Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0C008108.324ON93793746830.0
Kpol_1036.698.324ON93693937610.0
NCAS0C032608.324ON98395536090.0
SAKL0H15532g8.324ON94194235530.0
NDAI0G025808.324ON95895735360.0
Suva_10.2228.324ON94394035310.0
Smik_12.1928.324ON94394235200.0
Skud_12.1988.324ON94394235020.0
TDEL0F045008.324ON93893934690.0
YLR129W (DIP2)8.324ON94394234640.0
TBLA0A039508.324ON93691634560.0
KLTH0G12276g8.324ON93793934470.0
ZYRO0F10406g8.324ON93893834240.0
Kwal_56.239208.324ON93793934110.0
KAFR0H022608.324ON93894433490.0
CAGL0M04279g8.324ON94094232820.0
KNAG0G024508.324ON94294232700.0
Ecym_42558.324ON93793832650.0
AGL196C8.324ON93593832590.0
KLLA0D16390g8.324ON93694229990.0
ZYRO0A09636g8.435ON8086563131e-28
YLR222C (UTP13)8.435ON8177023069e-28
NDAI0E034408.435ON8576082943e-26
Kwal_27.115858.435ON8236562908e-26
SAKL0H12760g8.435ON8411992756e-24
KNAG0A025108.435ON8492052675e-23
KLTH0E10120g8.435ON8262032667e-23
Ecym_41348.435ON8102072641e-22
Skud_12.2858.435ON8172002622e-22
TBLA0I025708.435ON8482062622e-22
KAFR0H017508.435ON7832052612e-22
TDEL0B020108.435ON8052672603e-22
NCAS0C027108.435ON8152002585e-22
AGR180W8.435ON8062392578e-22
TPHA0L010808.435ON8352072579e-22
Smik_12.2798.435ON8172002561e-21
Suva_10.3168.435ON8181992542e-21
Kpol_1031.498.435ON7602092532e-21
KLLA0F13244g8.435ON8142382523e-21
ZYRO0A12980g8.544ON8242542462e-20
AGL234W6.363ON6292792442e-20
KLLA0F10263g6.363ON6822752442e-20
NCAS0D047806.363ON6212762414e-20
CAGL0C00737g8.435ON8162632425e-20
Ecym_25236.363ON6462792389e-20
AEL246C8.544ON8152932391e-19
TPHA0M020006.363ON6992812352e-19
KNAG0A037008.544ON8172792363e-19
CAGL0C03608g6.363ON6432832343e-19
YCR084C (TUP1)6.363ON7132832353e-19
Skud_3.1566.363ON7132832344e-19
SAKL0H09988g8.544ON7492932344e-19
NDAI0C054908.544ON8592282328e-19
Smik_3.1836.363ON7092832319e-19
SAKL0A00660g6.363ON6602832272e-18
Kpol_1028.236.363ON7442832263e-18
TBLA0F042406.363ON7272742263e-18
KAFR0E031808.544ON8142272256e-18
SAKL0F15972g7.534ON4702622208e-18
KLTH0A07282g6.363ON7252842221e-17
Suva_3.1216.363ON7002632221e-17
TPHA0L016908.544ON8322172211e-17
TDEL0A077806.363ON6572842201e-17
Smik_2.3388.544ON8002162211e-17
KNAG0D002506.363ON6552862202e-17
KLTH0A00880g7.534ON4712452172e-17
YBR198C (TAF5)8.544ON7982162202e-17
Kwal_23.64296.363ON7502822202e-17
AEL269C7.534ON4552692162e-17
Skud_2.3248.544ON8022162183e-17
Ecym_70388.544ON8002932166e-17
NCAS0B022008.544ON8222832167e-17
CAGL0M05335g8.544ON8062292157e-17
Suva_4.4528.544ON8002162157e-17
TDEL0B030208.544ON8312612159e-17
TBLA0H036208.544ON8122172131e-16
NDAI0K023506.363ON7932292122e-16
Kpol_1013.377.534ON4682742092e-16
KLTH0E12606g8.544ON7552162122e-16
TBLA0F005206.363ON6632972112e-16
Kwal_27.120538.544ON7552162122e-16
CAGL0E00561g6.363ON8362802112e-16
Kpol_1024.428.544ON8432162103e-16
NCAS0A055206.363ON6712862094e-16
ZYRO0D17292g6.363ON7182832094e-16
KAFR0A005102.431ON3192261971e-15
KAFR0C047406.363ON6652842041e-15
KLTH0D04466g2.431ON3192111944e-15
NCAS0A151707.534ON4742801967e-15
Kwal_23.53517.534ON4742451959e-15
KLLA0E23453g8.544ON8262351962e-14
TPHA0I018808.544ON10342081934e-14
SAKL0A03872g6.239ON8782941925e-14
KLTH0H03608g6.239ON8752871916e-14
Ecym_28087.534ON4652441886e-14
ZYRO0D01122g7.534ON4662461887e-14
NCAS0F018502.431ON3182221831e-13
AFL118W6.239ON8322981891e-13
Suva_13.2952.431ON3192231812e-13
Skud_13.2752.431ON3192231812e-13
Smik_13.3052.431ON3192231812e-13
YMR116C (ASC1)2.431ON3192231812e-13
AFR199C2.431ON3342201812e-13
NDAI0H027102.431ON3182231803e-13
KNAG0F018406.239ON9112871863e-13
TBLA0A060606.239ON8882871853e-13
KNAG0F038707.534ON4652371833e-13
NCAS0A042702.431ON3182221794e-13
TPHA0I032407.534ON4772791824e-13
KNAG0E023102.431ON3192241785e-13
KAFR0B003707.534ON4612481815e-13
TPHA0G023802.431ON3182221775e-13
NDAI0B051901.247ON6681961792e-12
Kpol_1048.598.544ON8502171792e-12
Kpol_487.71.399ON3032331722e-12
AER263C6.340ON5134271762e-12
TBLA0E007607.534ON3841651742e-12
TPHA0G016108.672ON4141431752e-12
KAFR0A069906.239ON8852871772e-12
Skud_4.5305.631ON3382461723e-12
ZYRO0E07392g6.239ON8972871773e-12
Ecym_24986.340ON5424271753e-12
TDEL0E054806.239ON8812871763e-12
TDEL0H003707.534ON4652521743e-12
ZYRO0E04620g1.399ON3032321703e-12
Kpol_297.72.431ON3182231704e-12
YBL008W (HIR1)4.106ON8402161754e-12
NDAI0G038303.25ON5102101744e-12
NCAS0A034704.106ON8162251755e-12
CAGL0H08932g6.239ON9022901755e-12
TPHA0J025406.239ON8662901755e-12
TBLA0B091002.431ON3172221696e-12
Smik_4.5185.631ON3302341696e-12
Smik_7.1356.239ON8872941747e-12
CAGL0L03201g1.247ON5792201737e-12
Smik_2.1124.106ON8412161737e-12
KNAG0B016101.247ON6741701738e-12
TDEL0B059701.399ON3032321678e-12
KNAG0C062405.631ON3552601698e-12
KNAG0H016901.399ON3032531678e-12
Ecym_60982.431ON3182201688e-12
Suva_7.1276.239ON8912871739e-12
Skud_14.3211.399ON3032561679e-12
ZYRO0F07282g8.672ON4271551709e-12
Suva_14.3421.399ON3032561671e-11
KLTH0D11132g8.672ON4371871701e-11
CAGL0M08646g5.631ON3372411681e-11
KNAG0I028406.340ON5192821701e-11
SAKL0D08756g1.399ON3032321661e-11
SAKL0E03960g2.431ON3202071671e-11
KLLA0B01958g6.239ON8902931711e-11
Skud_7.1356.239ON8972871711e-11
YGL137W (SEC27)6.239ON8892941711e-11
Smik_14.3221.399ON3032561651e-11
YNL006W (LST8)1.399ON3032561651e-11
CAGL0J03476g6.340ON5174251692e-11
Skud_2.1034.106ON8402161702e-11
Suva_2.1174.106ON8402161702e-11
ZYRO0D16742g7.231ON6082721692e-11
Smik_3.1726.340ON5154271682e-11
KAFR0F043506.340ON5151411682e-11
KLLA0E07085g3.25ON4522141672e-11
Kpol_1028.416.340ON5121441682e-11
NDAI0A026107.231ON7671601692e-11
NCAS0B078401.247ON5892061682e-11
KLLA0D04840g1.399ON3032541633e-11
Suva_6.1871.247ON7141861683e-11
KNAG0J016808.672ON3981521653e-11
YDR267C (CIA1)5.631ON3302211643e-11
KAFR0H031401.399ON3032321633e-11
TBLA0C041104.106ON8492131683e-11
Kpol_1028.546.325ON9051561683e-11
TDEL0A075506.340ON5151631663e-11
TPHA0M018306.340ON5151441664e-11
SAKL0H06666g8.672ON4412121654e-11
TDEL0A020702.431ON3192261625e-11
KAFR0A033801.247ON6661731665e-11
Suva_9.1547.231ON6382141665e-11
YJL112W (MDV1)1.247ON7142591665e-11
ADL082C7.231ON5692081647e-11
Suva_3.1096.340ON5154261647e-11
NDAI0I003506.340ON5154301638e-11
Ecym_24018.672ON4261551628e-11
Suva_14.223.25ON4692101638e-11
KAFR0I018807.231ON5911201648e-11
ZYRO0G20152g2.431ON3192261609e-11
NCAS0C053105.631ON3492461609e-11
Ecym_80901.247ON7161161649e-11
TBLA0D041307.231ON5741161631e-10
NCAS0D046106.340ON5154321621e-10
Kpol_1032.614.106ON8222251631e-10
NCAS0A134307.231ON6081171631e-10
ZYRO0D08206g6.340ON5152841621e-10
Skud_14.223.25ON4672101621e-10
TBLA0I022806.325ON9271561631e-10
Suva_11.2681.247ON6452301621e-10
ZYRO0D03828g1.247ON7261231621e-10
KNAG0D016907.231ON6542631622e-10
KLTH0H12122g1.399ON3032311572e-10
TDEL0H021307.231ON5842871612e-10
CAGL0H03729g1.399ON3032911572e-10
ZYRO0C03124g3.25ON4452101602e-10
KLTH0E08162g4.122ON5561481612e-10
AEL314W1.247ON7151171612e-10
Skud_10.1021.247ON7082501612e-10
KNAG0C014101.247ON6531221612e-10
Kpol_1016.111.247ON6691441612e-10
Kwal_26.87768.672ON4331841592e-10
Smik_10.1261.247ON7121861612e-10
Smik_6.3488.672ON4512131592e-10
TPHA0B011201.247ON7191981602e-10
CAGL0G09845g7.534ON5002551593e-10
TBLA0G014904.122ON7321651603e-10
KLTH0E15576g1.247ON7231211593e-10
TBLA0B043908.585ON3361771563e-10
Kwal_23.57697.231ON6272691593e-10
SAKL0F08404g7.231ON6431901593e-10
NDAI0A033104.106ON8172341594e-10
Kwal_27.126671.247ON7211901594e-10
Skud_3.1456.340ON5151411574e-10
YIL046W (MET30)7.231ON6402221584e-10
KAFR0L013907.322ON12061591595e-10
KLLA0F21406g1.247ON7051791585e-10
KAFR0I006408.585ON3151561535e-10
YNL317W (PFS2)3.25ON4652101565e-10
KNAG0B027207.322ON12041721586e-10
Kpol_1055.644.275ON9382751576e-10
TBLA0F022307.322ON12161771586e-10
KLTH0F16764g5.631ON3312381536e-10
KLLA0E12277g2.431ON3262361536e-10
TDEL0A061808.672ON4341871556e-10
KLLA0A08822g4.122ON5821591566e-10
KLLA0E21781g5.631ON3332381537e-10
KAFR0H005505.631ON3541451537e-10
CAGL0E02805g4.106ON8401831577e-10
NDAI0I008806.239ON8882721577e-10
Skud_11.2711.247ON6461871567e-10
YCR072C (RSA4)6.340ON5151411557e-10
KLLA0C08547g6.340ON5154361557e-10
TBLA0F041306.340ON5141411558e-10
Smik_14.143.25ON4662101548e-10
KLTH0A04114g7.231ON6582371559e-10
TDEL0A004403.25ON4513081549e-10
YPL151C (PRP46)8.672ON4511851531e-09
TPHA0F005504.106ON8282161551e-09
NCAS0J011104.122ON5951611541e-09
KAFR0A064804.122ON5681591541e-09
CAGL0G04345g1.247ON7111181551e-09
KAFR0H024508.672ON4171851531e-09
Kpol_1031.361.247ON7061931551e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0C00810
         (937 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...  1808   0.0  
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...  1453   0.0  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...  1394   0.0  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...  1373   0.0  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...  1366   0.0  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...  1364   0.0  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...  1360   0.0  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...  1353   0.0  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...  1340   0.0  
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...  1338   0.0  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...  1335   0.0  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...  1332   0.0  
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...  1323   0.0  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...  1318   0.0  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...  1294   0.0  
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...  1268   0.0  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...  1264   0.0  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...  1262   0.0  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...  1259   0.0  
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...  1159   0.0  
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...   125   1e-28
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...   122   9e-28
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...   117   3e-26
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...   116   8e-26
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...   110   6e-24
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...   107   5e-23
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...   107   7e-23
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...   106   1e-22
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...   105   2e-22
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...   105   2e-22
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...   105   2e-22
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...   104   3e-22
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...   103   5e-22
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...   103   8e-22
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....   103   9e-22
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...   103   1e-21
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...   102   2e-21
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...   102   2e-21
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...   101   3e-21
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    99   2e-20
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    99   2e-20
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    99   2e-20
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     97   4e-20
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    98   5e-20
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    96   9e-20
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    97   1e-19
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    95   2e-19
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    96   3e-19
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    95   3e-19
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    95   3e-19
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    95   4e-19
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    95   4e-19
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             94   8e-19
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    94   9e-19
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    92   2e-18
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    92   3e-18
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    92   3e-18
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    91   6e-18
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    89   8e-18
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    90   1e-17
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    90   1e-17
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    90   1e-17
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    89   1e-17
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    90   1e-17
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    89   2e-17
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    88   2e-17
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    89   2e-17
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    89   2e-17
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    88   2e-17
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    89   3e-17
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    88   6e-17
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    88   7e-17
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    87   7e-17
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    87   7e-17
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    87   9e-17
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    87   1e-16
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    86   2e-16
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    85   2e-16
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    86   2e-16
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    86   2e-16
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    86   2e-16
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    86   2e-16
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    86   3e-16
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    85   4e-16
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    85   4e-16
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    80   1e-15
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    83   1e-15
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    79   4e-15
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    80   7e-15
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    80   9e-15
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    80   2e-14
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    79   4e-14
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    79   5e-14
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    78   6e-14
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    77   6e-14
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    77   7e-14
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    75   1e-13
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    77   1e-13
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    74   2e-13
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    74   2e-13
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    74   2e-13
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    74   2e-13
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    74   2e-13
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    74   3e-13
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    76   3e-13
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    76   3e-13
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    75   3e-13
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    74   4e-13
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    75   4e-13
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    73   5e-13
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    74   5e-13
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    73   5e-13
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    74   2e-12
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    74   2e-12
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    71   2e-12
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    72   2e-12
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               72   2e-12
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    72   2e-12
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    73   2e-12
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    71   3e-12
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    73   3e-12
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    72   3e-12
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    72   3e-12
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    72   3e-12
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    70   3e-12
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    70   4e-12
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    72   4e-12
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      72   4e-12
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     72   5e-12
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    72   5e-12
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    72   5e-12
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    70   6e-12
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    70   6e-12
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    72   7e-12
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    71   7e-12
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    71   7e-12
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    71   8e-12
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    69   8e-12
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    70   8e-12
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    69   8e-12
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    69   8e-12
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    71   9e-12
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    69   9e-12
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    70   9e-12
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    69   1e-11
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    70   1e-11
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    69   1e-11
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    70   1e-11
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    69   1e-11
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    69   1e-11
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    70   1e-11
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    70   1e-11
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    70   1e-11
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    68   1e-11
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    68   1e-11
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    70   2e-11
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    70   2e-11
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    70   2e-11
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    70   2e-11
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    69   2e-11
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    69   2e-11
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    69   2e-11
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    69   2e-11
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     70   2e-11
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    69   2e-11
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    67   3e-11
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    69   3e-11
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    68   3e-11
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    68   3e-11
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    67   3e-11
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    69   3e-11
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    69   3e-11
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    69   3e-11
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    69   4e-11
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    68   4e-11
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    67   5e-11
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    69   5e-11
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    69   5e-11
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    69   5e-11
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    68   7e-11
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    68   7e-11
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       67   8e-11
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    67   8e-11
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    67   8e-11
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    68   8e-11
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    66   9e-11
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    66   9e-11
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    68   9e-11
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    67   1e-10
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     67   1e-10
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    67   1e-10
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    67   1e-10
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    67   1e-10
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    67   1e-10
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    67   1e-10
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    67   1e-10
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    67   1e-10
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    67   2e-10
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    65   2e-10
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    67   2e-10
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    65   2e-10
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    66   2e-10
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    67   2e-10
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    67   2e-10
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    67   2e-10
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    67   2e-10
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    67   2e-10
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    66   2e-10
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    67   2e-10
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    66   2e-10
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    66   2e-10
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    66   3e-10
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    66   3e-10
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    66   3e-10
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    65   3e-10
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    66   3e-10
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    66   3e-10
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     66   4e-10
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    66   4e-10
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    65   4e-10
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    65   4e-10
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    66   5e-10
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    65   5e-10
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    64   5e-10
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    65   5e-10
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    65   6e-10
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    65   6e-10
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    65   6e-10
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    64   6e-10
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    64   6e-10
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    64   6e-10
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    65   6e-10
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    64   7e-10
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    64   7e-10
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    65   7e-10
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    65   7e-10
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    65   7e-10
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    64   7e-10
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    64   7e-10
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    64   8e-10
