631 IEIDFNFEDNRTVTCECTFENYMSICPFLENEGTSSYTLEELSIITSFGLEDLKISLKFW 690
           +E+     D R +  E T +  + +  +L + G    T+EE+   T+  +  ++ SLKFW
Sbjct: 595 VELQLRLADGRDLNYEVTLDEAL-VLSYLSSNGDG--TVEEIVKQTNLDISQVEKSLKFW 651

Query: 691 LDQKILYFDGKTYRPLEYLDRSEIIIESPESNNVNSVMSITNNPLNGFAILGKGNDTIDR 750
           +   IL +  +T R               E  NV+                      ++R
Sbjct: 652 VKSSILRYSTETSR-----------YSVEERQNVDV------------------KHAVER 682

Query: 751 PSQENITKCTPDHDKTFNATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQTTSHDTAIK 810
            S   I   T   D         + K+  ++  +LTNLG    +K+++ L+         
Sbjct: 683 QSSSEIVNATDSVDLQQQQFIDSMQKVLPFIKGMLTNLGSLKADKIHSFLKMAVPKEIGY 742

Query: 811 KVSSVTLENIVTELVENGQILCLPNGLYQLPE 842
             +   L+  +  LVE  +++  PNG ++L +
Sbjct: 743 SATPSQLQLYLNALVEESKLVKTPNGAFRLAK 774

>CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa]
           {ON} similar to uniprot|Q12440 Saccharomyces cerevisiae
           YLR127c APC2 component of the anaphase promoting complex
          Length = 783

 Score =  361 bits (927), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 249/817 (30%), Positives = 418/817 (51%), Gaps = 86/817 (10%)

Query: 39  DP--KSNHQLKPPTXXXXXXXXXXXXDVNTLGDYDSIETLNSLLRYYYIFQVRLNFFSNL 96
           DP  K NHQLKPP               N   DY     L S ++ YY +Q R+ F++  
Sbjct: 38  DPAGKKNHQLKPPNLLVKTMIEKLLLGSN---DYQ----LLSNIQDYYCWQCRVYFYNEY 90

Query: 97  QSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRLK 156
           + I    ++ ++E++  FP+ ++PIF  NN + E E+    +YLL+TN    S  + RL+
Sbjct: 91  KRIETLNELKRIERHVLFPLKYIPIFEGNNRV-ENEVRLFGNYLLKTNKKVMSRAVERLR 149

Query: 157 KLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKITMYADKQFTNAWSQRFIIME 216
             + EDDF+LA EI+ +    ++    S  I+L+ +LDKI  +    +T  W++R++IME
Sbjct: 150 NRMLEDDFELATEIVDY---FDYCQTDSTSIVLDIILDKIEQFCQLHYTRKWNKRYLIME 206

Query: 217 TYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLRIRSEEIFDICVISYPDSKPT 276
           T+N+FI++YW   + LL C ED+H IT  LYKYFEKQF+ IR+ EIFDIC+ +    +PT
Sbjct: 207 TFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNPASVQPT 266

Query: 277 IMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTILIAYIKTVKSLLILDPTSRYL 336
           ++ELR  ++       +++ LLS+F LKV+N SI T   L  YI+T+K+  ILDP+ RYL
Sbjct: 267 LLELRKEISTVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYL 326

Query: 337 QSFTSFTNPYLQQKSDIIYILLFAILDL-RTDDIKTNPIVKVDQNXXXXXXXXXXXXHFG 395
           Q+ +S+  P+ +Q+ D++++LLF++L L  TD + T P    ++                
Sbjct: 327 QTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTMPSQVSEEKLT------------A 374

Query: 396 INLNFSDVDISDNLENGNNNKNISQLDYAGQESSQLLYSQILNRALTWLPESKLVSPNKS 455
           +     D +I    E  ++  +     ++ +E S +L  Q++ R + W+PE    S  K 
Sbjct: 375 LTNELKDTEICSYTEESDDVVDPMIGSFSKEEDSMVL-EQVIKRYMEWIPEVP-TSFGKG 432

Query: 456 IKMMRKKNLLDILFAIFDDHELFLKRFVELLKQKLFVIKGYNLEESWVQCLRLFKTKFSP 515
           I    K +L DIL  + +  E  +  F  LL +KL  ++GY L++ W + L L K +F  
Sbjct: 433 ILSDHKLDLFDILLELLESKETLVIEFKNLLTKKLLDLRGYTLDKKWSKFLSLLKKRF-- 490

Query: 516 NSLDDAPTSTNLETLTGNNDSMYMTNIDVMLWDMRGSKKLTEQMHL-IDELDNRINLKII 574
              D+  T T  E    N     +  ID+ML D+  S+++   M L +   + ++  KI+
Sbjct: 491 ---DNRSTETMDEEDLNN-----INTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIV 542

Query: 575 SSLYWQYDMKNEKRKTYYGLLNKMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEID 634
           S+LYW  +   + +   +    +MD  L + L+ YS+ YS+ + G+ L L  D  ++ ++
Sbjct: 543 SALYWSNNSDTQSKAGDF----EMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLN 598

Query: 635 FNFEDNRTVTCECTFENYMSICPFLENEGTSSYTLEELSI---ITSFGLEDLKIS--LKF 689
            +F D RTV C+ +   Y  +  F   +  S++  E L+I       G++  +++  L++
Sbjct: 599 LSFLDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRY 658

Query: 690 WLDQKILYFDGKTYRPLEYLDRSEIIIESPESNNVNSVMSITNNPLNGFAILGKGNDT-- 747
           W+ + +LYF    YR LE+L                                 KG+ T  
Sbjct: 659 WVSKDVLYFSDGKYRTLEFLR-------------------------------WKGDSTYA 687

