Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C008208.322ON26626614080.0
TDEL0F044808.322ON2602636153e-79
Kpol_1036.688.322ON2562666153e-79
YLR128W (DCN1)8.322ON2692635791e-73
KAFR0H022708.322ON2682705678e-72
CAGL0M04257g8.322ON2732725555e-70
SAKL0H15576g8.322ON2822595566e-70
TBLA0A039308.322ON2662735252e-65
NDAI0G025908.322ON2862945158e-64
Kwal_56.239148.322ON2652645032e-62
ZYRO0F10362g8.322ON2512664911e-60
KLTH0G12320g8.322ON2542514711e-57
KLLA0D16346g8.322ON3012674612e-55
KNAG0G024408.322ON2652684521e-54
AGL194C8.322ON2562634484e-54
Suva_10.2218.322ON1781774354e-53
Skud_12.1978.322ON1791784285e-52
Ecym_42538.322ON2582604233e-50
NCAS0C032708.322ON1841844084e-49
Smik_12.1918.322ON1251242801e-30
ABR211C7.377ON38946800.10
CAGL0M09130g7.461ON112594780.29
CAGL0M06765g2.296ON28082730.73
CAGL0A04345g7.377ON39241721.0
Kpol_1003.452.296ON28045711.2
KLLA0A07293g3.55ON58357702.3
KLTH0G10626g2.296ON30380692.5
NCAS0E026907.377ON39837683.8
Suva_12.1777.461ON114886684.3
TPHA0E005607.461ON110678675.7
SAKL0F14080g7.461ON111687676.3
KLLA0E08581g2.296ON27477657.1
Skud_10.3117.461ON114979668.1
TBLA0I024907.461ON118378668.5
TDEL0G003905.16ON54836658.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C00820
         (266 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 ...   546   0.0  
TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa...   241   3e-79
Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 ...   241   3e-79
YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {...   227   1e-73
KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON...   223   8e-72
CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} simila...   218   5e-70
SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa] ...   218   6e-70
TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.32...   206   2e-65
NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON...   202   8e-64
Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W...   198   2e-62
ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 a...   193   1e-60
KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315) ...   186   1e-57
KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 3...   182   2e-55
KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.32...   178   1e-54
AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, ...   177   4e-54
Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W...   172   4e-53
Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W...   169   5e-52
Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa] ...   167   3e-50
NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON...   161   4e-49
Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W...   112   1e-30
ABR211C Chr2 complement(800856..802025) [1170 bp, 389 aa] {ON} S...    35   0.10 
CAGL0M09130g Chr13 (914811..918188) [3378 bp, 1125 aa] {ON} simi...    35   0.29 
CAGL0M06765g Chr13 (690036..690878) [843 bp, 280 aa] {ON} simila...    33   0.73 
CAGL0A04345g Chr1 complement(429936..431114) [1179 bp, 392 aa] {...    32   1.0  
Kpol_1003.45 s1003 (106636..107478) [843 bp, 280 aa] {ON} (10663...    32   1.2  
KLLA0A07293g Chr1 (652702..654453) [1752 bp, 583 aa] {ON} weakly...    32   2.3  
KLTH0G10626g Chr7 (896733..897644) [912 bp, 303 aa] {ON} similar...    31   2.5  
NCAS0E02690 Chr5 (537047..538243) [1197 bp, 398 aa] {ON} Anc_7.3...    31   3.8  
Suva_12.177 Chr12 complement(269120..272566) [3447 bp, 1148 aa] ...    31   4.3  
TPHA0E00560 Chr5 (96958..100278) [3321 bp, 1106 aa] {ON} Anc_7.4...    30   5.7  
SAKL0F14080g Chr6 complement(1120568..1123918) [3351 bp, 1116 aa...    30   6.3  
KLLA0E08581g Chr5 (768795..769619) [825 bp, 274 aa] {ON} similar...    30   7.1  
Skud_10.311 Chr10 complement(548246..551695) [3450 bp, 1149 aa] ...    30   8.1  
TBLA0I02490 Chr9 complement(570577..574128) [3552 bp, 1183 aa] {...    30   8.5  
TDEL0G00390 Chr7 complement(80116..81762) [1647 bp, 548 aa] {ON}...    30   8.7  

>TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 bp,
           266 aa] {ON} Anc_8.322 YLR128W
          Length = 266

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/266 (100%), Positives = 266/266 (100%)

Query: 1   MDSIVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPREYPAELIEL 60
           MDSIVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPREYPAELIEL
Sbjct: 1   MDSIVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPREYPAELIEL 60

Query: 61  FERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCIT 120
           FERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCIT
Sbjct: 61  FERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCIT 120

Query: 121 RNQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDT 180
           RNQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDT
Sbjct: 121 RNQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDT 180

Query: 181 AKEYWKLFFGDGTPLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFKD 240
           AKEYWKLFFGDGTPLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFKD
Sbjct: 181 AKEYWKLFFGDGTPLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFKD 240

Query: 241 EYDPMDPWPYIMDEYHEYLEENGKLN 266
           EYDPMDPWPYIMDEYHEYLEENGKLN
Sbjct: 241 EYDPMDPWPYIMDEYHEYLEENGKLN 266

>TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa]
           {ON} Anc_8.322 YLR128W
          Length = 260

 Score =  241 bits (615), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 115/263 (43%), Positives = 166/263 (63%), Gaps = 12/263 (4%)

Query: 2   DSIVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHD--VPREYPAELIE 59
           D +V EF  LT   +K A+ +L  N W L YALN++YDQ  GGF+ +   P  YP EL+ 
Sbjct: 5   DDLVSEFVSLTQCESKTAKDFLRRNQWKLEYALNDYYDQMPGGFIEEPHTPVTYPEELLA 64