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    64   8e-10
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    64   9e-10
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    64   9e-10
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    64   1e-09
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    64   1e-09
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              64   1e-09
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    64   1e-09
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    64   1e-09
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    64   1e-09
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    64   1e-09
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    64   1e-09
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    64   1e-09
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    64   1e-09
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    64   1e-09
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    64   2e-09
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    64   2e-09
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    63   2e-09
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    63   2e-09
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    63   2e-09
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    64   2e-09
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    63   2e-09
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      63   2e-09
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    64   2e-09
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      64   2e-09
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    62   2e-09
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    63   2e-09
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    64   2e-09
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    64   2e-09
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    64   2e-09
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    62   3e-09
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    62   3e-09
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    63   3e-09
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    61   3e-09
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    63   3e-09
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    62   3e-09
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    63   3e-09
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    63   3e-09
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    62   3e-09
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    63   3e-09
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     62   3e-09
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    62   3e-09
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    63   3e-09
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    62   4e-09
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    63   4e-09
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    62   4e-09
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    62   4e-09
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    62   4e-09
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    62   4e-09
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    62   4e-09
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    63   4e-09
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    62   4e-09
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    62   4e-09
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    62   4e-09
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    62   4e-09
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    62   4e-09
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    62   5e-09
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    62   5e-09
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    62   5e-09
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    62   5e-09
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    62   5e-09
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    62   6e-09
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    62   6e-09
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    61   6e-09
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    62   7e-09
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    60   7e-09
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    62   7e-09
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    61   7e-09
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    61   8e-09
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    61   8e-09
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    62   8e-09
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    61   8e-09
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      60   8e-09
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    61   9e-09
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    61   9e-09
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    62   9e-09
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    61   9e-09
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    62   9e-09
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    62   9e-09
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    60   9e-09
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    60   1e-08
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    61   1e-08
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    60   1e-08
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    61   1e-08
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      60   1e-08
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    60   1e-08
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    61   1e-08
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    60   1e-08
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    60   1e-08
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    60   1e-08
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    60   1e-08
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    60   2e-08
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    60   2e-08
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    60   2e-08
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    60   2e-08
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    60   2e-08
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    60   2e-08
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    60   2e-08
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    60   2e-08
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    60   2e-08
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    60   2e-08
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     59   2e-08
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    59   2e-08
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    57   2e-08
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    60   2e-08
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    59   3e-08
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    60   3e-08
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    59   3e-08
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    60   3e-08
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    59   3e-08
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    59   3e-08
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    60   3e-08
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    58   3e-08
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    59   3e-08
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    59   4e-08
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    59   4e-08
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    59   4e-08
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    59   4e-08
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    58   4e-08
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    59   4e-08
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    59   5e-08
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    59   5e-08
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    59   5e-08
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    59   5e-08
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    59   5e-08
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    59   5e-08
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      58   5e-08
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    59   6e-08
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    58   6e-08
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    57   6e-08
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    59   6e-08
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    59   6e-08
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    59   6e-08
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    57   6e-08
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    59   6e-08
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    58   6e-08
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    59   6e-08
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    59   7e-08
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    58   7e-08
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    58   8e-08
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    57   8e-08
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    58   8e-08
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    58   9e-08
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    58   1e-07
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    58   1e-07
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    58   1e-07
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    57   1e-07
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    57   1e-07
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    56   1e-07
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    57   1e-07
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    56   1e-07
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    57   1e-07
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    56   2e-07
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    57   2e-07
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    57   2e-07
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    57   2e-07
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    57   2e-07
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    57   2e-07
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    57   2e-07
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    54   2e-07
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    57   2e-07
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    57   2e-07
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    57   3e-07
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    56   3e-07
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    56   3e-07
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    56   3e-07
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    56   3e-07
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    56   3e-07
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    56   4e-07
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    55   4e-07
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    56   4e-07
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    56   4e-07
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    55   5e-07
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    56   5e-07
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    55   5e-07
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    55   5e-07
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    55   6e-07
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    55   6e-07
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    55   6e-07
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    54   6e-07
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    55   7e-07
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    55   7e-07
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    55   7e-07
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    55   7e-07
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    55   7e-07
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    55   8e-07
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    55   8e-07
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    55   8e-07
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    54   8e-07
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       55   9e-07
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    55   9e-07
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    55   1e-06
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    54   1e-06
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    55   1e-06
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    54   1e-06
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    55   1e-06
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    54   1e-06
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    54   1e-06
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    53   1e-06
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    53   1e-06
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    53   1e-06
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    54   2e-06
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    53   2e-06
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    53   2e-06
AFL056C Chr6 complement(329216..332146) [2931 bp, 976 aa] {ON} S...    54   2e-06
ADR264C Chr4 complement(1158216..1159256) [1041 bp, 346 aa] {ON}...    53   2e-06
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    54   2e-06
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    52   2e-06
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    53   2e-06
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    52   2e-06
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    54   2e-06
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    54   2e-06
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    53   3e-06
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    53   3e-06
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    53   3e-06
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    53   3e-06
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    53   3e-06
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    52   4e-06
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    52   4e-06
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    53   4e-06
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    52   4e-06
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    53   4e-06
Kpol_1032.65 s1032 complement(150052..151095) [1044 bp, 347 aa] ...    52   4e-06
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    52   5e-06
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    52   5e-06
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    52   5e-06
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    52   5e-06
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    52   5e-06
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     52   5e-06
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    52   5e-06
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    52   5e-06
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    52   5e-06
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    52   6e-06
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    52   6e-06
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    52   6e-06
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    52   7e-06
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....    51   7e-06
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    52   7e-06
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    51   7e-06
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    52   7e-06
AFL009C Chr6 complement(420007..421248) [1242 bp, 413 aa] {ON} S...    51   8e-06
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    52   8e-06
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    51   8e-06
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    51   8e-06
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    52   9e-06
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    52   9e-06
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    52   9e-06
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    51   1e-05
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    51   1e-05
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    51   1e-05
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    51   1e-05
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    51   1e-05
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    51   1e-05
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    51   1e-05
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    51   1e-05
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    51   1e-05
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    51   1e-05
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    50   1e-05
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    51   1e-05
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    50   1e-05
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    51   1e-05
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    51   1e-05
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    50   1e-05
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    50   1e-05
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    50   1e-05
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    50   1e-05
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    50   1e-05
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    51   2e-05
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    51   2e-05
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    50   2e-05
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    51   2e-05
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    50   2e-05
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    50   2e-05
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    50   2e-05
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    50   2e-05
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    50   2e-05
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    50   2e-05
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    50   2e-05
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    50   2e-05
KNAG0A03450 Chr1 (439716..440648) [933 bp, 310 aa] {ON} Anc_8.58...    49   2e-05
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    49   2e-05
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    50   2e-05
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    50   2e-05
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    50   3e-05
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    50   3e-05
TBLA0B09730 Chr2 (2309400..2310938) [1539 bp, 512 aa] {ON} Anc_2...    50   3e-05
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    50   3e-05
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    49   3e-05
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    49   3e-05
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    49   3e-05
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    50   3e-05
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    49   3e-05
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    50   3e-05
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    50   4e-05
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    49   4e-05
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    49   4e-05
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    50   4e-05
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       49   4e-05
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    49   4e-05
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    49   4e-05
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    49   4e-05
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    49   5e-05
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    49   5e-05
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    49   5e-05
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    49   5e-05
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    49   5e-05
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    49   5e-05
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    49   5e-05
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    49   5e-05
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    49   5e-05
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    49   6e-05
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    49   6e-05
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    49   6e-05
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    48   6e-05
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    49   6e-05
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    49   6e-05
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    48   7e-05
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    49   7e-05
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    49   8e-05
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...    48   8e-05
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    48   8e-05
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    48   8e-05
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    48   9e-05
NCAS0F02050 Chr6 complement(409352..413923) [4572 bp, 1523 aa] {...    49   9e-05
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    48   9e-05
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    48   1e-04
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    48   1e-04
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    48   1e-04
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    48   1e-04
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    48   1e-04
SAKL0B07458g Chr2 (642864..644393) [1530 bp, 509 aa] {ON} simila...    48   1e-04
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    48   1e-04
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    48   1e-04
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    48   1e-04
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    48   1e-04
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    48   1e-04
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    48   1e-04
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    47   1e-04
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    48   1e-04
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    48   2e-04
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    47   2e-04
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    47   2e-04
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    47   2e-04
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    47   2e-04
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    47   2e-04
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    47   2e-04
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    47   2e-04
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    47   2e-04
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    47   2e-04
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    47   2e-04
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    47   2e-04
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    47   2e-04
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    47   2e-04
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    47   2e-04
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     47   2e-04
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    47   2e-04
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    47   2e-04
ZYRO0F09284g Chr6 (754433..755767) [1335 bp, 444 aa] {ON} simila...    47   2e-04
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    46   3e-04
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    47   3e-04
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    47   3e-04
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    46   3e-04
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...    46   3e-04