Query: 748 -IDRPSQENITKCTPDHDKTFNATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQTT-SH 805
            I    +E++ + +  H+   +     V +   Y+  IL NLG   I+KL+ +LQ+    
Sbjct: 688 AIPDVLEESVVERSSQHE---DKQENHVERALPYIKDILLNLGTLKIDKLHALLQSAMPK 744

Query: 806 DTAIKKVSSVTLENIVTELVENGQILCLPNGLYQLPE 842
           D+    V+   L++ +  LVE G +    N  Y+LP+
Sbjct: 745 DSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKLPQ 781

>Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 511
           aa] {ON} ANNOTATED BY YGOB -
          Length = 511

 Score =  313 bits (801), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 199/542 (36%), Positives = 298/542 (54%), Gaps = 42/542 (7%)

Query: 306 LNLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDLR 365
           +N SI T   LIAY+KTVKS L LDP+ +YL S ++F NPYLQ+++D++ +LL+AILDL+
Sbjct: 1   MNPSITTVDALIAYVKTVKSFLTLDPSGKYLHSISTFVNPYLQERNDLVSVLLYAILDLQ 60

Query: 366 TDDIKTNPIVKVDQNXXXXXXXXXXXXHFGINLNFSDVDISDNLENGNNNKNISQLDYAG 425
           +++ +      +D +             FGI               G  N ++ + +  G
Sbjct: 61  SENFQEEAQNILDADSLVILSDELRDPEFGIE--------------GELNIDLDKNELTG 106

Query: 426 QES-----SQLLYSQILNRALTWLPESKLVSPNKSIKMMRKKNLLDILFAIFDDHELFLK 480
           Q S     S LLY Q++ + L W+PES  +   +   +  +KNLLDIL  IF+++E+F+ 
Sbjct: 107 QPSNKSGDSSLLYRQVITQMLNWVPESSKIDSKRQKMIGLRKNLLDILLEIFENNEVFIA 166

Query: 481 RFVELLKQKLFVIKGYNLEESWVQCLRLFKTKFSPNSLDDAPTSTNLETLTGNNDSMYMT 540
            F++LL +KL  +K Y L+  W +CL+L K KF  NS      STN+  +TG+ D +Y+ 
Sbjct: 167 EFLKLLTKKLLKLKYYKLDSRWSKCLKLLKEKFKGNSAGTTSISTNIGNVTGS-DLVYIN 225

Query: 541 NIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYWQYDMKNEKRKTYYGLLNKMDQ 600
           NIDVMLWD++ S  LT +MH I+ LD RI  K ISSLYW    K  K K       ++D 
Sbjct: 226 NIDVMLWDLKTSGDLTSRMHQIEGLDRRIQPKFISSLYWD-QAKESKSKGNNAKQTQIDP 284

Query: 601 TLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMSICPFLE 660
            L  QL+KY ++YS LKPGR L+LL D  T+E++F FED RT++C+ T E    I  F E
Sbjct: 285 LLSTQLEKYIRVYSELKPGRTLHLLKDHGTVELEFTFEDGRTISCDATLEQSNIINYFSE 344

Query: 661 NEGTSSYTLEELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRPLEYLDRSEIIIESPE 720
               +  +LE+L I++      LK  L+FW+D+K+LYFDG+ YR LEYLD+ EII++S  
Sbjct: 345 AVSENGLSLEQLHILSGIESTGLKKILQFWVDEKVLYFDGQLYRILEYLDQPEIIVQSLT 404

Query: 721 SNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENITKCTPDHDKTFNATSQEVSKIKEY 780
                       NPL+                    +          N   + ++ +  Y
Sbjct: 405 HTGEVLKEEQKLNPLS--------------------SSSITSDIDQMNKIHETLNNVWPY 444

Query: 781 VLSILTNLGEQNIEKLYNVLQTT-SHDTAIKKVSSVTLENIVTELVENGQILCLPNGLYQ 839
           +  +LTNLG   +EK+++ L+ T   D     ++  +LE  +  LVE+  +  L +G Y+
Sbjct: 445 IKGMLTNLGSLKLEKIHSFLRATVPKDVNYNSITVSSLEVYLNSLVEDDVLELLASGSYR 504

Query: 840 LP 841
           LP
Sbjct: 505 LP 506

>NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.321
           YLR127C
          Length = 811

 Score =  300 bits (768), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 241/841 (28%), Positives = 401/841 (47%), Gaps = 102/841 (12%)

Query: 36  NPNDPKSNHQLKPPTXXXXXXXXXXXXDVNTL-GDYDSIETLNSLLRYYYIFQVRLNFFS 94
           +PN  K   Q KPPT             +N L   Y   E     LR YY++ V+ +F  
Sbjct: 34  DPNSSKGTRQNKPPTLELKDC-------INLLRAGYSQDEKFKMWLREYYLYVVKFHFMK 86

Query: 95  NLQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNLINR 154
           N+  I+  KD   LE  Y +P+  + +  + +      +   +HYL+  N+TFR NLI +
Sbjct: 87  NVDEISVLKDFKLLEMIYIYPLQFMDLVDSTDI--SNLVKSFKHYLIDKNVTFRKNLITK 144

Query: 155 LKK--LVK---EDDFDLAQ--EIIKWSNEANFSLLSSKQIILNALLDKITMYADKQFTNA 207
            K   LV    E +++ A   EII W  ++   +LS+  +IL+A L KI ++A +Q    
Sbjct: 145 FKDCFLVGNQFEFEYEFANIVEIIHWIQDSE-GVLSATDLILDASLTKIEIFAREQMIGK 203