Query: 60  LFERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCI 119
           L+++Y            E+   ID DG+IQ IEDL Y+LEDL T+CLA ++ C  L D I
Sbjct: 65  LYDKY----------VLEDQNKIDIDGMIQLIEDLDYKLEDLVTICLAKLLHCTRLADGI 114

Query: 120 TRNQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQID 179
           +++QFL  WY + CS +  ++  L+ +   L +D+ Y T IYNY+F L  ++N + +  D
Sbjct: 115 SKDQFLHNWYMQGCSTLPQMRHVLDDLDTKLHTDLEYMTDIYNYTFDLALDQNKRDLDTD 174

Query: 180 TAKEYWKLFFGDGTPLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFK 239
           TA EYW+LFF  GT +H+    L++W  FL    K  +T+D WKM+LEFFK+FP+++  K
Sbjct: 175 TAAEYWRLFFQPGTAVHVNPALLNSWLAFLDSEQKTVVTRDTWKMLLEFFKQFPSLSAVK 234

Query: 240 DEYDPMDPWPYIMDEYHEYLEEN 262
             Y+  D WPYI+DEY+EYLE++
Sbjct: 235 TSYNEADAWPYIIDEYYEYLEDS 257

>Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 aa]
           {ON} (188159..188161,188259..189026) [771 nt, 257 aa]
          Length = 256

 Score =  241 bits (615), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 126/266 (47%), Positives = 180/266 (67%), Gaps = 11/266 (4%)

Query: 1   MDSIVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGF-VHDVPREYPAELIE 59
           M  I  EF  LT+   KVA KYL  N+WNLNYALNE+YD+E+G F V +   EYP ELI+
Sbjct: 1   MPDITEEFIGLTNCDKKVATKYLKRNNWNLNYALNEYYDKEVGSFLVEEEVIEYPEELIQ 60

Query: 60  LFERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCI 119
           +F++Y+N    +G S       ID DG IQ I DL Y+LED+ T+CLA +M C +L+  I
Sbjct: 61  IFKKYSND---NGES-------IDTDGFIQLINDLDYQLEDIVTICLAELMHCKSLSLPI 110

Query: 120 TRNQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQID 179
           T++QFL  WY + CS +K +K  L+ +   L++DI Y+T+IY YSF LI + N K I+ D
Sbjct: 111 TKDQFLSTWYEQGCSQLKHMKILLDDLDHKLQNDIRYYTHIYRYSFDLIRDSNEKCIEKD 170

Query: 180 TAKEYWKLFFGDGTPLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFK 239
            A EYWKLFF    P+ I + QL++W +F+ ++  ++IT+D W+ +LE+FKK+PT+    
Sbjct: 171 MAIEYWKLFFSSKCPITINELQLNSWIEFINVNEIESITRDVWERLLEYFKKYPTLEILS 230

Query: 240 DEYDPMDPWPYIMDEYHEYLEENGKL 265
             Y+ +DPWPYIMDEY+E+LE+  ++
Sbjct: 231 KNYNELDPWPYIMDEYYEFLEDTKRI 256

>YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {ON}
            DCN1Scaffold-type E3 ligase required for cullin
           neddylation and ubiquitin ligase activation; contains a
           ubiquitin-binding domain (UBA) for ubiquitin and Nedd8
           (Rub1p) interaction and a PONY domain involved in cullin
           binding and neddylation
          Length = 269

 Score =  227 bits (579), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 112/263 (42%), Positives = 161/263 (61%), Gaps = 17/263 (6%)

Query: 5   VREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDV-----PREYPAELIE 59
           +  F  LT    KV+RKYL  N WN+NYALN++YD+E+G F  +V     P  YP EL +
Sbjct: 18  IESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPVYPKELTQ 77

Query: 60  LFERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCI 119
           +FE Y N                D D L++FIE+LGY LEDL TLCLA+++G   L + +
Sbjct: 78  VFEHYINNNL------------FDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPL 125

Query: 120 TRNQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQID 179
            R  FL  W+ + CS I D+++ ++T+   L  D+ YFT IYNY+F LI + N K I  D
Sbjct: 126 KREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTD 185

Query: 180 TAKEYWKLFFGDGTPLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFK 239
              +YWKLFF    P+ +E + L+ W +FL   GK TI+KD W+M+L FFK++PT+ +  
Sbjct: 186 EGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKII 245

Query: 240 DEYDPMDPWPYIMDEYHEYLEEN 262
            +YD    WP+I+DE++E L++ 
Sbjct: 246 SDYDETAAWPFIIDEFYECLQDQ 268

>KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON}
           Anc_8.322 YLR128W
          Length = 268

 Score =  223 bits (567), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 166/270 (61%), Gaps = 20/270 (7%)

Query: 5   VREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPRE-----YPAELIE 59
           +  F   T     +ARKYLS N WN+NYALN+FYD ELGGF  +  R      YP EL++
Sbjct: 10  IVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAVYPKELVQ 69

Query: 60  LFERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCI 119
           LF  Y +           ED  ID  G+I+ I+D G  +EDL T+CLA+++   NL D I
Sbjct: 70  LFRDYCS-----------EDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKI 118

Query: 120 TRNQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMK--SIQ 177
            R+ FL+  + + C  + DIK  L+ + E L +D  YFT IYN+SFGLI +++ +  SI 
Sbjct: 119 YRDDFLQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSID 178