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    46   3e-04
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    46   3e-04
NCAS0D01130 Chr4 (208915..209958) [1044 bp, 347 aa] {ON} Anc_2.3...    46   3e-04
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    46   4e-04
YGL004C Chr7 complement(490703..491956) [1254 bp, 417 aa] {ON}  ...    46   4e-04
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    46   4e-04
TBLA0A03210 Chr1 complement(762289..764535) [2247 bp, 748 aa] {O...    46   4e-04
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    46   4e-04
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    47   4e-04
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    46   4e-04
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    46   4e-04
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    46   4e-04
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    46   5e-04
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               46   5e-04
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    46   5e-04
KLTH0H15752g Chr8 complement(1359449..1360501) [1053 bp, 350 aa]...    45   5e-04
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    46   5e-04
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    45   5e-04
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    46   5e-04
KLLA0F07403g Chr6 (697593..698636) [1044 bp, 347 aa] {ON} simila...    45   5e-04
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    45   5e-04
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    45   5e-04
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    46   5e-04
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    46   6e-04
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    45   6e-04
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    45   6e-04
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    45   6e-04
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    45   7e-04
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    45   7e-04
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    45   7e-04
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    45   7e-04
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    45   7e-04
Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}...    45   7e-04
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    45   8e-04
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    45   8e-04
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    45   8e-04
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    45   8e-04
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    45   9e-04
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    45   9e-04
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    45   9e-04
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    45   9e-04
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    45   9e-04
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    45   0.001
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    45   0.001
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    45   0.001
Kwal_34.15818 s34 (74248..75297) [1050 bp, 349 aa] {ON} YMR146C ...    44   0.001
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    45   0.001
KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {O...    45   0.001
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    45   0.001
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    45   0.001
ZYRO0A08184g Chr1 (655686..656726) [1041 bp, 346 aa] {ON} highly...    44   0.001
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    44   0.001
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    45   0.001
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    45   0.001
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    44   0.001
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    44   0.001
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    45   0.001
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    44   0.001
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    44   0.001
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    44   0.001
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    44   0.001
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    44   0.002
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    44   0.002
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    44   0.002
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    44   0.002
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    44   0.002
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    44   0.002
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    44   0.002
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    44   0.002
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    44   0.002
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    44   0.002
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    44   0.002
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    44   0.002
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    44   0.002
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    44   0.002
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    44   0.002
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    44   0.002
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    44   0.002
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    44   0.002
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    44   0.002
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    43   0.002
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    44   0.002
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    44   0.002
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    43   0.002
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    43   0.003
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    43   0.003
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    44   0.003
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    43   0.003
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    43   0.003
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    43   0.003
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    44   0.003
NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {O...    43   0.003
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    43   0.003
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    43   0.003
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    43   0.003
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    43   0.003
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    43   0.003
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    43   0.003
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    43   0.003
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    43   0.004
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    43   0.004
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    43   0.004
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    43   0.004
AER035W Chr5 (699524..702544) [3021 bp, 1006 aa] {ON} Syntenic h...    43   0.004
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    43   0.004
Kpol_1033.58 s1033 (147020..149881) [2862 bp, 953 aa] {ON} (1470...    43   0.004
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    43   0.004
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    43   0.004
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    43   0.004
TDEL0G03100 Chr7 (582165..583205) [1041 bp, 346 aa] {ON} Anc_2.3...    42   0.004
Kwal_55.21144 s55 (703153..704865) [1713 bp, 570 aa] {ON} YPR137...    43   0.004
YOR269W Chr15 (826385..827869) [1485 bp, 494 aa] {ON}  PAC1Prote...    43   0.004
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    42   0.004
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    42   0.004
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    42   0.005
AGR367C Chr7 complement(1408852..1411167) [2316 bp, 771 aa] {ON}...    43   0.005
KAFR0A05270 Chr1 complement(1043260..1044975) [1716 bp, 571 aa] ...    42   0.005
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    42   0.005
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    42   0.005
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    42   0.005
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    42   0.005
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    42   0.005
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    42   0.005
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    42   0.005
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    42   0.005
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    42   0.005
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    42   0.005
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    42   0.006
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    42   0.006
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    42   0.006
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    42   0.006
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    42   0.006
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    42   0.006
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    42   0.006
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    42   0.007
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    42   0.007
SAKL0H22418g Chr8 complement(1951429..1952724) [1296 bp, 431 aa]...    42   0.007
SAKL0G08492g Chr7 (725684..727894) [2211 bp, 736 aa] {ON} simila...    42   0.007
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    42   0.007
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    42   0.008
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    42   0.008
Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON...    42   0.009
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    42   0.009
NDAI0A04540 Chr1 complement(1023305..1025011) [1707 bp, 568 aa] ...    42   0.009
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    42   0.009
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    42   0.009
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    41   0.010
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    42   0.010
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    42   0.010
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    42   0.010
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    41   0.010
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    42   0.010
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    41   0.010
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    41   0.011
KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly...    41   0.011
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    42   0.011
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    41   0.012
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    41   0.012
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    41   0.012
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    41   0.013
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    41   0.013
Ecym_6423 Chr6 (822758..824329) [1572 bp, 523 aa] {ON} similar t...    41   0.013
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    41   0.013
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    41   0.013
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    41   0.013
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    41   0.014
NCAS0F02940 Chr6 complement(582657..584924) [2268 bp, 755 aa] {O...    41   0.014
KAFR0D04430 Chr4 (874649..876928) [2280 bp, 759 aa] {ON} Anc_5.3...    41   0.014
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    41   0.014
KLTH0F14344g Chr6 (1177844..1179556) [1713 bp, 570 aa] {ON} high...    41   0.014
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    41   0.014
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    41   0.014
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    41   0.015
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    41   0.015
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    41   0.015
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    41   0.016
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    41   0.016
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    41   0.016
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    41   0.016
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    40   0.017
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    41   0.017
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    41   0.017
KLLA0F13750g Chr6 complement(1274110..1275972) [1863 bp, 620 aa]...    41   0.017
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...    40   0.018
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    41   0.018
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    40   0.018
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    40   0.019
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    41   0.020
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    40   0.020
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    41   0.021
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    40   0.021
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    41   0.021
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    40   0.021
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    40   0.021
YER066W Chr5 (290242..290799) [558 bp, 185 aa] {ON}  RRT13Putati...    39   0.021
TDEL0G00730 Chr7 (147888..152492) [4605 bp, 1534 aa] {ON} Anc_5....    41   0.021
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    40   0.022
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    40   0.022
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    40   0.023
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    40   0.023
NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {...    40   0.023
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    40   0.023
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    40   0.024
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    40   0.024
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    40   0.024
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    40   0.025
YKL121W Chr11 (214142..216700) [2559 bp, 852 aa] {ON}  DGR2Prote...    40   0.025
KLLA0D04664g Chr4 (397818..399320) [1503 bp, 500 aa] {ON} simila...    40   0.025
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    40   0.025
KNAG0A07760 Chr1 complement(1232666..1234366) [1701 bp, 566 aa] ...    40   0.026
KAFR0B05030 Chr2 (1040952..1041998) [1047 bp, 348 aa] {ON} Anc_2...    40   0.027
Suva_11.210 Chr11 (387997..388986) [990 bp, 329 aa] {ON} YKL018W...    40   0.027
ZYRO0B04444g Chr2 complement(363742..365469) [1728 bp, 575 aa] {...    40   0.028
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    40   0.029
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    40   0.029
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    40   0.030
Skud_11.211 Chr11 (384964..385953) [990 bp, 329 aa] {ON} YKL018W...    40   0.030
YKL018W Chr11 (404102..405091) [990 bp, 329 aa] {ON}  SWD2Subuni...    40   0.030
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    40   0.031
AAL119W Chr1 (137922..139535) [1614 bp, 537 aa] {ON} Syntenic ho...    40   0.031
SAKL0D02068g Chr4 (167213..168823) [1611 bp, 536 aa] {ON} simila...    40   0.032
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    40   0.032
KNAG0A06340 Chr1 (967160..970114) [2955 bp, 984 aa] {ON} Anc_2.4...    40   0.033
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    40   0.033
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...    40   0.034
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    40   0.034
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    40   0.034
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    40   0.035
Smik_11.237 Chr11 (391046..392035) [990 bp, 329 aa] {ON} YKL018W...    39   0.035
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    39   0.035
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    40   0.036
AAR102C Chr1 complement(526057..527832) [1776 bp, 591 aa] {ON} S...    40   0.036
YAR003W Chr1 (155005..156285) [1281 bp, 426 aa] {ON}  SWD1Subuni...    40   0.037
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    40   0.038
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    40   0.040
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    40   0.040
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    40   0.041
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    39   0.041
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    39   0.041
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    40   0.041
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    40   0.041
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    39   0.041
Kpol_2002.54 s2002 complement(118705..125166) [6462 bp, 2153 aa]...    40   0.042
TBLA0E03320 Chr5 complement(831986..832945) [960 bp, 319 aa] {ON...    39   0.043
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    39   0.044
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    39   0.044
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    40   0.044
NCAS0A11750 Chr1 (2335605..2337320) [1716 bp, 571 aa] {ON} Anc_3...    39   0.044
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    39   0.044
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    39   0.045
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    39   0.045
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    39   0.045
Smik_1.70 Chr1 (138173..139459) [1287 bp, 428 aa] {ON} YAR003W (...    39   0.045
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    40   0.046
Kpol_1072.46 s1072 (103226..105850) [2625 bp, 874 aa] {ON} (1032...    40   0.047
Smik_4.585 Chr4 complement(1040861..1043125) [2265 bp, 754 aa] {...    39   0.047
TDEL0D02290 Chr4 complement(442275..443876) [1602 bp, 533 aa] {O...    39   0.048
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    39   0.050
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    39   0.050
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    39   0.051
NDAI0H03610 Chr8 (887848..889410) [1563 bp, 520 aa] {ON} Anc_1.359     39   0.051
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    39   0.052
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    39   0.053
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    39   0.054
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    39   0.054
KLLA0E11177g Chr5 (983669..985150) [1482 bp, 493 aa] {ON} simila...    39   0.055
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    39   0.055
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    39   0.055
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    39   0.056
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    39   0.056
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    39   0.057
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    39   0.057
Skud_6.105 Chr6 (190549..192051) [1503 bp, 500 aa] {ON} YFR021W ...    39   0.058
KLLA0D13222g Chr4 complement(1132067..1134277) [2211 bp, 736 aa]...    39   0.060
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    39   0.060
YFR021W Chr6 (194812..196314) [1503 bp, 500 aa] {ON}  ATG18Phosp...    39   0.061
Suva_11.103 Chr11 (200612..203182) [2571 bp, 856 aa] {ON} YKL121...    39   0.061
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    39   0.063
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.063
TDEL0E02620 Chr5 (508356..510593) [2238 bp, 745 aa] {ON} Anc_5.3...    39   0.071
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    39   0.071
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    39   0.071
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    39   0.075
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    39   0.075
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      39   0.076
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    39   0.076
TDEL0F03590 Chr6 (659038..660756) [1719 bp, 572 aa] {ON} Anc_3.4...    39   0.076
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    39   0.076
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    39   0.078
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    38   0.079
TBLA0A02500 Chr1 complement(599925..601844) [1920 bp, 639 aa] {O...    39   0.080
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    39   0.080
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    39   0.082
KNAG0C06020 Chr3 complement(1172661..1176416) [3756 bp, 1251 aa]...    39   0.083
KAFR0H02680 Chr8 (507660..510239) [2580 bp, 859 aa] {ON} Anc_8.6...    39   0.083
Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar ...    39   0.084
ZYRO0G13596g Chr7 complement(1084499..1085908) [1410 bp, 469 aa]...    39   0.084
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    38   0.084
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    39   0.086
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    38   0.086
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    38   0.087
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    39   0.087
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    39   0.089
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    39   0.090
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    39   0.091
KLLA0C06633g Chr3 (580349..582244) [1896 bp, 631 aa] {ON} simila...    39   0.094
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    38   0.094
Kpol_1050.100 s1050 (228171..229895) [1725 bp, 574 aa] {ON} (228...    39   0.094
KNAG0J02560 Chr10 (482741..484294) [1554 bp, 517 aa] {ON} Anc_3....    38   0.095
Skud_4.592 Chr4 complement(1050634..1052892) [2259 bp, 752 aa] {...    39   0.097
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    38   0.098
TPHA0D04170 Chr4 (894124..895845) [1722 bp, 573 aa] {ON} Anc_3.4...    38   0.10 
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    38   0.10 
Skud_11.108 Chr11 (200902..203460) [2559 bp, 852 aa] {ON} YKL121...    39   0.10 
Kwal_26.8604 s26 complement(859891..862494) [2604 bp, 867 aa] {O...    39   0.10 
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    38   0.10 
KLLA0B11077g Chr2 complement(970761..972464) [1704 bp, 567 aa] {...    38   0.10 
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    38   0.11 
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    38   0.11 
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    39   0.11 
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    38   0.11 
KLLA0F16038g Chr6 complement(1487475..1490063) [2589 bp, 862 aa]...    38   0.11 
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    38   0.11 
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    38   0.11 
KAFR0D01020 Chr4 (210874..212490) [1617 bp, 538 aa] {ON} Anc_8.4...    38   0.12 
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    38   0.12 
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    38   0.12 
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    38   0.12 
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    38   0.12 
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    38   0.13 
TPHA0D02150 Chr4 complement(441410..443737) [2328 bp, 775 aa] {O...    38   0.13 
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    38   0.13 
CAGL0G00704g Chr7 (65805..67127) [1323 bp, 440 aa] {ON} similar ...    38   0.13 
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    38   0.13 
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    38   0.13 
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    38   0.14 
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    38   0.14 
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    38   0.14 
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     38   0.14 
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    37   0.15 
KLLA0A08800g Chr1 (770989..772308) [1320 bp, 439 aa] {ON} simila...    38   0.15 
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    37   0.15 
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    37   0.15 
ZYRO0G20988g Chr7 complement(1723533..1726193) [2661 bp, 886 aa]...    38   0.15 
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    38   0.15 
NDAI0C04390 Chr3 complement(993861..996212) [2352 bp, 783 aa] {O...    38   0.16 
Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar ...    37   0.16 
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    38   0.16 
Skud_1.64 Chr1 (130376..131662) [1287 bp, 428 aa] {ON} YAR003W (...    37   0.16 
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    38   0.16 