Query: 208 WSQRFIIMETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLRIRSEEIFDICV 267
            +Q+FI+MET+NKFI+ YW N   L+   EDDH++T ++Y++FE+QF++IR EEI  I V
Sbjct: 204 LNQKFIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMV 263

Query: 268 ISYPDSKPTIMELRGLLTQSKIST---------------NILIRLLSEFQLKVLNLSIPT 312
             YP +KPTI+EL+ +L++   ST                +L + L  F+ + LN  IPT
Sbjct: 264 QDYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPT 323

Query: 313 CTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQ-KSDIIYILLFAILDLRTDDIKT 371
             +L AY+K  KS L+LDP+   L S   F  PYL+  + +++ ILL+A+L+L++ D+  
Sbjct: 324 IDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIE 383

Query: 372 NPIVKV--DQNXXXXXXXXXXXXHFGINLNFSDVDISDNLENGNNNKNISQLDYAGQESS 429
               K   D              H   + +  DVD       G N            E+S
Sbjct: 384 LNCEKTTYDMRSIELLSKELSNDH---SKHAGDVDYKKFSPEGTNE----------FENS 430

Query: 430 QLLYSQILNRALTWLPESKLVSPNKS----IKMMRKKNLLDILFAIFDDHELFLKRFVEL 485
            L Y Q+    L W P    +S + +      + +    +D +F   +  +  +  F++L
Sbjct: 431 TLPYEQVYTDFLNWKPSITPISESSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKL 490

Query: 486 LKQKLFVIKGYNLEESWVQCLRLFKTKFSPNSLDDAPTSTNLETLTGNNDSMYMTNIDVM 545
           L  KL  +KGY +E+ W +CL++ + K + +         N E++T +     +  I +M
Sbjct: 491 LTIKLLHMKGYEVEDRWQKCLKILQDKVTSDK-----NIVNDESITSD-----INTILIM 540

Query: 546 LWDMRGSKKLTEQMHLIDELDNRINL----KIISSLYWQYDMKNEKRKTYYGLLNKMDQT 601
           L D+  SK+ + +   I E  N   +    K IS LYW++     KR++ Y     +D  
Sbjct: 541 LHDISISKESSNEK--ISEFQNSSEMQLFPKFISKLYWKF-----KRQSEYQF--PLDSK 591

Query: 602 LFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMSICPFLEN 661
           L  +L KY K Y    PG  L L+       ++  F+D R ++ + TFE Y  +  F  +
Sbjct: 592 LRKKLSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHND 651

Query: 662 EGTSSYTLE--ELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRPLEYLDRSEIIIESP 719
           +  SS  L   +LS +     E ++  L+FW+++K+L      Y   EYL+  E+     
Sbjct: 652 KDDSSQVLSINQLSTMLKMDPERVRAHLQFWINKKVLCHQNDYYTIQEYLNNQEL----- 706

Query: 720 ESNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENITKCTPDHDKTFNATSQEVSKIKE 779
             ++  +V++ +  PL                SQE +           N   + + ++  
Sbjct: 707 --SSGPTVITSSILPL----------------SQERMPFKRSVPTNVLNDPKEILHRVYP 748

Query: 780 YVLSILTNLGEQNIEKLYNVL-QTTSHDTAIKKVSSVTLENIVTELVENGQILCLPNGLY 838
           Y+  + TNLG   ++K+++ L  +        KV+   LE  + +LVE  Q++ LP+G +
Sbjct: 749 YINDMFTNLGSLKVDKIHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVEEEQLIVLPDGSF 808

Query: 839 Q 839
           +
Sbjct: 809 K 809

>KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {ON}
           Anc_8.321 YLR127C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 797

 Score =  291 bits (744), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 208/698 (29%), Positives = 351/698 (50%), Gaps = 65/698 (9%)

Query: 76  LNSLLRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVPIF-LNNNYIWETELN 134
           L+   + YYI  ++  +  + Q    FK I  LE    +P+ ++P   +++    E  + 
Sbjct: 60  LDRQFKIYYIDVIKQEYLCD-QVKREFKHIQVLESKLVYPVTYLPFLSISDQLAIEQTIC 118

Query: 135 KIRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLD 194
            +RHYL+  +   R++L+   + L+++DDF+   +II+W   AN  LL    + L+ ++ 
Sbjct: 119 SLRHYLVDNDDNLRNSLVAEFETLMQDDDFESGYQIIEWLYTANAKLLRPWNLALDTIVS 178

Query: 195 KITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQF 254
           KI+   D +    W  +F++M T+NKFIN YWS+ A  L+ +ED+H+ TKVLYK FEK+F
Sbjct: 179 KISTLCDNEMRRNWEAKFLVMNTFNKFINLYWSHLAKFLHLSEDNHDFTKVLYKCFEKEF 238

Query: 255 LRIRSEEIFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCT 314
           +RIR+EEIF+I V SY  +K TI+ELR  ++  +  + ++ + L +F++KVLN S+ T  
Sbjct: 239 VRIRTEEIFEIVVESYQAAKTTILELRTFMSGYERLSKLVNQFLKQFKIKVLNPSVNTVE 298

Query: 315 ILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDLR--------- 365
            L+A+I++VK  +ILDP +R++ + T+F  P+  Q+ D + I+L+AILDLR         
Sbjct: 299 ALVAFIRSVKCFVILDPRARHMHTITNFVKPFFHQRGDAVQIILYAILDLRDVDFEKMGV 358

Query: 366 ---------TDDIKTNPIVKVDQNXXXXXXXXXXXXHFGINLNFSDVDISDNLENGNNNK 416
                    + +++ +P V ++                 +N + S +D+ D L++G    
Sbjct: 359 SPVKGLSELSHELREDPYVNINAKCQTPTPSPSKISSPHLN-DSSSMDVDDKLDDG---- 413