Query: 178 IDTAKEYWKLFFGDGT--PLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTV 235
           +D A EYWKLFF + +   + I  E L  W +FL    KK ++KD W+MILEFF+KF  +
Sbjct: 179 MDIAIEYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDL 238

Query: 236 TEFKDEYDPMDPWPYIMDEYHEYLEENGKL 265
              K+ YD  DPWP+++DE++EYL++ GKL
Sbjct: 239 ESLKESYDENDPWPFVIDEFYEYLQDTGKL 268

>CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} similar
           to uniprot|Q12395 Saccharomyces cerevisiae YLR128w
          Length = 273

 Score =  218 bits (555), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 122/272 (44%), Positives = 166/272 (61%), Gaps = 17/272 (6%)

Query: 4   IVREFQQLTSSSNK-VARKYLSGNDWNLNYALNEFYDQELGGFVHD-VPR---EYPAELI 58
           +++ FQ LTS +++  A++YLS N+WN+NYALNE+YD+E+GGF  D + R   +YP EL+
Sbjct: 9   LMKTFQSLTSCTDEGKAKRYLSANNWNINYALNEYYDKEVGGFTEDHMIRHQFKYPDELV 68

Query: 59  ELFERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDC 118
            LF  Y      DG+        I  DGLI +I+DLGY LEDL T+ LA+ + C NL + 
Sbjct: 69  SLFGHYAALIEEDGTQS------ITPDGLIDYIQDLGYNLEDLVTISLAHFLQCKNLENP 122

Query: 119 ITRNQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQI 178
           IT  QFL  WYN+ C  ++ ++  LE     L +D  YFT IYNYSF L        ++ 
Sbjct: 123 ITEKQFLYFWYNEGCYTLEQMRHYLEDCERKLCNDWKYFTTIYNYSFDL-NASKQGVVET 181

Query: 179 DTAKEYWKLFFGDGTP-----LHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFP 233
           D A EYWKLFF +        + +++  LD W KFL    KK I KD W+M+L FFKKFP
Sbjct: 182 DIAIEYWKLFFEENRTKLSGIIKVDQAHLDLWCKFLQDEHKKLIHKDTWQMLLLFFKKFP 241

Query: 234 TVTEFKDEYDPMDPWPYIMDEYHEYLEENGKL 265
           ++   K EY+  D WPY +DE++EYLEE   L
Sbjct: 242 SLDAIKTEYNEADAWPYTIDEFYEYLEERNVL 273

>SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 282

 Score =  218 bits (556), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 112/259 (43%), Positives = 158/259 (61%), Gaps = 13/259 (5%)

Query: 5   VREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPREYPAELIELFERY 64
           + EF  LT+ +   A KYLS N W L+YALNE+YD++ GGFV+  P +Y  EL+E F++Y
Sbjct: 30  INEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFVNKKPVKYSHELVETFDKY 89

Query: 65  NNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQF 124
            + K             I  + L+++IEDLGY LEDL T+CLA ++ C  +   IT  QF
Sbjct: 90  ADSKRC-----------ITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQF 138

Query: 125 LEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKEY 184
           L +W    C N+  +K EL+ + E L  D +YF++IYNY++ LI EE+ + + IDTA EY
Sbjct: 139 LSSWTEHGCKNMIHMKHELQDLEEQLHQDQDYFSHIYNYTYDLIVEESERHLNIDTAAEY 198

Query: 185 WKLFFGDGT-PLHIEKEQLDNWNKFLT-ISGKKTITKDEWKMILEFFKKFPTVTEFKDEY 242
           W+LFF +    + I   +L  W +F T  SG+ T+TKD W M L+F  KFP        Y
Sbjct: 199 WELFFHNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGY 258

Query: 243 DPMDPWPYIMDEYHEYLEE 261
           D MD WP + DEY+EY++E
Sbjct: 259 DEMDAWPLVFDEYYEYMDE 277

>TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.322
           YLR128W
          Length = 266

 Score =  206 bits (525), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 108/273 (39%), Positives = 163/273 (59%), Gaps = 20/273 (7%)

Query: 2   DSIVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGF-VHDVPR-------EY 53
           D  ++EF  L +S    A+KYL  N W L YALN+FYD E+G F + D+ R       EY
Sbjct: 5   DQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIEY 64

Query: 54  PAELIELFERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCN 113
              L EL+  Y     V G+           +GL++ ++DLGY ++ L TLCLA ++GC 
Sbjct: 65  VRPLTELYNHYAIDSGVLGT-----------EGLVKLVDDLGYTVDHLVTLCLAKLVGCI 113

Query: 114 NLTDCITRNQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENM 173
           + T  I  + F+++    KC +++DIK+ L      L+++  Y+T+IY+  F L+ EE  
Sbjct: 114 HFTTPILLSNFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGK 173

Query: 174 KSIQIDTAKEYWKLFFG-DGTPLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKF 232
           K+I  +TA+EYW LFF     P+ ++ +Q   W K+L+ +  K ITKD+W M+L FFKKF
Sbjct: 174 KTIDSETAQEYWDLFFACQNYPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKF 233

Query: 233 PTVTEFKDEYDPMDPWPYIMDEYHEYLEENGKL 265
           P+++E + +Y     WPYI DEY+EYLE+N K+
Sbjct: 234 PSLSELQRKYSEDSAWPYIFDEYYEYLEDNNKI 266

>NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON}
           Anc_8.322 YLR128W
          Length = 286

 Score =  202 bits (515), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 121/294 (41%), Positives = 165/294 (56%), Gaps = 54/294 (18%)