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    38   0.16 
AFR715C Chr6 complement(1753288..1755438) [2151 bp, 716 aa] {ON}...    38   0.16 
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    38   0.17 
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    38   0.17 
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    37   0.17 
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    38   0.18 
KLTH0B08800g Chr2 complement(712793..717340) [4548 bp, 1515 aa] ...    38   0.18 
AFL006C Chr6 complement(425925..427226) [1302 bp, 433 aa] {ON} S...    37   0.18 
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    37   0.19 
Kpol_1061.35 s1061 (98864..100180) [1317 bp, 438 aa] {ON} (98864...    37   0.19 
Kwal_47.17093 s47 complement(245346..246860) [1515 bp, 504 aa] {...    37   0.19 
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    37   0.19 
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    37   0.20 
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    37   0.20 
Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W (...    37   0.21 
SAKL0D09504g Chr4 (792974..794599) [1626 bp, 541 aa] {ON} highly...    37   0.21 
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    37   0.21 
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    37   0.21 
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    37   0.21 
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    37   0.21 
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    37   0.22 
SAKL0G19536g Chr7 complement(1683650..1684636) [987 bp, 328 aa] ...    37   0.22 
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    37   0.22 
KLLA0F21076g Chr6 (1966373..1969036) [2664 bp, 887 aa] {ON} weak...    37   0.22 
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    37   0.22 
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    37   0.24 
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    37   0.24 
TDEL0B00800 Chr2 (152025..153452) [1428 bp, 475 aa] {ON} Anc_8.8...    37   0.24 
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    37   0.24 
CAGL0B03289g Chr2 (319012..321624) [2613 bp, 870 aa] {ON} simila...    37   0.24 
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    37   0.25 
KLTH0E03872g Chr5 (353271..355511) [2241 bp, 746 aa] {ON} simila...    37   0.25 
Suva_16.464 Chr16 (804728..806449) [1722 bp, 573 aa] {ON} YPR137...    37   0.25 
TDEL0D05080 Chr4 (924017..927007) [2991 bp, 996 aa] {ON} Anc_3.1...    37   0.26 
ZYRO0D10516g Chr4 (883922..886171) [2250 bp, 749 aa] {ON} simila...    37   0.26 
YPR137W Chr16 (802359..804080) [1722 bp, 573 aa] {ON}  RRP9Prote...    37   0.27 
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    37   0.27 
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    37   0.27 
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    37   0.28 
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    37   0.28 
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    37   0.29 
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    37   0.29 
Ecym_2240 Chr2 (470406..473900) [3495 bp, 1164 aa] {ON} similar ...    37   0.29 
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    37   0.29 
TBLA0C05340 Chr3 complement(1293851..1295560) [1710 bp, 569 aa] ...    37   0.29 
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    37   0.29 
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    37   0.29 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    37   0.29 
KAFR0B01580 Chr2 (298942..303528) [4587 bp, 1528 aa] {ON} Anc_5....    37   0.32 
TDEL0F02220 Chr6 (406232..407542) [1311 bp, 436 aa] {ON} Anc_4.1...    37   0.33 
YDR324C Chr4 complement(1114433..1116763) [2331 bp, 776 aa] {ON}...    37   0.33 
KLLA0B11099g Chr2 complement(972830..975658) [2829 bp, 942 aa] {...    37   0.33 
KLTH0D10054g Chr4 complement(835206..837818) [2613 bp, 870 aa] {...    37   0.33 
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    37   0.33 
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    37   0.34 
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    37   0.34 
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    37   0.34 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    37   0.35 
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    36   0.36 
KAFR0A03660 Chr1 (748252..750816) [2565 bp, 854 aa] {ON} Anc_1.3...    37   0.36 
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    36   0.37 
TPHA0N01800 Chr14 complement(386979..387968) [990 bp, 329 aa] {O...    36   0.37 
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    37   0.37 
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    36   0.38 
Smik_16.383 Chr16 (679641..681362) [1722 bp, 573 aa] {ON} YPR137...    36   0.38 
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    37   0.38 
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    36   0.39 
CAGL0L04950g Chr12 complement(564488..566905) [2418 bp, 805 aa] ...    37   0.39 
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    37   0.39 
SAKL0D07238g Chr4 complement(594187..596784) [2598 bp, 865 aa] {...    37   0.39 
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    36   0.40 
Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {...    36   0.41 
Skud_16.427 Chr16 (761681..763402) [1722 bp, 573 aa] {ON} YPR137...    36   0.41 
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    36   0.42 
Ecym_1039 Chr1 (72890..75073) [2184 bp, 727 aa] {ON} similar to ...    36   0.42 
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    37   0.42 
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    36   0.43 
TPHA0J01070 Chr10 complement(249880..251535) [1656 bp, 551 aa] {...    36   0.44 
Kwal_23.4327 s23 (670568..675208) [4641 bp, 1546 aa] {ON} YHR186...    36   0.46 
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    36   0.47 
Smik_15.69 Chr15 complement(118407..121760) [3354 bp, 1117 aa] {...    36   0.47 
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    36   0.47 
TPHA0O01610 Chr15 (319614..321224) [1611 bp, 536 aa] {ON} Anc_2....    36   0.47 
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    36   0.47 
TDEL0A04820 Chr1 (848835..849815) [981 bp, 326 aa] {ON} Anc_5.61...    36   0.47 
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    36   0.48 
Kpol_1008.20 s1008 (39393..41141) [1749 bp, 582 aa] {ON} (39393....    36   0.48 
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    36   0.48 
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    36   0.50 
Kpol_1057.7 s1057 complement(16034..17017) [984 bp, 327 aa] {ON}...    36   0.50 
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    36   0.51 
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    36   0.51 
Suva_2.495 Chr2 complement(871929..874187) [2259 bp, 752 aa] {ON...    36   0.51 
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    36   0.51 
SAKL0B01540g Chr2 (150043..151752) [1710 bp, 569 aa] {ON} simila...    36   0.52 
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    36   0.52 
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    36   0.54 
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    36   0.55 
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    36   0.55 
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    36   0.58 
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    36   0.60 
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    35   0.60 
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    35   0.61 
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    36   0.61 
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    36   0.62 
KNAG0A07390 Chr1 complement(1156310..1157542) [1233 bp, 410 aa] ...    35   0.62 
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    35   0.63 
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    36   0.64 
TDEL0A01140 Chr1 complement(192604..194151) [1548 bp, 515 aa] {O...    35   0.65 
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    36   0.65 
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    36   0.66 
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    35   0.66 
SAKL0A05434g Chr1 (492312..495710) [3399 bp, 1132 aa] {ON} simil...    36   0.69 
Ecym_1499 Chr1 complement(1025285..1027051) [1767 bp, 588 aa] {O...    35   0.70 
KLTH0G02772g Chr7 (214898..216805) [1908 bp, 635 aa] {ON} simila...    35   0.70 
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    35   0.70 
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    35   0.72 
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    35   0.72 
TDEL0C05940 Chr3 complement(1070975..1072264) [1290 bp, 429 aa] ...    35   0.73 
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    35   0.73 
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    35   0.73 
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    35   0.73 
NDAI0E02190 Chr5 complement(450769..453492) [2724 bp, 907 aa] {O...    35   0.74 
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    36   0.75 
Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {...    35   0.75 
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    35   0.77 
TPHA0A05850 Chr1 (1327076..1328374) [1299 bp, 432 aa] {ON} Anc_3...    35   0.77 
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    35   0.78 
Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON} (15235..16...    35   0.79 
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    35   0.80 
KAFR0E02470 Chr5 complement(503462..505351) [1890 bp, 629 aa] {O...    35   0.81 
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    35   0.82 
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    35   0.82 
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    35   0.83 
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    35   0.83 
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    35   0.84 
CAGL0J07854g Chr10 complement(767587..768885) [1299 bp, 432 aa] ...    35   0.85 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    35   0.85 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    35   0.86 
Kpol_1027.5 s1027 complement(11866..14520) [2655 bp, 884 aa] {ON...    35   0.87 
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    35   0.88 
Kpol_1018.67 s1018 (194053..195033) [981 bp, 326 aa] {ON} (19405...    35   0.90 
KLLA0F08811g Chr6 complement(819834..821744) [1911 bp, 636 aa] {...    35   0.90 
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    35   0.91 
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    35   0.94 
Ecym_6170 Chr6 complement(316353..317675) [1323 bp, 440 aa] {ON}...    35   0.96 
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    35   0.96 
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    35   0.97 
TPHA0G01890 Chr7 (392062..394737) [2676 bp, 891 aa] {ON} Anc_8.6...    35   0.98 
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    35   0.98 
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    35   1.0  
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    35   1.0  
CAGL0F01837g Chr6 (181178..182980) [1803 bp, 600 aa] {ON} simila...    35   1.0  
KLLA0B07667g Chr2 (667863..673862) [6000 bp, 1999 aa] {ON} some ...    35   1.0  
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    35   1.1  
KLTH0H11286g Chr8 complement(965578..967500) [1923 bp, 640 aa] {...    35   1.1  
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    35   1.1  
NDAI0J01790 Chr10 (441237..445535) [4299 bp, 1432 aa] {ON} Anc_4...    35   1.1  
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    35   1.1  
KLTH0H12870g Chr8 (1098531..1100117) [1587 bp, 528 aa] {ON} simi...    35   1.1  
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    35   1.1  
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    35   1.1  
CAGL0A00781g Chr1 (77746..81366) [3621 bp, 1206 aa] {ON} similar...    35   1.1  
Kwal_0.356 s0 (169040..170620) [1581 bp, 526 aa] {ON} YFR021W (A...    35   1.1  
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    35   1.1  
SAKL0C03344g Chr3 (315639..317087) [1449 bp, 482 aa] {ON} weakly...    35   1.1  
SAKL0C10098g Chr3 complement(909553..912489) [2937 bp, 978 aa] {...    35   1.2  
CAGL0D04884g Chr4 (475678..477369) [1692 bp, 563 aa] {ON} highly...    35   1.2  
SAKL0H10824g Chr8 complement(934337..935881) [1545 bp, 514 aa] {...    35   1.2  
ZYRO0F17842g Chr6 complement(1477727..1480000) [2274 bp, 757 aa]...    35   1.2  
AER280C Chr5 complement(1148956..1150488) [1533 bp, 510 aa] {ON}...    35   1.2  
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    35   1.3  
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    35   1.3  
Kwal_55.20233 s55 (311887..314130) [2244 bp, 747 aa] {ON} YDR324...    35   1.3  
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    35   1.3  
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    35   1.3  
Ecym_5599 Chr5 complement(1220881..1221930) [1050 bp, 349 aa] {O...    34   1.3  
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    35   1.3  
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    34   1.4  
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    34   1.4  
Kpol_1055.2 s1055 complement(663..2915) [2253 bp, 750 aa] {ON} c...    35   1.4  
NCAS0C01450 Chr3 complement(267976..270597) [2622 bp, 873 aa] {O...    35   1.4  
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    35   1.5  
Skud_16.374 Chr16 complement(672714..674045) [1332 bp, 443 aa] {...    34   1.5  
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    34   1.5  
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    34   1.5  
Skud_12.121 Chr12 complement(236234..238000) [1767 bp, 588 aa] {...    34   1.5  
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    35   1.6  
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             34   1.6  
NCAS0F00640 Chr6 complement(123774..124396,124484..125543) [1683...    34   1.6  
Smik_6.325 Chr6 complement(511278..513968) [2691 bp, 896 aa] {ON...    35   1.6  
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    34   1.6  
SAKL0H01628g Chr8 (168606..173270) [4665 bp, 1554 aa] {ON} simil...    35   1.6  
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    34   1.7  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    34   1.7  
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    34   1.7  
KLLA0D08371g Chr4 (710885..712411) [1527 bp, 508 aa] {ON} simila...    34   1.7  
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    34   1.7  
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    34   1.7  
KLTH0B04136g Chr2 complement(335902..338352) [2451 bp, 816 aa] {...    34   1.7  
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    34   1.8  
TPHA0D02860 Chr4 (596215..597192) [978 bp, 325 aa] {ON} Anc_5.61...    34   1.8  
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    34   1.8  
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    34   1.8  
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    34   1.8  
Suva_16.415 Chr16 complement(715808..717157) [1350 bp, 449 aa] {...    34   1.8  
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    34   1.8  
TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa] ...    34   1.9  
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    34   1.9  
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    34   2.0  
Smik_7.332 Chr7 (556142..557641) [1500 bp, 499 aa] {ON} YFR021W ...    34   2.0  
KLTH0H11000g Chr8 complement(943669..946260) [2592 bp, 863 aa] {...    34   2.0  
TBLA0B04120 Chr2 (941318..943987) [2670 bp, 889 aa] {ON} Anc_8.6...    34   2.0  
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    34   2.1  
Ecym_8393 Chr8 complement(805739..807394) [1656 bp, 551 aa] {ON}...    34   2.1  
KNAG0H00450 Chr8 (70320..72755) [2436 bp, 811 aa] {ON} Anc_2.613...    34   2.3  
Kwal_33.14449 s33 complement(675978..677504) [1527 bp, 508 aa] {...    34   2.3  
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    33   2.3  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    34   2.3  
Skud_4.423 Chr4 (754186..755523) [1338 bp, 445 aa] {ON} YDR165W ...    34   2.3  
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    34   2.4  
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    34   2.4  
AEL154C Chr5 complement(339962..342628) [2667 bp, 888 aa] {ON} S...    34   2.4  
KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]...    34   2.4  
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    34   2.5  
NDAI0C06420 Chr3 complement(1486617..1488686) [2070 bp, 689 aa] ...    34   2.5  
KLLA0A01650g Chr1 complement(146030..147235) [1206 bp, 401 aa] {...    33   2.5  
KAFR0C04130 Chr3 (825105..827501) [2397 bp, 798 aa] {ON} Anc_2.6...    34   2.5  
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    33   2.5  
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    34   2.5  
Kwal_47.18825 s47 complement(989263..991137) [1875 bp, 624 aa] {...    34   2.5  
CAGL0J03344g Chr10 complement(324829..326460) [1632 bp, 543 aa] ...    33   2.5  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    33   2.6  
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    34   2.6  
Smik_7.50 Chr7 complement(84865..86058) [1194 bp, 397 aa] {ON} Y...    33   2.6  
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    33   2.7  
ZYRO0D11616g Chr4 (977141..978928) [1788 bp, 595 aa] {ON} simila...    33   2.7  
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    33   2.7  
KNAG0I01650 Chr9 (324016..325590) [1575 bp, 524 aa] {ON} Anc_1.3...    33   2.7  
Kwal_33.14971 s33 (896070..898526) [2457 bp, 818 aa] {ON} YMR049...    34   2.7  
ABL141C Chr2 complement(131670..133226) [1557 bp, 518 aa] {ON} S...    33   2.7  
TPHA0N01540 Chr14 complement(335055..337412) [2358 bp, 785 aa] {...    33   2.8  
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    33   2.8  
NDAI0I02940 Chr9 (693605..694816) [1212 bp, 403 aa] {ON} Anc_3.5...    33   2.8  
TPHA0J02880 Chr10 (639057..640961) [1905 bp, 634 aa] {ON} Anc_5....    33   2.8  
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    33   2.9  
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    33   2.9  
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    33   2.9  
ABR189W Chr2 (764141..765370) [1230 bp, 409 aa] {ON} Syntenic ho...    33   3.0  
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    33   3.0  
YGL213C Chr7 complement(90054..91247) [1194 bp, 397 aa] {ON}  SK...    33   3.0  
KNAG0C05420 Chr3 (1059879..1062236) [2358 bp, 785 aa] {ON} Anc_5...    33   3.2  
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    33   3.2  
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    33   3.2  
KNAG0B03930 Chr2 complement(756034..757881) [1848 bp, 615 aa] {O...    33   3.3  
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    33   3.3  
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...    33   3.4  
Skud_13.205 Chr13 complement(349265..351682) [2418 bp, 805 aa] {...    33   3.4  
Suva_6.93 Chr6 (160006..161508) [1503 bp, 500 aa] {ON} YFR021W (...    33   3.4  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    33   3.4  
CAGL0M02805g Chr13 (317204..319822) [2619 bp, 872 aa] {ON} simil...    33   3.5  
Kpol_2002.33 s2002 (67641..69998) [2358 bp, 785 aa] {ON} (67641....    33   3.5  
TBLA0D03080 Chr4 (741949..748887) [6939 bp, 2312 aa] {ON} Anc_1....    33   3.5  
CAGL0I07821g Chr9 complement(751754..755143) [3390 bp, 1129 aa] ...    33   3.5  
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    33   3.5  
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    33   3.6  
KLLA0E13553g Chr5 complement(1195444..1197186) [1743 bp, 580 aa]...    33   3.7  
Smik_12.117 Chr12 complement(232159..233895) [1737 bp, 578 aa] {...    33   3.8  
TPHA0M00700 Chr13 complement(132140..135313) [3174 bp, 1057 aa] ...    33   3.8  
NDAI0B04880 Chr2 complement(1193217..1195928) [2712 bp, 903 aa] ...    33   3.8  
TDEL0F03510 Chr6 complement(647165..648505) [1341 bp, 446 aa] {O...    33   3.8  
TBLA0C02620 Chr3 (622295..624985) [2691 bp, 896 aa] {ON} Anc_1.3...    33   3.8  
Suva_10.139 Chr10 complement(252982..254748) [1767 bp, 588 aa] {...    33   3.9  
TDEL0B07520 Chr2 complement(1320439..1321422) [984 bp, 327 aa] {...    33   3.9  
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    33   4.0  
SAKL0E12892g Chr5 (1062422..1064002) [1581 bp, 526 aa] {ON} simi...    33   4.1  
ZYRO0D07744g Chr4 (674077..678654) [4578 bp, 1525 aa] {ON} simil...    33   4.1  
CAGL0K07920g Chr11 complement(786915..788342) [1428 bp, 475 aa] ...    33   4.2  
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    33   4.3  
NCAS0B08910 Chr2 complement(1709752..1712469) [2718 bp, 905 aa] ...    33   4.3  
KNAG0H00220 Chr8 (32961..33944) [984 bp, 327 aa] {ON} Anc_2.657 ...    33   4.3  
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    33   4.3  
AFR153W Chr6 (711168..712898) [1731 bp, 576 aa] {ON} Syntenic ho...    33   4.3  
CAGL0L09647g Chr12 (1034737..1036026) [1290 bp, 429 aa] {ON} hig...    33   4.4  
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    33   4.4  
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    33   4.6  
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    33   4.6  
Suva_16.184 Chr16 (319761..322448) [2688 bp, 895 aa] {ON} YPL126...    33   4.6  
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    33   4.7  
TDEL0F01750 Chr6 (325359..328655) [3297 bp, 1098 aa] {ON} Anc_6....    33   4.7  
TBLA0B04670 Chr2 (1088358..1089392) [1035 bp, 344 aa] {ON} Anc_6...    33   4.9  
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    33   4.9  
CAGL0I07073g Chr9 complement(681102..682283) [1182 bp, 393 aa] {...    33   5.1  
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    33   5.1  
Skud_7.55 Chr7 complement(95372..96565) [1194 bp, 397 aa] {ON} Y...    33   5.1  
KLLA0C18491g Chr3 (1632791..1636387) [3597 bp, 1198 aa] {ON} sim...    33   5.1  
Skud_16.154 Chr16 (281868..284645) [2778 bp, 925 aa] {ON} YPL126...    33   5.2  
ZYRO0F03256g Chr6 (274828..276807) [1980 bp, 659 aa] {ON} simila...    33   5.3  
Kpol_1036.22 s1036 (54759..57860) [3102 bp, 1033 aa] {ON} (54759...    33   5.5  
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    33   5.5  
KLTH0E08184g Chr5 complement(751459..752772) [1314 bp, 437 aa] {...    32   5.6  
TBLA0F01150 Chr6 (287045..290413) [3369 bp, 1122 aa] {ON} Anc_3....    33   5.6  
Skud_3.141 Chr3 complement(217949..220924) [2976 bp, 991 aa] {ON...    33   5.7  
SAKL0H24530g Chr8 complement(2127253..2128998) [1746 bp, 581 aa]...    33   5.7  
SAKL0A05962g Chr1 complement(543144..544184) [1041 bp, 346 aa] {...    32   5.7  
KAFR0D03800 Chr4 complement(735667..736953) [1287 bp, 428 aa] {O...    32   5.9  
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    32   5.9  
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    33   5.9  
NDAI0B02440 Chr2 complement(611035..612675) [1641 bp, 546 aa] {O...    32   5.9  
NDAI0F00920 Chr6 complement(225382..226440) [1059 bp, 352 aa] {O...    32   6.0  
YOR385W Chr15 (1065043..1065915) [873 bp, 290 aa] {ON} Putative ...    32   6.2  
Kwal_0.40 s0 complement(16823..19411) [2589 bp, 862 aa] {ON} YBR...    32   6.3  
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    32   6.5  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    32   6.8  
NDAI0G02390 Chr7 complement(547355..550252) [2898 bp, 965 aa] {O...    32   6.9  
CAGL0J11286g Chr10 (1097912..1099498) [1587 bp, 528 aa] {ON} sim...    32   7.0  
KNAG0I02870 Chr9 (558973..562131) [3159 bp, 1052 aa] {ON} Anc_6....    32   7.0  
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    32   7.2  
ADL054W Chr4 (586898..588772) [1875 bp, 624 aa] {ON} Syntenic ho...    32   7.5  
KLTH0G18348g Chr7 (1581039..1582844) [1806 bp, 601 aa] {ON} simi...    32   7.6  
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    32   7.8  
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    32   7.9  
NDAI0B02760 Chr2 complement(694100..697327) [3228 bp, 1075 aa] {...    32   8.0  
Ecym_2075 Chr2 (127773..129054,129182..129780) [1881 bp, 626 aa]...    32   8.0  
Kpol_309.6 s309 complement(10739..12673) [1935 bp, 644 aa] {ON} ...    32   8.2  
KAFR0A04420 Chr1 complement(881701..882768) [1068 bp, 355 aa] {O...    32   8.3  
NCAS0B07540 Chr2 complement(1422115..1424745) [2631 bp, 876 aa] ...    32   8.9  
Suva_7.48 Chr7 complement(86451..87644) [1194 bp, 397 aa] {ON} Y...    32   9.0  
TBLA0D03840 Chr4 (952421..956197) [3777 bp, 1258 aa] {ON} Anc_1....    32   9.5  
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    32   9.6  
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    32   9.8  
KNAG0F02280 Chr6 complement(432897..433967) [1071 bp, 356 aa] {O...    32   9.9  