Query: 417 NISQLDYAGQESSQLLYSQILNRAL------TWLPESKLVSPN-KSIKMMRKKNLLDILF 469
                      ++ L+Y Q+LN+        T       V  N K  +   + NLLD LF
Sbjct: 414 -----------TTDLVYKQVLNQFXXRGHHETNQGTRDYVGVNVKFSQRSNRTNLLDPLF 462

Query: 470 AIFDDHELFLKRFVELLKQKLFVIKGYNLEESWVQCLRLFKTKFSPNSL-DDAPTS--TN 526
            +FD  +  L  F++LL  KLF + GY LE +W +C +L K K +   + D  P S  T 
Sbjct: 463 ELFDKKDELLSCFLKLLTLKLFKLSGYTLEPNWNECYQLIKRKVTKGDVGDGGPLSRDTA 522

Query: 527 LETLTGNNDSMYMT--NIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYWQYDMK 584
              ++ NN+ + ++   IDVML D+R + K+T ++H    L+  +  K ISS YW Y   
Sbjct: 523 DAPVSSNNEQVLLSLNKIDVMLHDLRENAKITRRLHRTSMLNGNVFPKFISSQYWSY--- 579

Query: 585 NEKRKTYYGLLN----KMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDN 640
             +  T+    N    K+D  L   + +Y   +  LK GR++ L  +++  EI+    D 
Sbjct: 580 --RDDTFTKAGNRDQIKIDPVLETDILQYGGRFCELKYGRMVRLCKEKTIFEIELTVNDG 637

Query: 641 RTVTC-ECTFENYMSICPFLENEGTSSYTLEELSIITSFGLEDLKISLKFWLDQKILYFD 699
                 +     Y  I  +      + YT  EL  +    + D++ SL +W++  +L   
Sbjct: 638 EVPQVFKVDAMKYSVIEKYATGGPRAGYTPTELCELCGMDIADVQTSLTYWVNAGLLRLS 697

Query: 700 GKTYRPLEYLDRSEIIIESPESNNVNSVMSITNNPLNG 737
              Y    Y   SE     P  N    + + T   L+G
Sbjct: 698 SSGY----YESTSET---GPPPNRGTPLEASTREFLDG 728

>KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.321
           YLR127C
          Length = 817

 Score =  285 bits (730), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 221/724 (30%), Positives = 349/724 (48%), Gaps = 92/724 (12%)

Query: 42  SNHQLKPPTXXXXXXXXXXXXDVNTLGDYDSIETLNSLLRYYYIFQVRLNFFSNLQ---S 98
           + HQ KPP+                  D+      N L++ Y I  +R  F S ++   +
Sbjct: 30  AEHQCKPPSLRIKKSIQRIRECFQLSSDF-----TNCLVKLY-IDLIRFEFISYMKENAN 83

Query: 99  ITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRLKKL 158
              F D++KLE   E P L +P      + +   L+ +RHYLL ++ +F++ L   ++ L
Sbjct: 84  CLKFNDVLKLENRIEHPRLFIPEL---EFEYFKNLHMLRHYLLDSDKSFKTALCTSIENL 140

Query: 159 VKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKITMYADKQFTNAWSQRFIIMETY 218
           + EDDF  A  I+ W + A    LS K ++L+ L+ KI          +W++RFI++ET+
Sbjct: 141 IMEDDFYSATIILDWIDSAYSIDLSPKDLVLDMLVKKIAGICSGSIRGSWTRRFIVIETF 200

Query: 219 NKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLRIRSEEIFDICVISYPDSKPTIM 278
           N FI  YWS+FA LL C E+DHE+TK ++K FE++F+ IR  EIF+I   +YP+SKPTI+
Sbjct: 201 NDFIEVYWSHFAQLLKCPENDHELTKTVFKCFEREFINIRINEIFEIFTSAYPESKPTIL 260

Query: 279 ELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTILIAYIKTVKSLLILDPTSRYLQS 338
           ELR ++   K    +    L  F+ ++LN  + T   L +Y+K +K  L+LDP  RYL  
Sbjct: 261 ELRKVMKAPKDLQRLTYTFLDTFKDEMLNPCVTTIDALTSYLKAIKGFLLLDPAGRYLNL 320

Query: 339 FTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPIVKVDQNXXXXXXXXXXXXHFGINL 398
            T+F  PY Q KSD+I ILL+AILDL+  D +       D N                + 
Sbjct: 321 VTTFVKPYFQDKSDLINILLYAILDLKPKDFE-------DLNISYIPGLNKLSLDMREDP 373

Query: 399 NFSDVDISDNLENGNNN--KNISQLDYAGQES----SQLLYSQILNRALTWLPESKL--- 449
            FS     +N+E  +NN  + +  L+  G  S      L+   I+ + + W+PE  +   
Sbjct: 374 EFS----IENVEPNDNNYKRTVPNLESIGANSLHDKGTLIQDHIMKQFMMWVPEPNMNNL 429

Query: 450 ----------------VSPNKSIKMMRKKNLLDILFAIFDDHELFLKRFVELLKQKLFVI 493
                           V+   SI      NLLDIL  +F+  E+F+ +FV LL  K F +
Sbjct: 430 ENDHDNGNDFEEDNNDVTAVNSI--FYNVNLLDILLDLFESKEIFIGKFVNLLTIKFFKL 487

Query: 494 KGYNLEESWVQCLRLFKTKFSPN--SLDDA-----------PTSTNL----ETLTGNND- 535
           + Y ++ +W +CL L  +KF+ +  S+D+            PT+ N          +ND 
Sbjct: 488 QNYRVDPNWQKCLELINSKFNSSNISMDEKMEEDVAIGTVNPTNENYVDEKRKTNASNDM 547