Query: 18  VARKYLSGNDWNLNYALNEFYDQELGGFVHD----------VP--REYPAELIELFERYN 65
           +A+KYLS N+W LNYALNE+YD+E+G F+ D          +P   +YP ELI LF++Y 
Sbjct: 1   MAKKYLSRNNWRLNYALNEYYDKEIGSFIGDDDDDDGCKTILPDLNKYPQELIALFKKY- 59

Query: 66  NQKYVDGSSGNEEDV--GIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQ 123
                  SS N + +   ID DGLI +I DL Y LEDL T+CLA ++ C NL D I + Q
Sbjct: 60  -------SSKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQ 112

Query: 124 FLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLI--------------- 168
           FL  WY + CS ++ ++  L  +   L  D +YFT IYNY+F LI               
Sbjct: 113 FLSNWYLQGCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNI 172

Query: 169 ----TEENMKSIQI-----------DTAKEYWKLFF--GDGTPLHIEKEQLDNWNKFLTI 211
               T  N  SI I           +TA  YWK+FF   +  P+ + KE L  W +FL  
Sbjct: 173 GDDTTNSNDTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNE 232

Query: 212 SGKKTITKDEWKMILEFFKKFPTVTEFKDEYDPMDPWPYIMDEYHEYLEENGKL 265
             KK ITKD+W+M+LEFFKKF  +   K  YD    WPY++DE++EYL++ G++
Sbjct: 233 ERKKEITKDQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286

>Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W -
           Hypothetical ORF [contig 171] FULL
          Length = 265

 Score =  198 bits (503), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 159/264 (60%), Gaps = 14/264 (5%)

Query: 2   DSIVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPREYPAELIELF 61
           D  V EF  LT  S K+A+++LS N+W L+YALN++YD   GGF  D  R Y  EL+++F
Sbjct: 12  DRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTD-DRPYSPELLKVF 70

Query: 62  ERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITR 121
           ++Y +          E+   I   GL +FIEDLG ELED  TLCLA +M C++L + I+ 
Sbjct: 71  QKYKS----------EDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISM 120

Query: 122 NQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTA 181
           + F+++W+++ C N  D+K  ++ + + LR+D++YF  IYNY+F L  E   K + ++T+
Sbjct: 121 DTFIQSWHDRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETS 180

Query: 182 KEYWKLFFGDGTP--LHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFK 239
             YW+L F    P  + + +E+L +W ++L+    K + +D WKM L+F   FP     K
Sbjct: 181 IAYWELLFSPAKPYAIKVPQERLQSWIQYLSGEVAK-VHRDVWKMFLKFAVAFPDNEALK 239

Query: 240 DEYDPMDPWPYIMDEYHEYLEENG 263
             Y   D WP ++DEY+EYL   G
Sbjct: 240 KGYSEDDAWPLVIDEYYEYLVARG 263

>ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 251

 Score =  193 bits (491), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 94/266 (35%), Positives = 157/266 (59%), Gaps = 16/266 (6%)

Query: 1   MDSIVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPREYPAELIEL 60
           M+++V  F+ L   S++ AR YL+ ++W++N ALN++YD E     HD  + Y  EL +L
Sbjct: 1   MENLVATFKSLAQCSDRTARDYLNTHNWDVNQALNDYYDSE-----HDQDQSYSPELPQL 55

Query: 61  FERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCIT 120
           F +Y        +        +D DGLI++I DLGYE+++L T+CLA ++ C  LTD IT
Sbjct: 56  FRKY--------AVVTPHGFIMDTDGLIRYIGDLGYEIDNLATICLAQLLHCQRLTDGIT 107

Query: 121 RNQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDT 180
             QF   W    C+++  +   ++ +   LR+D +Y   IYNY+F L  +   K+++  T
Sbjct: 108 EGQFSYNWQQNGCTSLHQMGKLVQRLDHKLRTDQDYTAQIYNYTFELALDPGAKTLETHT 167

Query: 181 AKEYWKLFFGDGT-PLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFK 239
           A +YW LFF  G  P+ +E++    W  F  +  +++I++D W+M+  FF +F  +   +
Sbjct: 168 AVQYWTLFFATGQYPVIVEQQFFQLWISF--VQQEQSISRDTWRMLFPFFNRFSNLQSVR 225

Query: 240 DEYDPMDPWPYIMDEYHEYLEENGKL 265
           D Y+  D WPYI+DE++EYL + G++
Sbjct: 226 DNYNEADAWPYIIDEFYEYLADKGEI 251

>KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315)
           [765 bp, 254 aa] {ON} similar to uniprot|Q12395
           Saccharomyces cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 254

 Score =  186 bits (471), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 100/251 (39%), Positives = 146/251 (58%), Gaps = 16/251 (6%)

Query: 5   VREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPREYPAELIELFERY 64
           + EF  LT +S   AR YLS N+W L YALN+FYD   GGF    P   P +L+ LF  Y
Sbjct: 6   IEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPP---PPQLLTLFNEY 62

Query: 65  NNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQF 124
                       EED  I  DGLI+FI DLG +LED TTLC+A+ M C +L+  +++  F
Sbjct: 63  KK---------GEEDT-ISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMF 112

Query: 125 LEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKEY 184
           ++ W++  C N++ IK++++ + E LR D  YF +IY++++ L  E N K + ++TA  Y
Sbjct: 113 VQGWHDNLCENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAY 172

Query: 185 WKLFFG-DGT-PLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFKDEY 242
           W L F  DG   + I +++L +W  FLT +  + I  D WKM L+F + FP     K  Y
Sbjct: 173 WHLLFPTDGAYAIQIPQKRLCSWTAFLTRNVSR-IHHDIWKMFLKFARMFPDNKTLKQGY 231