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 1808 bits (4683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 903/937 (96%), Positives = 903/937 (96%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60
           MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV
Sbjct: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60

Query: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120
           LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS
Sbjct: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120

Query: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK 180
           GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK
Sbjct: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK 180

Query: 181 DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240
           DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV
Sbjct: 181 DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240

Query: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK 300
           EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK
Sbjct: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK 300

Query: 301 EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY 360
           EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY
Sbjct: 301 EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY 360

Query: 361 YSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLKTKSC 420
           YSIPYEKRLPKNPSPSKLYTIEQKGHRT          NKLLASASNGLLKIWNLKTKSC
Sbjct: 361 YSIPYEKRLPKNPSPSKLYTIEQKGHRTDIRSIDISDDNKLLASASNGLLKIWNLKTKSC 420

Query: 421 IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD 480
           IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD
Sbjct: 421 IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD 480

Query: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540
           GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK
Sbjct: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540

Query: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
           YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF
Sbjct: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660
           GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA
Sbjct: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660

Query: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDSAFKA 720
           ITSDGSTVVSSSHDHSMRVWKETDDQVFL             DTLLTSLEEGSGDSAFKA
Sbjct: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLEEEREKELEEQYEDTLLTSLEEGSGDSAFKA 720

Query: 721 DIEDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAGEPPV 780
           DIEDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAGEPPV
Sbjct: 721 DIEDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAGEPPV 780

Query: 781 KPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPEIL 840
           KPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPEIL
Sbjct: 781 KPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPEIL 840

Query: 841 KNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQGLK 900
           KNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQGLK
Sbjct: 841 KNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQGLK 900

Query: 901 FIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTLA 937
           FIKQQWNLKHNYEFI           NSKKRIFGTLA
Sbjct: 901 FIKQQWNLKHNYEFIDEEDQKKQEEKNSKKRIFGTLA 937

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 1453 bits (3761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/939 (74%), Positives = 817/939 (87%), Gaps = 5/939 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNV-GQVLTGALENINLWDIKTGELLS 59
           MVKSYQRFEQ SVFGVI+TNANCVW+ S +S+KSN  G V+T ALENIN+WDIKTGEL+S
Sbjct: 1   MVKSYQRFEQASVFGVISTNANCVWM-SPESKKSNSPGSVITSALENINIWDIKTGELIS 59

Query: 60  VLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHK 119
           VLSDGLP GSIDVKSSKPAEV+YL YHDETNLLAAGY DG IK+WDL+SK+VLL+F+GHK
Sbjct: 60  VLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHK 119

Query: 120 SGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTA 179
           S +T++KFD TGTRL+SGSRDS+II+WDLVSEVG++KLRSHKDAI+GIWCEGEDWLVST+
Sbjct: 120 SAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTS 179

Query: 180 KDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKI 239
           KDGLIK+WDLK QQC+ETHIA TGECWA+GVH DL++T+G D+Q+K+WNLD SKE GSK+
Sbjct: 180 KDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKL 239

Query: 240 VEKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRM 299
           +EKG Y+KQSKQRGL + F    + T F YIQN+DKT E+FRIR+++EIS+ALKKREKR+
Sbjct: 240 IEKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKALKKREKRL 299

Query: 300 KEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIE 359
           KEKG TDE+IQQ   ++Y S+++ PFQ+IKS YKIK+VS+T  +N+K+E VVTTSSN+IE
Sbjct: 300 KEKGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIE 359

Query: 360 YYSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLKTKS 419
           YYSIPYEKR P +P+P++LYTIE  GHRT          +KLLA+ASNGLLK+WNLKTK+
Sbjct: 360 YYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKA 419

Query: 420 CIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQ 479
           CIR FDCGYALTCKFLP GTL ++GTREG +QLFDL +STL+E+ + AH  AIWSLDIT 
Sbjct: 420 CIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITS 479

Query: 480 DGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED 539
           DG+RLVTGSADK+IKFWNF +E+DLVPGT DK++PVMKLIHDTT+E+N+D+LSV+ISPED
Sbjct: 480 DGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPED 539

Query: 540 KYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599
           K+LA+SLLDNTVKVF+LDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD
Sbjct: 540 KFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599

Query: 600 FGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWAL 659
           FGDCHKSLFAHQDSIMNV FLPESHNFFSSSKDGLVKYWDGDKFEC+QKLAAHQSEVW++
Sbjct: 600 FGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSI 659

Query: 660 AITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDSAFK 719
           AITSDG++V+S+SHDHS+RVW+ETDDQVFL             DTLL SLEEGSGD AFK
Sbjct: 660 AITSDGTSVISASHDHSLRVWEETDDQVFLEEEREKELEEQYEDTLLASLEEGSGDDAFK 719

Query: 720 ADIEDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKK-AGEP 778
            D E   DESTSVRNQTMESLK+GERLMEAL+LG SEIEA EKY  D K WEKKK +GEP
Sbjct: 720 GDAEKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSGEP 779

Query: 779 PVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPE 838
           P+KPQGNAIL+A+ ++P +YIM+TL+KIKPSQLEDALLVLPFSYVL+ LKFIDIVM D +
Sbjct: 780 PIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKDKK 839

Query: 839 ILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQG 898
           + KN L LICKNLF ++++NHKELISQRN+ LK QI +VKN LR SLQ NVDDLGFNIQG
Sbjct: 840 MTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNIQG 899

Query: 899 LKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTLA 937
           LKFIKQQWNLKHN++F            + KKRIFGTL+
Sbjct: 900 LKFIKQQWNLKHNFDF--TDDFDKKEESSGKKRIFGTLS 936

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 1394 bits (3609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/955 (69%), Positives = 795/955 (83%), Gaps = 19/955 (1%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60
           MVKSYQRFEQ SVFGVI++N+NCVWLPS+ S+KS+ GQ++TGALEN+N+WD+KTGEL S 
Sbjct: 28  MVKSYQRFEQASVFGVISSNSNCVWLPSTSSKKSHPGQIITGALENVNIWDLKTGELASF 87

Query: 61  LSDGL--PPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGH 118
           L+DGL  PPGS+D KSSKPAE T+L++H ETNLLA GY DGV+K+WDL SKTVL + +GH
Sbjct: 88  LNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAVGYNDGVVKVWDLYSKTVLCNLNGH 147

Query: 119 KSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWC--------- 169
            S +T LKFD++GTRL+SGSRDS+II+WDLVSEVG++KLRSHKDAITGIWC         
Sbjct: 148 SSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQE 207

Query: 170 EGE-DWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWN 228
           E E DWL+ST+KDGLIK+WDLK QQCVETHIA TGECW+L V  DLV+TT +DSQ+K W 
Sbjct: 208 ENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKFWQ 267

Query: 229 L---DTSKENGSKIVEKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQ 285
           L   D +  NGSK++EKG YEKQSKQRGL+V F  + D   F  IQN+D+TVEIFR+RK+
Sbjct: 268 LSLQDDTVPNGSKLIEKGIYEKQSKQRGLNVEFIDSIDGVGFFLIQNADRTVEIFRLRKE 327

Query: 286 DEISRALKKREKRMKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANS 345
           +EIS+ALKKREKR+ EKG T ++I++   D++VS+M+ PFQII+S YK+KA +WT+A ++
Sbjct: 328 EEISKALKKREKRLTEKGMTPDEIKKSLEDSFVSMMMHPFQIIRSIYKVKAATWTIATST 387

Query: 346 KIELVVTTSSNTIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASA 405
           K+EL VTT++NTIEYYSIPYEKR P  P  +KLY +E +G RT          NKLLA+A
Sbjct: 388 KLELTVTTANNTIEYYSIPYEKREPTQPIANKLYNVELQGQRTDIRSIDISDDNKLLATA 447

Query: 406 SNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESID 465
           SNG LKIWNLKTK CIRTF+CGYALTCKFLP G L +IGTR G++QLFDL +ST I +I+
Sbjct: 448 SNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGMLVIIGTRAGELQLFDLASSTQIANIE 507

Query: 466 VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLE 525
            AH+AAIWSLD+T DGKRL+TGSADKS+KFWNF +EQ+LVPGT+DKFVP + L HDTTLE
Sbjct: 508 EAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLE 567

Query: 526 LNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLII 585
           L+DDILSV++SPEDK+LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSK+II
Sbjct: 568 LSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMII 627

Query: 586 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV F+PESHNFFS SKDG++KYWDGDKFEC
Sbjct: 628 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFEC 687

Query: 646 VQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTL 705
           +QKLAAHQSEVWALAI +D S VVSSSHDHS+R+W+ET+D+VFL             DTL
Sbjct: 688 IQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWEETEDEVFLEEERDKEMEEQYEDTL 747

Query: 706 LTSLEEGSGDSAFKADIEDG----MDESTSVRNQTMESLKSGERLMEALELGFSEIEALE 761
           L SLEEG+GD AFK D +       DE+T V  QTMESLK+GERLMEA +LG +EIE+ E
Sbjct: 748 LASLEEGNGDDAFKGDTKGATNVEFDEATDVHKQTMESLKAGERLMEAFDLGMAEIESFE 807

Query: 762 KYNKDYKQWEKKKAGEPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFS 821
           +Y+K+ K W++KK GEPP+KPQGNAIL+AI + P++YIMDTLI+IKPSQLEDALLVLPFS
Sbjct: 808 EYDKNLKLWQRKKTGEPPIKPQGNAILIAIKKTPEEYIMDTLIRIKPSQLEDALLVLPFS 867

Query: 822 YVLQFLKFIDIVMDDPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKL 881
           YVL+FLKFI+IV+ + ++L N LALICKNLF IVK+NHKEL+SQ+N+VLK QIT VKN+L
Sbjct: 868 YVLKFLKFINIVIGNKKMLNNHLALICKNLFFIVKSNHKELVSQKNEVLKLQITKVKNEL 927

Query: 882 RTSLQANVDDLGFNIQGLKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTL 936
           R +L+AN DDLGFNIQG+KFIKQQWNL+HN EF+            +KKR FGTL
Sbjct: 928 RNALKANEDDLGFNIQGMKFIKQQWNLRHNLEFVDEYDQKSHEDKMAKKRTFGTL 982

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 1373 bits (3553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/942 (68%), Positives = 783/942 (83%), Gaps = 8/942 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60
           MVKSYQRFEQ S FGVI++N NCVW+ S +  + + GQ+LTGALEN+N WDIKTGEL  +
Sbjct: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRN--RGSAGQILTGALENVNCWDIKTGELSKI 58

Query: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120
           L+DGLPPG++D KS+K AE TYL+YH ETNLLA GYADGVIKIWDL+SKTVL++F+GHKS
Sbjct: 59  LTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKS 118

Query: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK 180
            +T+L+FD TGTRL+SGS+DSDIIIWDLV EVG++KLRSHKD+ITGIWCE EDWL+ST+K
Sbjct: 119 AITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSK 178

Query: 181 DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240
           DGLIK+WDLKTQQCVETH+A T ECW L +H DLV+TT T+SQIKIWNLD  K+ GSK++
Sbjct: 179 DGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLI 238

Query: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK 300
           EKG YEKQSKQRG+SV F TT+D   F YIQN+DKTVEIFR+R Q+EIS+AL+KREKR++
Sbjct: 239 EKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLR 298

Query: 301 EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY 360
           +KG  DE+IQQ   D+YVS+++ PFQ I+S +KIKA +W V   SK+E+V+TTS+NT+EY
Sbjct: 299 DKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEY 358

Query: 361 YSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLKTKSC 420
           YSIPY+KR P  P+P+KLYTIE +GHRT          NKLLA+ASNG LKIWN+KT +C
Sbjct: 359 YSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHAC 418

Query: 421 IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD 480
           IRTF+CGYALTCKFLP G L V+G R G +QLFDL +STL+E+ + AH AAIWSLD+T D
Sbjct: 419 IRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSD 478

Query: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540
           GKRLVTGSADK++KFW+F ++Q+L+PGT DKFVP +K+ HDTTLELNDDIL+VKIS ++K
Sbjct: 479 GKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNK 538

Query: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
           +LAVSLLDNTVKVFFL+SMKFFLSLYGHKLPVLSIDISFDSKL+ITSSADKNIKIWGLDF
Sbjct: 539 FLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDF 598