Query: 536 ---SMYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRINL---------KIISSLYWQYDM 583
               + +  I+VML D+R S+K + Q+    EL NR  L         K IS LYW Y+ 
Sbjct: 548 EEIQISLNKIEVMLNDIRHSEKFSFQIS--SEL-NRYGLRSNNVGIKPKFISPLYWDYE- 603

Query: 584 KNEKRKTYYGLLNKMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTV 643
            NE     +   N  D+     + +Y+  Y  +  G  L+    +  IE++ +F D    
Sbjct: 604 DNELGVNNFLKENVFDEECTKAILQYASEYCSINKGFALHYCKGKEMIEVEISFNDGAIK 663

Query: 644 TCECTFENYMSICPFLENEGTSSYTLEELSIITSFGLEDLK----ISLKFWLDQKILYFD 699
                   Y  +  F  + G    T+E  SI+T+   +  K     +LKFW+++ +L ++
Sbjct: 664 GFLVNASQYYVLTLF--DTGNEKLTIE--SILTAGEAKRSKNEIIDALKFWVEKNVLVYE 719

Query: 700 GKTY 703
           G  Y
Sbjct: 720 GGYY 723

>Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGL193W
          Length = 689

 Score =  246 bits (627), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 192/696 (27%), Positives = 341/696 (48%), Gaps = 67/696 (9%)

Query: 36  NPNDPKSNHQLKPPTXXXXXXXXXXXXDVNTLGDYDSIETLNSLLRYYYIFQVRLNFFSN 95
           NPND  +NHQ++ P+            D     D + +  L  LLR + + Q+R +FF N
Sbjct: 37  NPNDDHNNHQMRLPSLRIKNSIKLLKLD-----DAEQVFLL-QLLRQWTLSQLRYHFFHN 90

Query: 96  LQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRL 155
            +S+  +KD+++LE+YYEFP+ +V +F         EL  +R YLL  N TFR+N+ +R+
Sbjct: 91  WESLMQYKDMLRLERYYEFPLKYVGLFTAEEL--SNELIGLRKYLLNRNSTFRNNMESRI 148

Query: 156 KKLV-KEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKITMYADKQFTNAWSQRFII 214
           + L+ +EDDF+++ ++ KW  +     +   + +++ L +KI ++   +      Q+ +I
Sbjct: 149 RVLILEEDDFEMSSKLYKWMVQGLGHPMV--KFVIDLLTNKIELFCKSRMEGNVDQKHVI 206

Query: 215 METYNKFINKYWSNFAVLLNCA-EDDHEITKVLYKYFEKQFLRIRSEEIFDICVISYPDS 273
            E +N FI+K W+ F  LL    EDD E+  ++Y+ FE +F+ ++++E+FD  +  +P S
Sbjct: 207 EEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCFENKFIEMKTKELFDEIIPKFPLS 266

Query: 274 KPTIMELRGLLTQSKISTNILIRLLSE----FQLKVLNLSIPTCTILIAYIKTVKSLLIL 329
           KP+++E++ ++   K +T  L RL+++    F  ++L  S+ T  IL+ Y+K +K L+++
Sbjct: 267 KPSLLEMKSVI---KGATEELDRLVAQICNDFHSELLIPSVTTIEILLYYVKAIKCLMVV 323

Query: 330 DPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPIVKVDQNXXXXXXXXX 389
           DPT R +  FT    P ++++SD+I  +L AIL+L  D+I                    
Sbjct: 324 DPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTKDEIHEVISKNTLTENPQLLDQLS 383

Query: 390 XXXHFGINLNFSDVDISDNLENGNNNKNISQLDYAGQESSQLLYSQILNRALTWLPE--- 446
                   LNF  V            K+ + +    QE    L  Q L     W PE   
Sbjct: 384 KELKNSTALNFHSV---------TTIKSKAAIYSVAQERQNPLVKQFLE----WTPEPGP 430

Query: 447 -----SKLV---SPNKSIKMMRKKNLLDILFAIFDDHELFLKRFVELLKQKLFVIKGYNL 498
                SKL    + + +  +   K++L+++F +FD  E+ +  F++L+   +  ++GY L
Sbjct: 431 FNEDISKLGNNDTDDTTETLELPKDVLEVVFQVFDSPEILINEFIKLITNHMLQMEGYIL 490

Query: 499 EESWVQCLRLFKTKFSPNSLDDAPTSTNLETLTGNNDSMYMTNIDVMLWDMRGSKKLTEQ 558
              W Q L+    K+  N         N + L    +   + N+ VM  D+  S      
Sbjct: 491 SAKWSQLLKTLMKKYFKN---------NKQVLKSICEESNLVNVFVMWSDLEKSASFQNW 541

Query: 559 MHLIDELDNRINLKIISSLYWQYDMKNEKRKTYYG--LLNKMDQTLFNQLDKYSKLYSRL 616
              +  + + +  KIIS LYW+       RK+ YG   ++     +F Q++K  ++ S  
Sbjct: 542 STKLQLIPSNVYPKIISYLYWKIS-----RKSLYGDYRISSALAIIFQQMEKAFEMKS-- 594

Query: 617 KPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMSICPFLE-NEGTSSYTLEELSII 675
            PGR L    DQ T+EI   F+D R  + + +   Y  I  F +   G  +  + + + +
Sbjct: 595 -PGRKLRFQNDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQKVPRGLRTADIVQQTDM 653

Query: 676 TSFGLEDLKISLKFWLDQKILYFDG-KTYRPLEYLD 710
               +E +   +++W  + +LY  G   YR LE  D
Sbjct: 654 AQHHVEAI---VQYWCQEHVLYSTGDDCYRILERAD 686

>AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR127C (APC2)
          Length = 709

 Score =  243 bits (621), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 171/679 (25%), Positives = 321/679 (47%), Gaps = 57/679 (8%)

Query: 36  NPNDPKSNHQLKPPTXXXXXXXXXXXXDVNTLGDYDSIETLNSLLRYYYIFQVRLNFFSN 95
           +PND  +NHQ++PP+                 G      T   LLR   + Q+R +FF +
Sbjct: 37  DPNDDHNNHQMRPPSLRIKNSIRLLRLGEQAPG------TTVGLLRQCAVSQMRQHFFRH 90

Query: 96  LQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRL 155
            + +  + D++KLE+YYEFP+ +V +F  +      EL  +R YLL  N  FR+N+  R+
Sbjct: 91  WERLEQYTDMVKLERYYEFPLRYVAVFTEDEV--AAELVGLRKYLLNGNPGFRANMEARI 148

Query: 156 KKLV-KEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKITMYADKQFTNAWSQRFII 214
           + L+ ++DDF+ A  + KW  +     +   + ++  L  KI ++   +      QR++I
Sbjct: 149 RALILQDDDFETAARLYKWIVQGLGHPMV--KFVIEVLTQKIALFCRNRMDGNVDQRYLI 206

Query: 215 METYNKFINKYWSNFAVLLN-CAEDDHEITKVLYKYFEKQFLRIRSEEIFDICVISYPDS 273
           ME +N FI + W+ F  LL     DD E+  ++Y+ FEK+F+ ++++E+F   +  +P S
Sbjct: 207 MEVFNSFIARCWAQFIQLLQFPTADDPELNNLIYRCFEKKFIELKTQELFHQIIPKFPMS 266

Query: 274 KPTIMELRGLLTQSKISTNILI-RLLSEFQLKVLNLSIPTCTILIAYIKTVKSLLILDPT 332
           KP ++E++ ++       + L+ ++ ++F  ++L  S+ T  IL+ Y+KT+K L+++DPT
Sbjct: 267 KPALLEMKSVIKGDTAELDRLVAQIYNDFHKELLVPSVTTVEILLYYVKTIKCLMVVDPT 326

Query: 333 SRYLQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPIVKVDQNXXXXXXXXXXXX 392
            R +  FTS   P ++++SD+I  +L AIL+L +D+I       + +N            
Sbjct: 327 GRSMNRFTSKLKPKIKERSDLIISVLCAILELDSDEIHE----VISKN--TLTENPQLLS 380

Query: 393 HFGINLNFSDVDISDNLENGNNNKNISQLDYAGQESSQLLYSQILNRALTWLPESKLVSP 452
                L  S      ++        I  + +  Q+       Q++ + L W PE    + 
Sbjct: 381 QLSKELKNSTALTFHSMSTSKGKAAIYSVAFERQD-------QLVKQFLEWTPEPGPFTA 433

Query: 453 NKSIKMMR----------KKNLLDILFAIFDDHELFLKRFVELLKQKLFVIKGYNLEESW 502
           + +  +             K++L+++F +FD  E+ +  F++L+   +  + GY L   W
Sbjct: 434 DDAKALNSDDDGAETLELPKDVLEVVFQVFDSPEVLINEFIQLVTNHMLQMDGYVLNAKW 493

Query: 503 VQCLRLFKTKFSPNSLDDAPTSTNLETLTGNNDSMYMTNIDVMLWDMRGSKKLTEQMHLI 562
            Q L+    K+  N         N + L    +   + N+ VM  D+  S         +
Sbjct: 494 SQLLKTVMKKYFKN---------NKQVLKSMCEESNLVNVFVMWSDLEKSATFQTWSTKL 544

Query: 563 DELDNRINLKIISSLYWQYDMKNEKRKTYYG--LLNKMDQTLFNQLDKYSKLYSRLKPGR 620
             +   +  KIIS LYW+       R++ YG   +      +F+Q++   K +    PGR
Sbjct: 545 QLVPPNVYPKIISYLYWKIG-----RRSPYGDYAVAPGLAAIFDQME---KAFETRSPGR 596

Query: 621 VLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMSICPFLENEGTSSYTLEELSIITSFGL 680
            L    DQ ++++   FED R  +   +   Y  I  F       S T  +++  T+   
Sbjct: 597 KLRFQKDQGSVDLQLVFEDGRHWSSRVSLPKYTVIDLFQRQACPLSVT--DIAAHTNMSP 654

Query: 681 EDLKISLKFWLDQKILYFD 699
             ++  ++FW  + +L+ +
Sbjct: 655 RLVEDIIQFWCHEHVLHLN 673

>NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.321
           YLR127C
          Length = 911

 Score =  203 bits (516), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 221/877 (25%), Positives = 411/877 (46%), Gaps = 125/877 (14%)

Query: 64  VNTLGDYDSIETLNSLLRYYYIFQVRLNFFSN--LQSITYFKDIIKLEKYYEFPILHVPI 121
           V+T G  D I  L    + YY F ++L+F  +   +++T  ++  KLE  Y  P+     
Sbjct: 62  VSTYGKDDQIRLL---FKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFTYD 118

Query: 122 FLNNNYIWETELNKIRHYLLRTNLTFRSNLINRLKKL-VKEDDFDLA------QEIIKWS 174
            ++ N + ++ +N  + YL+  N TFR N+++ ++ L + ED F+         EI+ W 
Sbjct: 119 LIDTNEM-QSLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWL 177

Query: 175 NEANFSLLSSKQIILNALLDKITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLN 234
           N+AN ++ S   ++L+ LL KI  +  ++    W+ RFIIME +N FIN+YW   + L +
Sbjct: 178 NDANGNV-SPIDLLLDLLLRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFH 236