Query: 243 DPMDPWPYIMD 253
           +  D WP ++D
Sbjct: 232 NEDDAWPVLID 242

>KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 301
           aa] {ON} similar to uniprot|Q12395 Saccharomyces
           cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 301

 Score =  182 bits (461), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 157/267 (58%), Gaps = 20/267 (7%)

Query: 6   REFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQ--ELGGFVHDVPREYPAELIELFER 63
           +EF  LT  +  VA++YL  N   + YALN++YD    +GG    + + Y   L+ +FE+
Sbjct: 48  KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGG----MRQSYNPSLVAIFEK 103

Query: 64  YNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQ 123
           Y+N     G S  E     D+ GLI+FIEDLG  +ED  TLCL+ ++  ++LT  ++R Q
Sbjct: 104 YSN-----GVSATE----WDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQ 154

Query: 124 FLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKE 183
           FL AW +  C  ++ +K  L T+ E L +D +YF  IY+Y+F L T+E  + +  D A E
Sbjct: 155 FLNAWSDLCCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIE 214

Query: 184 YWKLFFGDGT-PLHIEKEQLDNWNKFL----TISGKKTITKDEWKMILEFFKKFPTVTEF 238
           YW +FF D    L I KE+L++W +F+    +   K+ I+ D W M  +F +++P     
Sbjct: 215 YWNIFFKDNKYALKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESL 274

Query: 239 KDEYDPMDPWPYIMDEYHEYLEENGKL 265
           K  YD M  WP ++DEY+E+LEEN KL
Sbjct: 275 KQNYDEMAAWPLLIDEYYEFLEENDKL 301

>KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.322
           YLR128W
          Length = 265

 Score =  178 bits (452), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 154/268 (57%), Gaps = 22/268 (8%)

Query: 5   VREFQQLTSSSN-KVARKYLSGNDWNLNYALNEFYDQELGGFVH---DVPRE---YPAEL 57
           + +F +LT   + K A +YL  + WN+NYALN+FYD+E+G F     DVP++   YP EL
Sbjct: 6   IHDFIELTQCRDRKKAERYLRESHWNVNYALNDFYDKEVGNFFSTYKDVPQDNVVYPPEL 65

Query: 58  IELFERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTD 117
           I +F++Y+            E   I  +G+I +I DL   ++DL T+CLA ++G  NL  
Sbjct: 66  IHVFDQYS------------EAGVITFEGMITYIGDLSLSIDDLVTICLAQLLGWENLLA 113

Query: 118 CITRNQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQ 177
            ITR QFL  W+ + CS I ++K  L  +   L  D  YF  IY Y+F L+ E +   + 
Sbjct: 114 PITREQFLAQWFLQGCSTINEMKTVLADLNGKLEKDRGYFKEIYMYTFPLLVEPDQNKLD 173

Query: 178 IDTAKEYWKLFFGDGT--PLHIEKEQLDNWNKFL-TISGKKTITKDEWKMILEFFKKFPT 234
             +  EYWKLFF      P+ I++E LD W  +L   S   ++T+D WKM+ +FF +F +
Sbjct: 174 AASTIEYWKLFFDQEKKYPMIIDQELLDPWFVYLGEQSENMSVTEDIWKMVYQFFNRFRS 233

Query: 235 VTEFKDEYDPMDPWPYIMDEYHEYLEEN 262
           + + K  YD M  WP ++DE+ EYL++ 
Sbjct: 234 LGDVKQGYDEMAAWPILIDEFIEYLQDT 261

>AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, 256
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR128W (DCN1); 1-intron
          Length = 256

 Score =  177 bits (448), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 91/263 (34%), Positives = 156/263 (59%), Gaps = 17/263 (6%)

Query: 4   IVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPREYPAELIELFER 63
           ++REF  +TS+++  A  YL  N W+L++AL++FY Q  GG       +Y AEL+  FER
Sbjct: 10  LIREFLAVTSATSAAAETYLERNHWSLDHALDDFYTQSGGG---GRAEQYSAELVATFER 66

Query: 64  YNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQ 123
           Y        ++G      +D + L++++ DLG++LED+ TLCLA ++    LT  I+R Q
Sbjct: 67  Y--------AAGG----AMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQ 114

Query: 124 FLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKE 183
           FL  W+   CS++ D++  ++ +   LR+D  YF  +Y Y+FGL  +   + + ++TA  
Sbjct: 115 FLSTWHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIA 174

Query: 184 YWKLFFGDGT-PLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFKDEY 242
           YW LFF D T  + +   +L +W +FL  +G  ++++D W M   F ++FP  TE  + Y
Sbjct: 175 YWSLFFLDHTYAVTVPAPRLRSWFEFLR-AGDHSVSRDTWDMFPRFAQRFPDDTELLEHY 233

Query: 243 DPMDPWPYIMDEYHEYLEENGKL 265
           + +  WP ++DEY+E+++   +L
Sbjct: 234 NELASWPLVIDEYYEWVKGRNQL 256

>Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W
           (REAL)
          Length = 178

 Score =  172 bits (435), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 79/177 (44%), Positives = 116/177 (65%)

Query: 85  DGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQFLEAWYNKKCSNIKDIKDELE 144
           D LI+FIEDLGY LEDL TLCL +++G   L + + R  FL AW+ + CS + ++K  ++
Sbjct: 2   DSLIKFIEDLGYNLEDLATLCLVHLLGYKKLEEPLDRETFLSAWFMQGCSTLPNMKKCVK 61