Query: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660
           GDCHKSLFAHQDSIM+V F+PESHNFFS SKDGLVKYWDGDKFECVQKLAAHQSEVWALA
Sbjct: 599 GDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 658

Query: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDSAFKA 720
           I++D   VVS+SHDHS+RVW+ET+D+VFL             +TLL SLE GSGD  F+ 
Sbjct: 659 ISNDARFVVSTSHDHSIRVWEETEDEVFLEEEREKEMDEQYENTLLHSLEAGSGDDNFQR 718

Query: 721 DI----EDG--MDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKK 774
           DI    EDG   D++T V  QT+ESLK+GER++EAL+LG + IE  E Y K+ K W+KKK
Sbjct: 719 DIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKK 778

Query: 775 AGEPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVM 834
           +GEPP KPQ NAIL+A+ + P+QYIM+TL+KI+PSQLEDALLVLPFSYVL FLKFID+V+
Sbjct: 779 SGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVI 838

Query: 835 DDPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGF 894
            D ++  N L LICK LF I+K+N++EL++Q+N+ LK QI  VK +LRT+L+ N DDLGF
Sbjct: 839 KDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGF 898

Query: 895 NIQGLKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTL 936
           N+QGLKFI+QQWNL+HN EF+             KKRIF TL
Sbjct: 899 NVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETL 940

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 1366 bits (3536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/957 (68%), Positives = 786/957 (82%), Gaps = 21/957 (2%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60
           MVKSYQRFEQ+SVFGVI +N+NC+WLPS  +  ++ GQ++T ALENIN+WDIKTGEL S 
Sbjct: 1   MVKSYQRFEQESVFGVINSNSNCIWLPSDSNPSTSPGQIITSALENINIWDIKTGELSSH 60

Query: 61  LSDGL--PPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGH 118
           L D L  PPGSID KS+KPAE TYL++H +TNLLA GY DGVIK+WDL SKTVL + +GH
Sbjct: 61  LIDSLIPPPGSIDAKSTKPAETTYLQHHKDTNLLAVGYNDGVIKVWDLYSKTVLCNLNGH 120

Query: 119 KSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCE-----GED 173
            S +T+LKFDSTGTRL+SGSRDS+II+WDLVSEVG++KLRSHKDAITGIWC      GED
Sbjct: 121 SSAITVLKFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEMQNNGED 180

Query: 174 ------WLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIW 227
                 WL+ST+KDGLIK+WDLK QQC+ETHIA TGECW++ V  DL++TT +DSQIKIW
Sbjct: 181 DENELDWLISTSKDGLIKIWDLKIQQCIETHIAHTGECWSVAVRNDLLITTSSDSQIKIW 240

Query: 228 NLDTSKEN---GSKIVEKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRK 284
            L+   ++     K++EKG YEKQSKQRGLS+ F  TADET F YIQN+DKTVEIFR+RK
Sbjct: 241 ELNLDNDDDGKNKKLIEKGIYEKQSKQRGLSIEFIDTADETGFFYIQNADKTVEIFRLRK 300

Query: 285 QDEISRALKKREKRMKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAAN 344
           QDEI++A+KKR KR+ EKG T E I+Q   D+Y+SL++ PFQI++S YKIKAV+WT+A  
Sbjct: 301 QDEINKAIKKRTKRLTEKGMTPEDIEQNIKDSYISLIMHPFQIVRSIYKIKAVTWTIATP 360

Query: 345 SKIELVVTTSSNTIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLAS 404
           SK+EL +TTS+NTIEYYS PYEKR P  P+P+KL+TIE +G RT          NKLLA+
Sbjct: 361 SKLELCLTTSNNTIEYYSTPYEKREPTQPTPNKLHTIELQGQRTDIRSIDISDDNKLLAT 420

Query: 405 ASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESI 464
           ASNGLLKIWN+KTKSCIRTF+CGY+LTCKFLP GTL ++GTR G++QLFDL +STL+E+I
Sbjct: 421 ASNGLLKIWNIKTKSCIRTFECGYSLTCKFLPGGTLVIVGTRGGELQLFDLASSTLLETI 480

Query: 465 DVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTL 524
           + AH+AAIWSLD+T DGKRLVTGSADKS+KFW+F +EQ+LV GT DK++P +KL HDTTL
Sbjct: 481 EDAHDAAIWSLDLTSDGKRLVTGSADKSVKFWDFQLEQELVAGTVDKYLPKLKLFHDTTL 540

Query: 525 ELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLI 584
           ELNDDILSVKISPEDK+LAVSLLDNTVKVFF+D+MKFFLSLYGHKLPVLSIDISFDSKLI
Sbjct: 541 ELNDDILSVKISPEDKFLAVSLLDNTVKVFFMDTMKFFLSLYGHKLPVLSIDISFDSKLI 600

Query: 585 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFE 644
           ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV F+PESHNFFS SKDGL+KYWDGDKFE
Sbjct: 601 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGLIKYWDGDKFE 660

Query: 645 CVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDT 704
           C+QKLA HQSEVW++AI +D S +VSSSHDHS+R+W+ET+D+VFL             DT
Sbjct: 661 CIQKLAGHQSEVWSIAIANDASFIVSSSHDHSIRIWEETEDEVFLEEEREKELEELYEDT 720

Query: 705 LLTSLEEGSGDSAFKADIEDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYN 764
           LLTSLEE +GD AFK D  +  DE+T V  QTMESLK+ ERLMEA +LG  EIEA+E+Y 
Sbjct: 721 LLTSLEEDNGDDAFKKDGGEDKDEATDVHKQTMESLKASERLMEAFDLGMKEIEAMEEYE 780

Query: 765 KDYKQWEKKKAGEP-----PVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLP 819
           ++ K W++K +        P+KPQGNAILLAI + P++YIMDTL++IKPSQLEDALLVLP
Sbjct: 781 RELKNWQRKDSNNKATQTVPIKPQGNAILLAIKKTPEEYIMDTLVRIKPSQLEDALLVLP 840

Query: 820 FSYVLQFLKFIDIVMDDPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKN 879
           FSY+++FLKFIDIV++  +IL N L LIC+ LF IVK+NHKEL+SQ+N+ LK QIT VK+
Sbjct: 841 FSYIIKFLKFIDIVINSKKILNNHLPLICRILFFIVKSNHKELVSQKNEELKSQITRVKD 900

Query: 880 KLRTSLQANVDDLGFNIQGLKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTL 936
            LR +L+ N DDLGFNIQGLKFIKQQW LKHNYE++            +KKR FGT+
Sbjct: 901 NLRNALKNNEDDLGFNIQGLKFIKQQWKLKHNYEYVDDQDQKAQEAKFAKKRTFGTI 957

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1364 bits (3531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 641/940 (68%), Positives = 782/940 (83%), Gaps = 8/940 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSN---VGQVLTGALENINLWDIKTGEL 57
           MVKSYQRFEQ + FGVI +NANCVW+P+S SR +N    GQ++T ALEN+N+WDIKTG+L
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPAS-SRTNNGSGPGQLITSALENVNIWDIKTGDL 59

Query: 58  LSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSG 117
           ++ LSDGLPPG+ D K SKPAE TYLE H +TNLLA GYADGVIK+WDL+SKTVLL+F+G
Sbjct: 60  VTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNG 119

Query: 118 HKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVS 177
           HK+ +T+++FDSTGTRL+SGS+DS+II+WDLV EVG++KLRSHKDAITG WC+GEDWLVS
Sbjct: 120 HKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVS 179

Query: 178 TAKDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKEN-G 236
           T+KDGLIK+WDLKTQQC+ETHIA TGECW L V  DL++TT TDSQ+KIW L+   E  G
Sbjct: 180 TSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMG 239

Query: 237 SKIVEKGTYEKQSKQRGLSVNFKTTA-DETTFLYIQNSDKTVEIFRIRKQDEISRALKKR 295
            K+ E G +EKQSKQRGL + F T A D  +F YIQN+DKT+E +RIRK++EI+R LKKR
Sbjct: 240 EKLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIARGLKKR 299

Query: 296 EKRMKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSS 355
           EKR++EKG TDE+I +   D+Y SL+L PFQ ++S YKIK+ SWT   +SK+ELVVTTS+
Sbjct: 300 EKRLREKGLTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSN 359

Query: 356 NTIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNL 415
           NTIEYYSIPYEKR P +P+P K +TIE +G RT          NKLLA+ASNG LKIWN+
Sbjct: 360 NTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNV 419

Query: 416 KTKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSL 475
           KT  CIRTF+CGYALTCKFLP G L ++GTR G++QLFDL +S+L+++I+ AH+AAIWSL
Sbjct: 420 KTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSL 479

Query: 476 DITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKI 535
           D+T DGKRLVTGSADK++KFW+F +E+ LVPGT DKFVP++KL HDTTLELNDDILSV+I
Sbjct: 480 DLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRI 539

Query: 536 SPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKI 595
           SP+D+YLA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKI
Sbjct: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599

Query: 596 WGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSE 655
           WGLDFGDCHKSLFAHQDSIM+V FLPESHNFFS SKD +VKYWDG+KFEC+QKL AHQSE
Sbjct: 600 WGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSE 659

Query: 656 VWALAITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGD 715
           VWALAI++DGS VVSSSHDHS+R+W+ET+DQVFL             DTLLTSLEEG+GD
Sbjct: 660 VWALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGD 719

Query: 716 SAFKADI--EDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKK 773
            AFK D   E+  DE++ V  QT+ESLK+GE+LMEAL+LG +EIE +E YNKD K W++K
Sbjct: 720 DAFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRK 779

Query: 774 KAGEPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIV 833
           K GE P+KPQGN++L+A+ + P+QYIMDTL +I+ SQLEDAL+V+PFSYVL+FLKF D V
Sbjct: 780 KLGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAV 839

Query: 834 MDDPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLG 893
           M +  +L N L LICKNLF I+K NHKELISQ+N+ LK QI  VK +LR +L++  DDLG
Sbjct: 840 MQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLG 899

Query: 894 FNIQGLKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIF 933
           FN+QGLKFI+QQWNLKHNYEF+           +++KR+F
Sbjct: 900 FNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVF 939

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1360 bits (3520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/942 (67%), Positives = 784/942 (83%), Gaps = 6/942 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVG--QVLTGALENINLWDIKTGELL 58
           MVKSYQRFEQ + FGVI +NANCVWLP+S   KS  G  Q++T ALEN+N+WDIKTG+L+
Sbjct: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60

Query: 59  SVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGH 118
           S LSDGLPPG+ D + +KPAE TYLE H +T+LLA GYADGVIK+WDLMSKTVLL+F+GH
Sbjct: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 119 KSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVST 178
           K+ +T+L+FD TGTRL+SGS+DS+II+WDLV EVG++KLRSHKD+ITG WC+GEDWL+ST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 179 AKDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKEN-GS 237
           +KDG+IKLWDLKTQQC+ETHIA TGECW L V  DL++TTGTDSQ+K+W L+   +  G 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240

Query: 238 KIVEKGTYEKQSKQRGLSVNFKT-TADETTFLYIQNSDKTVEIFRIRKQDEISRALKKRE 296
           K+ E GT+EKQSKQRGL + F T T+D  +F YIQN+DKT+EIFRIRK++EI+R LKKRE
Sbjct: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTIEIFRIRKEEEIARGLKKRE 300

Query: 297 KRMKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSN 356
           KR++EKG TDE+I +   D+Y SL+L PFQ ++S YKIK+ SWT   +SK+ELV+TTS+N
Sbjct: 301 KRLREKGLTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360

Query: 357 TIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLK 416
           TIEYYSIPYEKR P +P+P K +TIE +G RT          N+LLA+ASNG LKIWN+K
Sbjct: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420

Query: 417 TKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLD 476
           T  CIRTF+CGYALTCKFLP G L ++GTR G++QLFDL +S+L+++I+ AH+AAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 477 ITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKIS 536
           +T DGKRLVTGSADK++KFW+F +E  LVPGT DKF+P++KL HDTTLELNDDILS++IS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540

Query: 537 PEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           P+D+YLA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 597 GLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEV 656
           GLDFGDCHKSLFAHQDSIM+V FLPESHNFFS SKD +VKYWDG+KFEC+QKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 657 WALAITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDS 716
           WALAI++DGS VVSSSHDHS+R+W+ET+DQVFL             DTLLTSLEEG+GD 
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 717 AFKADI--EDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKK 774
           AFK D   E   DE + V  QT+ESLK+GERLMEAL+LG +EIE +E Y++D K W++KK
Sbjct: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780

Query: 775 AGEPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVM 834
            GE P+KPQGN++L+A+N+ P+QYIMDTL++I+ SQLEDAL+V+PFSYVL+FLKFID +M
Sbjct: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840

Query: 835 DDPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGF 894
            +  +L + L LICKNLF I+K NHKEL+SQ+N+ LK Q++ VK +LR +L++  DDLGF
Sbjct: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900

Query: 895 NIQGLKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTL 936
           N+QGLKFIKQQWNL+HNYEF+            ++KR F T+
Sbjct: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETV 942

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1353 bits (3502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/942 (66%), Positives = 781/942 (82%), Gaps = 6/942 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSD--SRKSNVGQVLTGALENINLWDIKTGELL 58
           MVKSYQRFEQ ++FGVI +NANCVWLP S   ++ S  GQ++T ALEN+N+WDIKTG+LL
Sbjct: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60

Query: 59  SVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGH 118
           + LSDGLPPG+ D + SKPAE TYLE H++T+LLA GYADGVIK+WDLMSKTVLL+F+GH
Sbjct: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 119 KSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVST 178
           K+ +T+L+FDSTGTRL+SGSRDS+II+WDLV EVG++KLRSHKD ITGIWC+GEDWL+ST
Sbjct: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180

Query: 179 AKDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKEN-GS 237
           +KDG+IKLWDLKTQQC+ETHIA TGECW+L V  DL++TTGTDSQ+KIW L+   +  G 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240

Query: 238 KIVEKGTYEKQSKQRGLSVNFKTTA-DETTFLYIQNSDKTVEIFRIRKQDEISRALKKRE 296
           K+ E G +EKQSKQRGL V F T A D  +F YIQN+DKT+E FRIRK++EI+R LKKRE
Sbjct: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 297 KRMKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSN 356
           KR++EKG TDE+I +    +Y SL+L PFQ I+S YK+K+ SWT   +SK+ELV+TTS+N
Sbjct: 301 KRLREKGLTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360

Query: 357 TIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLK 416
           TIEYYSIPYEKR   +P+P K +TIE +G RT          NKLLA+ASNG LKIWN+K
Sbjct: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420

Query: 417 TKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLD 476
           T  CIRTF+CGYAL+CKFLP G L ++GTR G++QLFDL +S+L+++++ AH+AAIWSLD
Sbjct: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480

Query: 477 ITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKIS 536
           +T DGKRLVTGSADK++KFW+F +E  LVPGT DK +P++KL HDTTLELNDDILSV+IS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540