Query: 235 C-------AEDDHEITKVLYKYFEKQFLRIRSEEIFDICVISYPDSKPTIMELRGLLTQS 287
                    E+DH +T ++Y +F +QF++IR  E   I V ++P S PTI+EL+ +L  S
Sbjct: 237 HQQFDYGDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITS 296

Query: 288 KI--------------STNI--------LIRLLSEFQLKVLNLSIPTCTILIAYIKTVKS 325
            +               TN+        + + L +FQ K LN  IPT  ++ A +K   S
Sbjct: 297 SMPRENVSTTATTTFRDTNLSEEYLKLFVKKFLKDFQRKFLNPCIPTIPLIRALVKMTNS 356

Query: 326 LLILDPTSRYLQSFTSFTNPYLQQK-SDIIYILLFAILDLRTDDI--------------- 369
            LILDP  + L +      P +Q++ +DI+ ILL+A+L+L   ++               
Sbjct: 357 FLILDPRGQLLTTIILTLKPLIQRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFN 416

Query: 370 ----KTNPIVKVDQNXXXXXXXXXXXXHFGINLNFSDVDISDN---LENGNNNKNISQLD 422
               +  P +    N              G     S+  I+++    +N  +  N + ++
Sbjct: 417 ILVSELYPTIIKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQNVKDMANANTME 476

Query: 423 Y-AGQESSQLLYSQILNRALTWLP---------ESKLVSPNKSIKMMRKKNLLDILFAIF 472
           Y A ++     +  +  + L W+P             V  ++    +R ++ +D LF  F
Sbjct: 477 YLARRKPETKPFFDLFKQYLEWVPPMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFF 536

Query: 473 DDHELFLKRFVELLKQKLFVIKG-YNLEESWVQCLRLFKTKFSPNSLDDAPTSTNLETLT 531
           D  +L L  +++LL +K    K  Y L+ +W+ CL L K K + +++ D    + + T  
Sbjct: 537 DSIDLLLSEYLKLLTEKFIHSKNYYTLDNNWLWCLNLLKEKSNSSNVPDENVKSTINT-- 594

Query: 532 GNNDSMYMTNIDVMLWDMRGS------KKLTEQMHLIDELDNRINLKIISSLYWQYDMKN 585
                     ID+ML DM+ S      KK T++ +++ + D     K +S LYW+ +  N
Sbjct: 595 ----------IDIMLNDMKRSASYGKDKKHTKENNMV-QGDIGFYPKEVSKLYWKINSTN 643

Query: 586 ------EKRKTYYGLLNKMDQTLFNQ-LD-KYSKLYSRL-KPGRVLNLLTDQSTIEIDFN 636
                   +  ++ LL        N  +D K ++ ++ L + G+ + L  D+S +E+  +
Sbjct: 644 IAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFFNELGRKGKKMELYKDKSLMEMKIS 703

Query: 637 FEDNRTVTCE-CTFENYMSICPFLENEGTSSYTLEELSIITSF---GLEDLKISLKFWLD 692
           F+D R +  +  T E Y  +  F   +G +++TLE+     S    G + L+  ++FW+D
Sbjct: 704 FDDGRELFFDNITIEQYDVLSLFTVEKG-AAFTLEKAYDFFSGLKRGKQKLEECIQFWVD 762

Query: 693 QKILYF--DGKTYRPLEYLDRSEIIIESPESNNVNSVMSITNNPLNGFAILGKGNDTIDR 750
           +K+LY   D   Y+ LE   R   + E  +   +     I ++     A +G  +D +  
Sbjct: 763 KKVLYLDDDDGCYKVLE---RLTFLDEIKQRKKMQEETVIKSD-----ARMGIDHDYVQE 814

Query: 751 PSQENITKCTPDHDKTFNATSQEVS----KIKEYVLSILTNLGEQNIEKLYNVLQ-TTSH 805
            ++++       H    +  + E+     +I  ++  +L NLG   +EK+++ L+ T   
Sbjct: 815 AAEDDDIAGFETHKDVISRANDEIKNILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPR 874

Query: 806 DTAIKKVSSVTLENIVTELVENGQILCLPNGLYQLPE 842
           D    +++   LEN +  LVE+ ++    +G ++ P+
Sbjct: 875 DFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFKKPK 911

>KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]
           {ON} weakly similar to uniprot|Q7LGV7 Saccharomyces
           cerevisiae YLR127C
          Length = 697

 Score =  176 bits (447), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 166/660 (25%), Positives = 289/660 (43%), Gaps = 69/660 (10%)

Query: 72  SIETLNSLLRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIW-E 130
           S E    L+  YY+  +R +FF     I  +KD+IKLEK Y   I  V      +  W +
Sbjct: 58  SDERTRFLIEQYYLTLIRTHFFLQFDDIVNWKDMIKLEKLY---ISKVEFMFGTSVYWIK 114

Query: 131 TELNKIRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILN 190
            E+   +  L++ N  FR  L  +L+  + ++D     ++ +W   A       ++I  N
Sbjct: 115 EEMISFKRLLMKKNNEFRKQLHAKLESHILDNDLVRFDQMYQWLAPA----FDGQEIEFN 170

Query: 191 ALLD--KITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDHEITKVLYK 248
             +   K+   + K   N    R+++M TYN FI  +WS F+ LL   EDDHE+T ++Y+
Sbjct: 171 VRIINLKVDQMSQKLMKNKIDDRYLVMNTYNHFIKDFWSKFSKLL-IIEDDHELTAIIYQ 229