Query: 145 TVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKEYWKLFFGDGTPLHIEKEQLDN 204
            +   L  D+ YFT IY+Y+F LI + N K I  + A +YW L F    P+H+E   L+ 
Sbjct: 62  GLDAKLHEDLQYFTEIYDYTFHLILDTNRKDIDTEEAIQYWTLLFQPEYPIHMEPGLLEA 121

Query: 205 WNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFKDEYDPMDPWPYIMDEYHEYLEE 261
           W +FL   GK+TITKD W M+L+FFK++PT+    D+YD    WP+I+DE++E+L +
Sbjct: 122 WFRFLHDEGKRTITKDAWHMLLQFFKQYPTIRSIIDDYDEAAAWPFIIDEFYEFLRD 178

>Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W
           (REAL)
          Length = 179

 Score =  169 bits (428), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 116/178 (65%)

Query: 85  DGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQFLEAWYNKKCSNIKDIKDELE 144
           D L++FIEDLGY LEDL TLCL +++G  NL + + R  FL  W+ + CS + D++  ++
Sbjct: 2   DSLVKFIEDLGYSLEDLATLCLVDLLGYKNLEEPLKRETFLSTWFMQGCSTLPDMQGCIK 61

Query: 145 TVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKEYWKLFFGDGTPLHIEKEQLDN 204
            +   L  D+ Y+T +Y+Y+F LI + N K+I ID A +YW LFF    P+HIE   L++
Sbjct: 62  RLDVKLHEDLQYYTQVYDYAFRLILDSNRKNIDIDDAIQYWTLFFQPVYPVHIESNLLES 121

Query: 205 WNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFKDEYDPMDPWPYIMDEYHEYLEEN 262
           W  FL   GK  I+KD W M+L FF+++ T+    D YD    WP+I+DE++EYL+++
Sbjct: 122 WFHFLRDEGKTLISKDTWHMLLLFFQQYLTIQSIIDGYDETAAWPFIIDEFYEYLQDH 179

>Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa]
           {ON} similar to Ashbya gossypii AGL194C 1-intron
          Length = 258

 Score =  167 bits (423), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 141/260 (54%), Gaps = 15/260 (5%)

Query: 5   VREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPREYPAELIELFERY 64
           +++F  +TS +   A K+L+ N W+L+YAL++ Y +  G    +  R Y AEL   F+ Y
Sbjct: 11  IKQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTR--GTSYLNTERTYDAELYSTFQNY 68

Query: 65  NNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQF 124
            +           E+  +D D LI+++ DLGY+LED  T+CLA ++   NLT  I   QF
Sbjct: 69  AS-----------ENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQF 117

Query: 125 LEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKEY 184
           L  W +  CSN+ D+ + + T+   L  D  YF  IY+Y+F +  +   + + IDTA  Y
Sbjct: 118 LSTWADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISY 177

Query: 185 WKLFFGDGT-PLHIEKEQLDNWNKFLTISGKKT-ITKDEWKMILEFFKKFPTVTEFKDEY 242
           W L F D +    I + +L++W +FL        +T+D W M+ +F  KFP       EY
Sbjct: 178 WTLLFLDHSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEY 237

Query: 243 DPMDPWPYIMDEYHEYLEEN 262
             M  WP IMDEY+ +++E 
Sbjct: 238 SEMGAWPLIMDEYYGWIKER 257

>NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON}
           Anc_8.322 YLR128W
          Length = 184

 Score =  161 bits (408), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 119/184 (64%), Gaps = 4/184 (2%)

Query: 85  DGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQFLEAWYNKKCSNIKDIKDELE 144
           DGL+ ++ DLG +LEDL T+CL +++ C N+ D ITR+QFL  W+ + CS+I  +K  L 
Sbjct: 2   DGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLV 61

Query: 145 TVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKEYWKLFFGDGT---PLHIEKEQ 201
            + + L SD  YF  IYNY+FGLIT+ + K ++++TA  YWKLF        P+ ++   
Sbjct: 62  DLNDKLHSDKQYFIDIYNYTFGLITDPD-KDLEVETAVAYWKLFLQPKEGEFPVRVDPTL 120

Query: 202 LDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFKDEYDPMDPWPYIMDEYHEYLEE 261
           L+ W +FL    KK IT+D W M++ FF+KFP +   K+ YD    WPYI+DEY+EYL++
Sbjct: 121 LNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQD 180

Query: 262 NGKL 265
              +
Sbjct: 181 TNHI 184

>Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W
           (REAL)
          Length = 125

 Score =  112 bits (280), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 53/124 (42%), Positives = 80/124 (64%)

Query: 139 IKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKEYWKLFFGDGTPLHIE 198
           +++ ++ +   LR ++ YFT IYNY+F L+ +   K I I+   +YWKLFF    P+ IE
Sbjct: 1   MQECMKRLDIKLRQNLQYFTLIYNYTFHLLLDSYRKDIDINECIQYWKLFFRPEYPVSIE 60

Query: 199 KEQLDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFKDEYDPMDPWPYIMDEYHEY 258
           +  L+ W +FL   GK  I KD W+M+L FFKK+ TV E  D+YD    WP+I+DE++EY
Sbjct: 61  QNLLEAWFRFLHDEGKMMINKDTWQMLLVFFKKYSTVREIMDDYDESAAWPFIIDEFYEY 120

Query: 259 LEEN 262
           L++ 
Sbjct: 121 LQDQ 124

>ABR211C Chr2 complement(800856..802025) [1170 bp, 389 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YBL058W
          (SHP1)
          Length = 389

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 31/46 (67%), Gaps = 1/46 (2%)