Query: 537 PEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           P+D+YLA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 597 GLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEV 656
           GLDFGDCHKSLFAHQDSIM+V FLPESHNFFS SKD +VKYWDG+KFEC+QKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 657 WALAITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDS 716
           WALAI S+GS VVSSSHDHS+R+W+ET+DQVFL             DTLL SLEEG+ D 
Sbjct: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLASLEEGNADD 720

Query: 717 AFKADI--EDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKK 774
           AFK D   ED  DE++ V  QT+ESLK+GERLMEAL++G ++IE +E YNKD + W++KK
Sbjct: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780

Query: 775 AGEPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVM 834
            GE P+KPQGN++L+A+N+ P+QYI+DTL +I+ SQLEDAL+V+PFSYVL+FLKFID VM
Sbjct: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 835 DDPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGF 894
            +  +L + L L+C+NLF I+K NHKEL+SQ+N+ LK QI  VK +LR +L++  DDLGF
Sbjct: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900

Query: 895 NIQGLKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTL 936
           N+QGLKFIKQQWNL+HNYEF+           +++KR+F T+
Sbjct: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETV 942

>TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.324
           YLR129W
          Length = 938

 Score = 1340 bits (3469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/939 (66%), Positives = 774/939 (82%), Gaps = 5/939 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60
           MVKSYQRFEQ + FGVI++N+NCV++P ++  +  +GQVLTG LE +NLWD+KTG+L+S 
Sbjct: 1   MVKSYQRFEQSASFGVISSNSNCVYIPPAN--RKGLGQVLTGGLEKVNLWDLKTGDLVSC 58

Query: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120
           LSDGLPPGSID KS+KPAE TYLEYH ETNLLA GYA+GVIK+WDLMSKTVLL+ +GHKS
Sbjct: 59  LSDGLPPGSIDAKSTKPAETTYLEYHAETNLLAVGYAEGVIKVWDLMSKTVLLTLNGHKS 118

Query: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK 180
            VTILKFD TGTRL+SGS+DS+II+WDL+ EVG++KLRSHK AI+G+W E ++WL+ST++
Sbjct: 119 AVTILKFDITGTRLISGSQDSNIIMWDLIGEVGLYKLRSHKGAISGLWLEKDEWLISTSR 178

Query: 181 DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240
           DGLIK+WDLKTQQCVETHIA TGECW+LGVH DL +T   DSQ+KIW+L+   E GSK++
Sbjct: 179 DGLIKVWDLKTQQCVETHIAHTGECWSLGVHEDLAITASADSQVKIWHLNFESEAGSKLI 238

Query: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK 300
           EKG YEKQS QRG S+ F TT DETTF YIQN+DK++EIFRIRK++EI +A +KREKR+K
Sbjct: 239 EKGIYEKQSNQRGSSIEFVTTTDETTFFYIQNADKSIEIFRIRKEEEILKATRKREKRLK 298

Query: 301 EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY 360
           EKG +DE+I+Q   D Y+S+++ PFQI++S +K+KA +W  A  SK++LVVTT+SNT+EY
Sbjct: 299 EKGLSDEEIKQNIQDGYISMIMHPFQILRSNFKVKAAAWGQATASKLDLVVTTASNTVEY 358

Query: 361 YSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLKTKSC 420
           Y+IPYEKR PK P+P++L+++E +GHRT          + LLA+ASNG LK+WNLKT+ C
Sbjct: 359 YTIPYEKREPKLPAPNRLHSVELQGHRTDVRAMDISNDSSLLATASNGTLKVWNLKTRMC 418

Query: 421 IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD 480
           +RTFDCGYAL C+FLP G L V+GTR G +QLFDL +ST++++ + AH+AAIWSLDIT D
Sbjct: 419 LRTFDCGYALCCRFLPGGFLIVVGTRNGDLQLFDLASSTMLDNKEGAHDAAIWSLDITSD 478

Query: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540
           GK+LVTGSADKS+KFW F +E+DL+ GT DKF PVMKL HDTTLELNDD+LSV+ISPEDK
Sbjct: 479 GKKLVTGSADKSVKFWKFQVEKDLIAGTVDKFAPVMKLSHDTTLELNDDVLSVRISPEDK 538

Query: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
           Y A+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIWGLDF
Sbjct: 539 YFAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKVIITSSADKNIKIWGLDF 598

Query: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660
           GDCHKSLFAHQDSIM+V FLPESHNFFS SKDGLVKYWDGDKFEC+QKLA HQSEVWALA
Sbjct: 599 GDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDGLVKYWDGDKFECIQKLAGHQSEVWALA 658

Query: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDSAFKA 720
           I+++G  VVS+SHD S+R+W+ET+DQVFL               LL+SLEEGSGD+AF+ 
Sbjct: 659 ISNNGKYVVSASHDRSIRIWEETEDQVFLEEEREKELEEQNETALLSSLEEGSGDAAFRK 718

Query: 721 DI---EDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAGE 777
           D+   E   DE+  VR QT+ESLK+GERLMEAL+LG  EIE  E Y K+ K W K K   
Sbjct: 719 DVGGDEADQDEAADVRKQTIESLKAGERLMEALDLGIPEIENREHYEKELKAWNKHKGDA 778

Query: 778 PPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDP 837
            PVKP GNAIL AI++ P++YI++TL +IKPSQLEDALLVLPFSYVL+F +FID  + D 
Sbjct: 779 KPVKPPGNAILTAISKTPEEYILETLARIKPSQLEDALLVLPFSYVLKFFRFIDAALLDN 838

Query: 838 EILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQ 897
            IL++ L LICKNLF IVK+NH+EL+SQ+N+ LK +I  VK+ LR +L++N DDLGFNI+
Sbjct: 839 RILQHNLPLICKNLFFIVKSNHRELVSQKNEELKLRIAKVKDLLRGALKSNEDDLGFNIE 898

Query: 898 GLKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTL 936
           GLKFI++QW+L+H  EF+            +KKR+F T+
Sbjct: 899 GLKFIRRQWDLRHKLEFVDDYSQREQEDKTAKKRVFETI 937

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 1338 bits (3464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/942 (67%), Positives = 785/942 (83%), Gaps = 6/942 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSS--DSRKSNVGQVLTGALENINLWDIKTGELL 58
           MVKSYQRFEQ + FGVI +NANCVW+P+S  +S  S  GQ++T ALE++N+WDIKTG+L+
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSGNSNGSGPGQLITSALEDVNIWDIKTGDLV 60

Query: 59  SVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGH 118
           S LSDGLPPG+ D + +KPAE TYLE H +T+LLA GYADGVIK+WDLMSKTVLL+F+GH
Sbjct: 61  SKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 119 KSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVST 178
           K+ +T+L+FD TGTRL+SGS+DS+II+WDLV EVG++KLRSHKD+ITG WC+GEDWL+ST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 179 AKDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKEN-GS 237
           +KDG+IKLWDLKT QC+ETHIA TGECW L V  DL++TTGTDSQ+KIW LD   +  G 
Sbjct: 181 SKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGG 240

Query: 238 KIVEKGTYEKQSKQRGLSVNFKT-TADETTFLYIQNSDKTVEIFRIRKQDEISRALKKRE 296
           K+ E G +EKQSKQRGL + F T ++D+T+F YIQN+DKT+E FRIRK++EI+R LKKRE
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 297 KRMKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSN 356
           KR+KEKG T+E+I +   ++Y S +L PFQ I+S YKIK+ SWT  ++SK+ELV+TTSSN
Sbjct: 301 KRLKEKGLTEEEIAKSIKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSN 360

Query: 357 TIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLK 416
           TIEYYSIPYEKR P +P+P K +TIE +G RT          NKLLA+ASNG LKIWN+K
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIK 420

Query: 417 TKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLD 476
           T  CIRTF+CGYALTCKFLP G L ++GTR G++QLFDL +S+L+++I+ AH+AAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 477 ITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKIS 536
           +T DGKRLVTGSADK++KFW+F +E  LVPGT +KF+PV+KL HDTTLEL DDIL V++S
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVS 540

Query: 537 PEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           P+D+YLA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 597 GLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEV 656
           GLDFGDCHKSLFAHQDSIMNV FLP+SHNFFS SKD +VKYWDG+KFEC+QKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 657 WALAITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDS 716
           WALA+ +DG  VVSSSHDHS+R+W+ET+DQVFL             DTLLTSLEEG+GD 
Sbjct: 661 WALAVATDGGFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 717 AFKADI--EDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKK 774
           AFKAD   E   DE++ V  QT+ESLK+GERLMEAL+LG +EIE LE YN+D K W++KK
Sbjct: 721 AFKADASGEGVEDEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKK 780

Query: 775 AGEPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVM 834
            GE P+KPQGNA+L+A+N+ P+QYIMDTL++I+ SQLEDAL+V+PFSYVL+FLKFID VM
Sbjct: 781 LGEAPIKPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 835 DDPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGF 894
            +  +L + L LICKNLF I+K NHKEL+SQ+N+ LK QI  VK +LR++L++  DDLGF
Sbjct: 841 QNKTLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTEDDLGF 900

Query: 895 NIQGLKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTL 936
           N+QGLKF+KQQWNL+HNYEF+           +++KR+FGT+
Sbjct: 901 NVQGLKFVKQQWNLRHNYEFVDEYDQQEKESNSARKRVFGTV 942

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 1335 bits (3456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/916 (68%), Positives = 770/916 (84%), Gaps = 1/916 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60
           MVKSYQRFEQ SVFGVI++N+NCVW+P S  +  ++G+V+TGALENI++WD+KT EL  V
Sbjct: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPSSKKSKSLGKVITGALENISVWDLKTSELEYV 60

Query: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120
           LSDGLPPGS+D+KSSKPAEV+YL++H ET L+AAGYADGVIK+WDL+SKTVLLSF+GHKS
Sbjct: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120

Query: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK 180
            +T+LKFD TGT+L+SGS DS+II+WDLVSEVG++KLRSHK  ITG+WC+ ++WL+ST+K
Sbjct: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180

Query: 181 DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240
           DGLIK+WDLKTQQC+ETHIA TGECWALG+  D VVT+  DSQ+KIW +D   E GSK++
Sbjct: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240

Query: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK 300
           EKG +EKQSKQRGLS+ F TT+D   F Y+QN+DKTVEIFR+RK  EI++A+K+REKR+ 
Sbjct: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300

Query: 301 EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY 360
           EKG T+E I+    ++YVS ++ PFQ+++S YKIK+V+WT++ ++K+E+VVTT+SNTIEY
Sbjct: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360

Query: 361 YSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLKTKSC 420
           YS+PYEKR P +P+P K +TIE +G RT          N LLA+ASNG LKIWNL TKSC
Sbjct: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420

Query: 421 IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD 480
           IRTF+CGYALTCKFLP G L V+GTREG +QLFDL +S L+ +I+ AH  AIWSLD+T D
Sbjct: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480

Query: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540
           GKRLVTGSADKSIKFW+F ++Q+L+ GT+DK+VP M ++HD+TLEL DDILS+KIS +DK
Sbjct: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540

Query: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
           +LA+SLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS D+K+IITSSADKNIKIWGLDF
Sbjct: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600

Query: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660
           GDCHKSLFAHQDSIM V FLP SHNFFS+SKDG VKYWDGDKFEC+QKLAAHQSEVWALA
Sbjct: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660

Query: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDSAFKA 720
           ++ +G  VVS SHDHS+R+W+ETDDQVFL             DTLL SLEEG+ D  FK 
Sbjct: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLEEEREKELEEQYEDTLLASLEEGNADDTFKG 720

Query: 721 DIE-DGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAGEPP 779
           D++ D  DE+T V  QT+ESLK+GERLM+AL+LG  EIE +E Y  +  +++KK+  + P
Sbjct: 721 DVKNDEDDEATRVSKQTIESLKAGERLMDALDLGIKEIEEMENYEAEMVKYKKKQRIDAP 780

Query: 780 VKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPEI 839
           VKP GNAILLA+ + P +YIMDTLI IKPSQLED+LLVLPFSYVL+FLKF D VM  P I
Sbjct: 781 VKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVPNI 840

Query: 840 LKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQGL 899
           L NRLALICKNLF I+K+N KEL+SQ+N+ LK QI+ VK++LR++LQ N DDLGFNIQGL
Sbjct: 841 LNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQGL 900

Query: 900 KFIKQQWNLKHNYEFI 915
           KFIKQQWN+KHN+EF+
Sbjct: 901 KFIKQQWNMKHNFEFV 916

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 1332 bits (3447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/939 (66%), Positives = 763/939 (81%), Gaps = 6/939 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60
           MVKSYQRFEQ SV GVI++N+NC+W+P+     S  GQVLTGALEN+N W +K+G+LLS 
Sbjct: 1   MVKSYQRFEQASVLGVISSNSNCIWIPAETRNAS--GQVLTGALENVNCWSMKSGDLLST 58

Query: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120
           LSDGLPPG++D KSSKPAE T+L+YH ET LLAAGY DGV+KIWDL+SK+VL++F+GHKS
Sbjct: 59  LSDGLPPGAVDAKSSKPAETTFLQYHPETKLLAAGYNDGVVKIWDLLSKSVLINFNGHKS 118

Query: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK 180
            +T+LKFDSTGTRL+SGS+DSDII+WDLV EVG+FKLRSHKD+ITG+WCEGEDWLVST+K
Sbjct: 119 AITVLKFDSTGTRLISGSKDSDIIVWDLVGEVGLFKLRSHKDSITGLWCEGEDWLVSTSK 178

Query: 181 DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240
           DGLIK+WDLKTQQCVETH+A  GECW++GVH DLVVT G D+QIK+W++D  K  GS + 
Sbjct: 179 DGLIKVWDLKTQQCVETHVAHVGECWSMGVHEDLVVTCGGDNQIKLWSVDYEKPVGSMLT 238

Query: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK 300
           E+GT+EKQSKQRG+SV F T +D  TF ++QN+D+TVE FR+R +DEIS+ALKKREKR+ 
Sbjct: 239 ERGTHEKQSKQRGVSVEFTTISDGVTFFFVQNADRTVETFRLRTEDEISKALKKREKRLS 298

Query: 301 EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY 360
           +KG T E+IQ    ++Y S ++ PFQI++S YKIK+  W V   SK+E+VV+TS+NT++Y
Sbjct: 299 DKGLTGEEIQANLKESYTSFIMHPFQILRSPYKIKSACWAVTTTSKLEIVVSTSNNTVDY 358

Query: 361 YSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLKTKSC 420
           YSIPY K+ PK PSP K+Y+I+ KGHRT          NKLLA+ASNG LKIWN+KTKSC
Sbjct: 359 YSIPYNKKEPKLPSPPKIYSIDIKGHRTDVRAIDISDDNKLLATASNGSLKIWNIKTKSC 418

Query: 421 IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD 480
           IRTF+CGYAL CKFLP G L VIGT+ G + LFDL +STL+ SI+ AH+ AIWSLD+T D
Sbjct: 419 IRTFECGYALACKFLPGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLDLTAD 478

Query: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540
           GKRLVTGSADKS++FW+F +EQ+LVPGTTDKFVP +K+ HDTTLELNDD+L+VKISP+++
Sbjct: 479 GKRLVTGSADKSVRFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVKISPDNR 538

Query: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
            LA+SLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKL+ITSSADKNIK+WGLDF
Sbjct: 539 LLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVWGLDF 598