Query: 249 YFEKQFLRIRSEEIFDICVISYPDSKPTIMELRGLLTQ--SKISTNILIRLLSEFQLKVL 306
            FEK +++ + +E +   V  +P S+  ++ELR +L +    + T +L  L   F  + L
Sbjct: 230 SFEKNYIKYKCDEFYTDIVPKFPASRKCLLELRSILNKDIKTVGTKVLETLYHGFVSRFL 289

Query: 307 NLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDLRT 366
             S+ TC IL  YIKTVK L I+DP    L+S +     YL  + DII  LL  I     
Sbjct: 290 TSSLLTCEILYYYIKTVKCLKIIDPMGICLRSLSKAVRVYLNPRPDIIKTLLLGIFPF-- 347

Query: 367 DDIKTNPIVKVDQNXXXXXXXXXXXXHFGINLNFSDVDISDNLENG---NNNKNISQLDY 423
              + N   K+  +             F   +   D  +   L       N  ++ +  Y
Sbjct: 348 ---QNNERFKIASSTDGSSVHLEKLEQFSREV--GDFSMGPELPTALPWFNQPHLPRCTY 402

Query: 424 AGQESSQLLYSQILNRALTWLPESKLVS------PNKSIKMMRKKNLLDILFAIFDDHEL 477
            G +       Q+L + L W+PE   +        +   K +   +L+ +L  + +    
Sbjct: 403 DGDD-------QLLKQYLNWVPEPPRIKLDVEDFADNDGKYVPPVDLIHVLLDVLESKRT 455

Query: 478 FLKRFVELLKQKLFVIKGYNLEESWVQCLRLFKTKFSPNSLDDAPTSTNLETLTGNNDSM 537
            +   + ++  K    + Y+L+  W + + +       N L+     T     +   D  
Sbjct: 456 LVDDLLGVVSGKFIESEEYSLDPEWQRIMDIIL-----NHLEGTRKGT---VTSEEADLT 507

Query: 538 YMTNIDVMLWDMRGSKKLTEQMHLID--ELDNRINLKIISSLYWQY--DMKNEKRKTYYG 593
           ++ ++D+ML D+R S +   Q+   +    +N  ++KI+S LYW++  ++      T Y 
Sbjct: 508 HLNDVDIMLEDLRLSSQFRNQVAHKNNSHFENFPHIKILSKLYWRHYQNLNGRLVTTKY- 566

Query: 594 LLNKMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQST-IEIDFNFEDNRTVTCECTFENY 652
              K D  +   + K +K+Y RL  GR L   T  S+ + I+   +       + T E Y
Sbjct: 567 ---KWDSEMEPLIQKLTKVYERLNTGRTLKFDTGSSSRVSINIVTKSGERRFFKVTMEQY 623

Query: 653 MSICPFL-ENEGTSS---------------YTLEELSIITSFGLEDLKISLKFWLDQKIL 696
           + I  F  E  G ++               YTL++L  +TS   + +   L FW  ++I+
Sbjct: 624 LVISHFQNETNGRNAPGMMADCNYVIPERRYTLKDLHKMTSMPRQKILDILSFWQQKEIV 683

>TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {ON}
           Anc_5.162 YJL013C
          Length = 994

 Score = 35.8 bits (81), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 76/175 (43%), Gaps = 25/175 (14%)

Query: 143 TNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKITMYADK 202
           T + F   L+  L+ +  +D F+L  + I W N A     SSKQ  +  +L++  MY   
Sbjct: 50  TRIAFERRLLEELEDM--DDPFELFMDYITWINHAYPQGGSSKQSGMLDVLERCLMY--- 104

Query: 203 QFTNAWSQRFIIMETY--NKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLRIRSE 260
                       METY  +  + K W  +  L   A D  +  K +Y Y  ++  RI S+
Sbjct: 105 ---------LRDMETYRNDPRLLKLWLWYIELF--AADSAQQAKEIYTYMLRK--RIGSK 151

Query: 261 -----EIFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSEFQLKVLNLSI 310
                E F   +      K  +  +R  + ++    N L++ + +FQ ++ N++I
Sbjct: 152 LSLFYESFATLLFEMGKYKEAVYIMRMGINENARPQNRLLKRMDDFQARLRNMNI 206

>Suva_16.267 Chr16 (467433..468662) [1230 bp, 409 aa] {ON} YPL048W
           (REAL)
          Length = 409

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 113 EFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIK 172
           +FP+  VP F+  N    TE   I +YL++  L+    +  +L  L  EDD +   +II+
Sbjct: 43  DFPLKKVPAFVGPNGFKLTEAMAINYYLVK--LSRDEKMKAQL--LGAEDDLNAQAQIIR 98

Query: 173 WSNEAN 178
           W + AN
Sbjct: 99  WQSLAN 104

>TPHA0C01680 Chr3 (388203..389447) [1245 bp, 414 aa] {ON} Anc_8.498
           YPL048W
          Length = 414

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 7/80 (8%)

Query: 113 EFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIK 172
           +FP+  +P F++N  +  +E   +  YL+  NL     +  +L  L   DDF    +I++
Sbjct: 43  QFPLKKLPAFVDNTGVRLSEQLAVDFYLI--NLADNQEIKTQL--LGNPDDFRTQSQILR 98

Query: 173 WSNEANFSLLSSKQIILNAL 192
           W++  N  LLS   I+L+A 
Sbjct: 99  WASLGNSDLLS---IMLSAF 115

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 92,777,069
Number of extensions: 4329972
Number of successful extensions: 17950
Number of sequences better than 10.0: 100
Number of HSP's gapped: 18493
Number of HSP's successfully gapped: 108
Length of query: 842
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 724
Effective length of database: 39,950,811
Effective search space: 28924387164
Effective search space used: 28924387164
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)