Query: 2  DSIVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFY-DQELGGFV 46
          D  +++F  LT+SS +VARKYL  ++ +L  ALN FY +Q+  G V
Sbjct: 3  DEQIQQFMMLTNSSAEVARKYLGEHEDDLEDALNGFYANQQRPGSV 48

>CAGL0M09130g Chr13 (914811..918188) [3378 bp, 1125 aa] {ON} similar
           to uniprot|P24814 Saccharomyces cerevisiae YJR090c
           required for glucose repression and for glucose and
           cation transport
          Length = 1125

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 48/94 (51%), Gaps = 13/94 (13%)

Query: 89  QFIEDLGYELEDLTTLCLANVMGCNNLTD-----CITRNQFLEAWYNKKCSNIKDIKD-E 142
           +F  DL   +  L +L L ++ GC N+TD      +  +  L   +  KCS I D+    
Sbjct: 572 KFFLDLSKNVNQLPSLRLLDLSGCENITDKTIDRVVQLSPKLRNIFLGKCSRITDLSLFH 631

Query: 143 LETVGENLRSDINYFTYIYNYSFGLITEENMKSI 176
           L T+G+NL++   +F + +N     IT+  ++++
Sbjct: 632 LSTLGKNLQT--VHFGHCFN-----ITDRGVRAL 658

>CAGL0M06765g Chr13 (690036..690878) [843 bp, 280 aa] {ON} similar
           to uniprot|P53965 Saccharomyces cerevisiae YNL032w SIW14
          Length = 280

 Score = 32.7 bits (73), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 5/82 (6%)

Query: 49  VPREYPAELIELFERYNNQKYVDGSSGNEED-VGIDADGLIQFIE-DLGYELEDLTTLCL 106
           +P EYP E ++  E+ N + +  G SGN+E  V I +D L + +E  L  E + +   C 
Sbjct: 155 IPEEYPQENLDFMEKANIKLFQVGMSGNKEPFVNIPSDLLTKALEVVLNPENQPILIHCN 214

Query: 107 ANVMGCNNLTDCITRNQFLEAW 128
                   L  CI +   L++W
Sbjct: 215 RGKHRTGCLIGCIRK---LQSW 233

>CAGL0A04345g Chr1 complement(429936..431114) [1179 bp, 392 aa]
          {ON} similar to uniprot|P34223 Saccharomyces cerevisiae
          YBL058w SHP1
          Length = 392

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 2  DSIVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQEL 42
          D ++++F  LT  S  VAR+YL   D +L  ALN +Y  ++
Sbjct: 5  DKVIQQFMTLTDRSIDVAREYLEQYDNDLGGALNAYYASQM 45

>Kpol_1003.45 s1003 (106636..107478) [843 bp, 280 aa] {ON}
           (106636..107478) [843 nt, 281 aa]
          Length = 280

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 49  VPREYPAELIELFERYNNQKYVDGSSGNEED-VGIDADGLIQFIE 92
           +P EYP E +E  E+   + Y  G SGN+E  V I +D L + +E
Sbjct: 155 IPEEYPPENLEFLEKSGIRLYQVGMSGNKEPFVNIPSDLLTKALE 199

>KLLA0A07293g Chr1 (652702..654453) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|Q12348 Saccharomyces cerevisiae
           YOL117W RRI2 subunit of COP9 Signalosome (CSN) like
           protein complex that cleaves the ubiquitin-like protein
           Rub1 from Cdc53 COP9 signalosome (CSN) subunit
          Length = 583

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 173 MKSIQIDTAKEYWKL-------FFGDGTPLHIEKEQLDNWNKFLTISGKKTITKDEW 222
           MKSI  DTA  Y+KL       +FG+   + +  E+L+  N      G + I KDEW
Sbjct: 457 MKSIAKDTADVYYKLDLVEDYVYFGEEYFVPLRSEELNIVNPLSQQMGSEIIGKDEW 513

>KLTH0G10626g Chr7 (896733..897644) [912 bp, 303 aa] {ON} similar to
           uniprot|P53965 Saccharomyces cerevisiae YNL032W SIW14
           Tyrosine phosphatase that plays a role in actin filament
           organization and endocytosis localized to the cytoplasm
          Length = 303

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 36/80 (45%), Gaps = 8/80 (10%)

Query: 49  VPREYPAELIELFERYNNQKYVDGSSGNEED-VGIDADGLIQFIEDLGYELEDLTTLCLA 107
           +P EYP E +E   R   + +  G SGN+E  V I +D L   +E +    E+   L   
Sbjct: 178 IPEEYPQENLEFMARAGIKLFQFGMSGNKEPFVNIPSDLLTSALE-VAINPENHPVLIHC 236

Query: 108 N----VMGCNNLTDCITRNQ 123
           N      GC  L  CI R Q
Sbjct: 237 NRGKHRTGC--LVGCIRRLQ 254

>NCAS0E02690 Chr5 (537047..538243) [1197 bp, 398 aa] {ON}
          Anc_7.377 YBL058W
          Length = 398

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 24/37 (64%)

Query: 2  DSIVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFY 38
          D  +++F  LT+ S++ A +YL   D +LN A+N F+
Sbjct: 6  DEAIQQFMALTNGSHEQASQYLEQYDGDLNEAVNAFF 42

>Suva_12.177 Chr12 complement(269120..272566) [3447 bp, 1148 aa]
           {ON} YJR090C (REAL)
          Length = 1148

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 18/86 (20%)

Query: 90  FIEDLGYELEDLTTLCLANVMGCNNLTDCIT----------RNQFLEAWYNKKCSNIKDI 139
             ++L   ++D+ +L L ++ GC N+TD             RN FL      KCS I D+
Sbjct: 558 LFQELSKVVDDMPSLRLIDLSGCENITDKTIERIVDLAPKLRNVFL-----GKCSRITDV 612

Query: 140 KD-ELETVGENLRSDINYFTYIYNYS 164
              +L  +G+NL++   +F + +N +
Sbjct: 613 SLFQLSKLGKNLQTV--HFGHCFNIT 636

>TPHA0E00560 Chr5 (96958..100278) [3321 bp, 1106 aa] {ON} Anc_7.461
           YJR090C
          Length = 1106

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 43/78 (55%), Gaps = 8/78 (10%)

Query: 93  DLGYELEDLTTLCLANVMGCNNLTD-----CITRNQFLEAWYNKKCSNIKDIKD-ELETV 146
           ++  ++++L +L L ++ GC N+TD      ++    L   +  KCS I DI   +L  +
Sbjct: 556 EITKKIQNLPSLRLLDLSGCENITDKTIERVVSLAPKLRNVFLGKCSRITDISLFQLAKL 615

Query: 147 GENLRSDINYFTYIYNYS 164
           G+NL++   +F + +N +
Sbjct: 616 GKNLQTI--HFGHCFNIT 631

>SAKL0F14080g Chr6 complement(1120568..1123918) [3351 bp, 1116 aa]
           {ON} similar to uniprot|P24814 Saccharomyces cerevisiae
           YJR090C GRR1 F-box protein component of the SCF
           ubiquitin- ligase complex required for Cln1p and Cln2p
           degradation involved in carbon catabolite repression
           glucose-dependent divalent cation transport
           high-affinity glucose transport and morphogenesis
          Length = 1116

 Score = 30.4 bits (67), Expect = 6.3,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 18/87 (20%)

Query: 89  QFIEDLGYELEDLTTLCLANVMGCNNLTDCIT----------RNQFLEAWYNKKCSNIKD 138
           +F+ DL  +++ L  L L ++ GC N+TD             RN FL      KCS I D
Sbjct: 547 RFLMDLSQKIDHLPNLRLIDLCGCENITDRTIERLTSLAPKLRNVFL-----GKCSRITD 601

Query: 139 IK-DELETVGENLRSDINYFTYIYNYS 164
                L  +G+NL++   +F + +N +
Sbjct: 602 NSLTYLAKLGKNLQT--VHFGHCFNLT 626

>KLLA0E08581g Chr5 (768795..769619) [825 bp, 274 aa] {ON} similar to
           uniprot|P53965 Saccharomyces cerevisiae YNL032W SIW14
           Tyrosine phosphatase that plays a role in actin filament
           organization and endocytosis localized to the cytoplasm
          Length = 274

 Score = 29.6 bits (65), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 2/77 (2%)

Query: 49  VPREYPAELIELFERYNNQKYVDGSSGNEED-VGIDADGLIQFIE-DLGYELEDLTTLCL 106
           +P EYPAE ++  E    + +  G SGN+E  V I +D L + +E  L  E   +   C 
Sbjct: 149 IPEEYPAENMKFMEETGIKLFQVGMSGNKEPFVNIPSDLLTKALEVVLNPENHPILIHCN 208

Query: 107 ANVMGCNNLTDCITRNQ 123
                   L  CI + Q
Sbjct: 209 RGKHRTGCLVGCIRKLQ 225

>Skud_10.311 Chr10 complement(548246..551695) [3450 bp, 1149 aa]
           {ON} YJR090C (REAL)
          Length = 1149

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 42/79 (53%), Gaps = 8/79 (10%)

Query: 92  EDLGYELEDLTTLCLANVMGCNNLTD-----CITRNQFLEAWYNKKCSNIKDIKD-ELET 145
           ++L   ++D+ +L L ++ GC N+TD      +     L   +  KCS I D+   +L  
Sbjct: 561 QELFKVVDDMPSLRLIDLSGCENITDKTIERIVNLAPKLRNVFLGKCSRITDVSLFQLSK 620

Query: 146 VGENLRSDINYFTYIYNYS 164
           +G+NL++   +F + +N +
Sbjct: 621 LGKNLQTV--HFGHCFNIT 637

>TBLA0I02490 Chr9 complement(570577..574128) [3552 bp, 1183 aa] {ON}
           Anc_7.461 YJR090C
          Length = 1183

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 39/78 (50%), Gaps = 8/78 (10%)

Query: 93  DLGYELEDLTTLCLANVMGCNNLTD-----CITRNQFLEAWYNKKCSNIKDIK-DELETV 146
           D+   ++ L  L L ++ GC N+TD      +  +  L   +  KC+ I D+    L  +
Sbjct: 582 DIAKNVDQLPALRLLDLSGCENITDRTVERVVALSPKLRNVFLGKCNRITDLSLSHLSRL 641

Query: 147 GENLRSDINYFTYIYNYS 164
           G+NL++   +F + +N +
Sbjct: 642 GKNLQTV--HFGHCFNIT 657

>TDEL0G00390 Chr7 complement(80116..81762) [1647 bp, 548 aa] {ON}
           Anc_5.16 YGR278W
          Length = 548

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 148 ENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKE 183
           EN+R  INYFT I     G++TE+  K + +  AKE
Sbjct: 456 ENIRYSINYFTAI---GLGVLTEDMRKQLDLIQAKE 488

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,521,816
Number of extensions: 1658916
Number of successful extensions: 5904
Number of sequences better than 10.0: 81
Number of HSP's gapped: 6058
Number of HSP's successfully gapped: 81
Length of query: 266
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 158
Effective length of database: 41,097,471
Effective search space: 6493400418
Effective search space used: 6493400418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)