Query: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660
           GDCHKSLFAH DSIM V FLPESHNFFS  KDGLVKYWDGDKFEC+QKLAAHQ EVW +A
Sbjct: 599 GDCHKSLFAHSDSIMKVAFLPESHNFFSCGKDGLVKYWDGDKFECIQKLAAHQKEVWTIA 658

Query: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDSAFKA 720
           I+ DG+ VVS+SHD S+RVW ETDDQVFL              TLL SLE+G+GD+ F  
Sbjct: 659 ISHDGTFVVSASHDQSIRVWVETDDQVFLEEEREKEMDEQYEKTLLNSLEDGAGDAMFHG 718

Query: 721 DIEDGM---DESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAGE 777
           D   G    DE+T V  QT ESLK+ ERLMEA+++G +EI    +Y +  K+W+KKK+G 
Sbjct: 719 DGNGGAEIGDEATDVHKQTTESLKASERLMEAMDMGMAEISNHLEYEQALKEWQKKKSGP 778

Query: 778 PPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDP 837
            P +PQ N+IL+AIN+ P +YIMD L +IKPSQLEDALLVLPFSYVL+FL FI++V++D 
Sbjct: 779 HPGRPQPNSILIAINKTPLEYIMDVLARIKPSQLEDALLVLPFSYVLEFLHFIELVIEDK 838

Query: 838 EILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQ 897
            +++  L L+CKNLF I+KANH+EL SQ+N+ LK QI  +K  LR S++A  DDLGFNIQ
Sbjct: 839 SLVRRHLPLLCKNLFFIIKANHRELFSQKNEKLKIQIDRIKYGLRNSIKAKADDLGFNIQ 898

Query: 898 GLKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTL 936
           GLKFIKQQWNLKHN+EF              KKR+F T+
Sbjct: 899 GLKFIKQQWNLKHNFEF-SDDVIISKQDKKVKKRVFETV 936

>ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 938

 Score = 1323 bits (3424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/938 (67%), Positives = 782/938 (83%), Gaps = 1/938 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60
           MVKSYQRFEQ SVFGV+++  N +W+P+ + R +  GQ++TGALEN+N+WDIKTGEL+S 
Sbjct: 1   MVKSYQRFEQSSVFGVVSSGDNSIWIPAENKRTNGPGQIITGALENVNIWDIKTGELVSH 60

Query: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120
           LSDGLPPG+ID +++KPAEVTY++Y+ +T+LLA GYADGVIKIWD+ SKTVLLSF+GH+S
Sbjct: 61  LSDGLPPGAIDARTTKPAEVTYMQYYSDTSLLAVGYADGVIKIWDMFSKTVLLSFNGHRS 120

Query: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK 180
            VT L FDSTGTRL+SGSRDS+II+WDLVSEVG++KLRSHKD+ITG+    E+WL+S +K
Sbjct: 121 AVTQLLFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDSITGLSLPDENWLMSVSK 180

Query: 181 DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240
           DGLIKLWDLK QQCVETHIA  GECWALGV  D+VVTT +DSQIKIW+LD   + G K+ 
Sbjct: 181 DGLIKLWDLKIQQCVETHIAHPGECWALGVDEDVVVTTSSDSQIKIWHLDLDADAGVKVT 240

Query: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK 300
           EKG +EKQSKQRG++V+F T +D T F Y+QN+DKT+EI R+RK++EISRALKKREKR K
Sbjct: 241 EKGIFEKQSKQRGVAVSFITVSDGTKFFYVQNADKTLEIIRLRKEEEISRALKKREKRFK 300

Query: 301 EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY 360
           EKG TDE+IQQ F ++Y+S+++  FQ+++S +KI+A SW V  +SK+EL VTTS NTIEY
Sbjct: 301 EKGMTDEEIQQNFKESYISIIMHSFQVLRSAFKIRAASWAVTTSSKLELTVTTSGNTIEY 360

Query: 361 YSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLKTKSC 420
           YSIPYEKR PK+P+P ++++IE +GHRT           KLLA+ASNGLLKIWN++TK+C
Sbjct: 361 YSIPYEKREPKHPTPIRVHSIELQGHRTDVRAIDISDDGKLLATASNGLLKIWNIRTKTC 420

Query: 421 IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD 480
           +RTF+CGYALTCKFLP G L ++GTR GQ+QLFDL +ST++E+ + AH+AAIWSLDIT D
Sbjct: 421 LRTFECGYALTCKFLPGGVLVIVGTRSGQLQLFDLASSTILENNEEAHDAAIWSLDITSD 480

Query: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540
           G+RLVTGSADK++KFWNF +E+  VPGTTDK +P M L HDTTLE++DDILSVKISPE+K
Sbjct: 481 GRRLVTGSADKTVKFWNFIVEEKKVPGTTDKLIPTMSLHHDTTLEMSDDILSVKISPENK 540

Query: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
            LAVSLLDNTVKVF+L++MKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF
Sbjct: 541 LLAVSLLDNTVKVFYLETMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660
           GDCHKSLFAHQDSIMNV FLPESHNFFS SKD  VKYWDGDKFE +QKLA HQSEVWALA
Sbjct: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDATVKYWDGDKFETIQKLAGHQSEVWALA 660

Query: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDSAFK- 719
           +   G+ V+S SHD S+RVW+ETDDQVFL             + LLTSLEEGSGDSAFK 
Sbjct: 661 VARSGTCVISVSHDSSIRVWEETDDQVFLEEERERELEEQNEEGLLTSLEEGSGDSAFKQ 720

Query: 720 ADIEDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAGEPP 779
            + +D  D++  V  QT+ESLK+GERLMEA++LG  EIEA E Y K+ + W+KKK G  P
Sbjct: 721 DEKDDDHDDAVDVHKQTVESLKAGERLMEAIDLGIPEIEAWEIYEKELQLWKKKKQGVEP 780

Query: 780 VKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPEI 839
            +PQ NAILLAIN+RP++YIMDTL++IKPSQLEDALL LPFSYVL+FLKF+D V+ D ++
Sbjct: 781 ERPQDNAILLAINKRPEEYIMDTLVRIKPSQLEDALLTLPFSYVLKFLKFLDTVLQDKKL 840

Query: 840 LKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQGL 899
           L N L+LICKNLF IV++NH+EL+SQ+N+ LK++IT VKN+LR +L+ N DDLGFNI+GL
Sbjct: 841 LHNHLSLICKNLFFIVQSNHRELVSQKNEELKQRITRVKNELREALKNNEDDLGFNIEGL 900

Query: 900 KFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTLA 937
           KFIKQQWNLKHNYEF+            +KKR+F TL+
Sbjct: 901 KFIKQQWNLKHNYEFVDEFDQRKQAEKTAKKRVFETLS 938

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 1318 bits (3411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/939 (65%), Positives = 764/939 (81%), Gaps = 6/939 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60
           MVKSYQRFEQ+SVFGVI++N+NC+WLP+ +  +++ GQVLTGALEN+N W +K+GEL+  
Sbjct: 1   MVKSYQRFEQESVFGVISSNSNCLWLPAEN--RNSTGQVLTGALENVNCWSMKSGELIGT 58

Query: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120
           L+DGLPPG++D KS+KPAE +YL+YH ET LLA GY DG IKIWDL+SK+VL+SF+GHKS
Sbjct: 59  LTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGHKS 118

Query: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK 180
            +TIL FD TGTRL+SGSRDSDII+WDLV EVG++KLRSHKD+ITG+WCEGE+WL+ST+K
Sbjct: 119 AITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLISTSK 178

Query: 181 DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240
           DGLIK+WDLK QQCVETH+A  GECW++GVH DLV+T G D+QIK+WNL+  +  GS ++
Sbjct: 179 DGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNLNFEESAGSMLI 238

Query: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK 300
           EKGT+EKQS+QRG+++ F T +DETTF +IQN+D++VE FR+RKQDEI++ALKKREKR+ 
Sbjct: 239 EKGTHEKQSRQRGVAIQFTTVSDETTFFFIQNADRSVETFRLRKQDEIAKALKKREKRLT 298

Query: 301 EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY 360
           EKG ++++IQQ   D++ S ++ PFQI++S YK+++V W     SK++LVVTT++NT++Y
Sbjct: 299 EKGLSEDEIQQNLKDSFTSFIMHPFQIVRSIYKVRSVCWATTTTSKLDLVVTTANNTVDY 358

Query: 361 YSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLKTKSC 420
           YSI Y+KR P  PSP KL++I+ +GHR+          NKLLA+ASNG LKIWN+KT SC
Sbjct: 359 YSIKYQKREPTMPSPPKLHSIDIRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSC 418

Query: 421 IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD 480
           IRTF+CGYAL CKFLP G L V+GT+ G + L+DL +STL+ +I+ AH+ AIWSLD+T D
Sbjct: 419 IRTFECGYALACKFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTD 478

Query: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540
           GKRLVTGSADK++ FW+F +EQ+ VPGTTDKF P +K+ HDTTLELNDD+L+VKISP+++
Sbjct: 479 GKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNR 538

Query: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
            LAVSLLDNTVKVFF+DSMKFFLSLYGHKLPVLSIDISFDSKL+ITSSADKNIKIWGLDF
Sbjct: 539 LLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDF 598

Query: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660
           GDCH+SLFAH DSIM V F+PESHNFFS SKD LVKYWDGDKFEC+QKLAAHQ EVW LA
Sbjct: 599 GDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEVWTLA 658

Query: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDSAFKA 720
           I+SDG  VVS+SHD S+RVW ETDDQVFL              TLL SLE G+GD  F+ 
Sbjct: 659 ISSDGRFVVSASHDQSIRVWSETDDQVFLEEERERESDEQYEKTLLNSLENGAGDDMFEK 718

Query: 721 DIE-DG--MDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAGE 777
           D   DG   D++T V  QT ESLK+ E+LMEAL+LG SEI  L +Y K  KQWEKK++G 
Sbjct: 719 DGNGDGEITDQATDVHKQTTESLKASEKLMEALDLGMSEINNLLEYEKALKQWEKKRSGP 778

Query: 778 PPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDP 837
            P KP  N+IL+AIN+ P +YIMD L+KIKPSQLEDALLVLPF+YVL FL FID+V+ + 
Sbjct: 779 HPGKPLPNSILVAINKTPLEYIMDVLVKIKPSQLEDALLVLPFTYVLTFLHFIDLVLKEK 838

Query: 838 EILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQ 897
           E+ + RL LIC+NLF I+K+NH+EL SQ+N+ LK Q+  +K+ LR S++A  DDLGFNIQ
Sbjct: 839 ELARRRLPLICRNLFFIIKSNHRELFSQKNEELKIQMNRIKDGLRKSIKAKSDDLGFNIQ 898

Query: 898 GLKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTL 936
           GL FIKQQWN+KHN+EF             +KKR+F TL
Sbjct: 899 GLTFIKQQWNMKHNFEF-SDDITVNKTNEKAKKRVFETL 936

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 1294 bits (3349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/944 (68%), Positives = 777/944 (82%), Gaps = 13/944 (1%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60
           MVKSYQRFEQ SVFGVI++N+N VW+P+ +      G ++T ALENIN+WDIKTGEL++ 
Sbjct: 1   MVKSYQRFEQTSVFGVISSNSNSVWIPNGNGP----GNIITSALENINIWDIKTGELVNQ 56

Query: 61  LSDGLPP-GSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHK 119
           L+DGLPP GSID K SKPA VTY +YH++TNLLAAGY+DGVIK+WDL+SKT+LL+F+GHK
Sbjct: 57  LTDGLPPPGSIDSKLSKPASVTYFKYHEDTNLLAAGYSDGVIKVWDLISKTILLTFNGHK 116

Query: 120 SGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWC-EGEDWLVST 178
           S +TIL FDSTGTRL+SGS DSDII+WDLVSEVG++KLRSHKD ITGIWC + E+WL+ST
Sbjct: 117 SAITILTFDSTGTRLISGSNDSDIIVWDLVSEVGLYKLRSHKDNITGIWCSDDENWLIST 176

Query: 179 AKDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKE-NGS 237
           +KDGLIK+WDLK QQCVETHIA TGECW+LG+H DLVVTT  +SQ+K W LD   + NGS
Sbjct: 177 SKDGLIKVWDLKIQQCVETHIAHTGECWSLGIHNDLVVTTSAESQVKFWKLDLENQPNGS 236

Query: 238 KIVEKGTYEKQSKQRGLSVNFKTT-ADETTFLYIQNSDKTVEIFRIRKQDEISRALKKRE 296
           K+VEKG +EKQSKQRGLSV F T+  D+ +F +IQN+DKTVEIFRIRK+DEI +ALKKRE
Sbjct: 237 KLVEKGIFEKQSKQRGLSVEFITSKGDDVSFFHIQNADKTVEIFRIRKKDEIEKALKKRE 296

Query: 297 KRMKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSN 356
           KR+KEKG TD++I Q   + +VS ++ PFQ ++STYKIK+V WT A +SK+ELVVTTSSN
Sbjct: 297 KRLKEKGMTDDEIAQNVDEAFVSFLMHPFQTVRSTYKIKSVCWTHATSSKLELVVTTSSN 356

Query: 357 TIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLK 416
           TIEYYS+ Y KR+P+   PSK++TIE  G RT          NKLLA+ASNGLLKIWNLK
Sbjct: 357 TIEYYSVTYAKRIPQ--PPSKIHTIELHGQRTDIRSIAISDDNKLLATASNGLLKIWNLK 414

Query: 417 TKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLD 476
           T  CIRTF+CGYAL CKFLP G L ++GTR G++QLFDL +ST +E+I+ AH+AAIWSLD
Sbjct: 415 THKCIRTFECGYALCCKFLPGGLLVIVGTRNGELQLFDLASSTQLENIEDAHDAAIWSLD 474

Query: 477 ITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKIS 536
           IT DGKRL+TGSADK++KFW+F ++Q  V GT D ++PV+KL HDTTLE+ +DIL V++S
Sbjct: 475 ITSDGKRLITGSADKTVKFWDFKLDQQKVEGTRDSYIPVLKLFHDTTLEIGEDILCVRLS 534

Query: 537 PEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           P+DK+LAVSLLD TVK+FFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW
Sbjct: 535 PDDKFLAVSLLDYTVKIFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 594

Query: 597 GLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEV 656
           GLDFGDCHKSLFAH DSIMNV FL  SHNFFS SKDG +KYWDGDKFEC+QKL AHQ+EV
Sbjct: 595 GLDFGDCHKSLFAHADSIMNVKFLNNSHNFFSCSKDGTIKYWDGDKFECIQKLVAHQNEV 654

Query: 657 WALAITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDS 716
           W++AI  D S VVSSSHDHS+R+W+ET+DQVFL             +TLL SLEEG+GDS
Sbjct: 655 WSIAIADDSSFVVSSSHDHSLRIWEETEDQVFLEEEREREMEEQYENTLLNSLEEGTGDS 714

Query: 717 AFKADIE--DGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKK 774
           AFK+D +  +  DE+T V  QT ESLK+GERLMEAL+LG  EIE  E Y KD + W+KKK
Sbjct: 715 AFKSDTKGSEDEDEATDVHKQTAESLKAGERLMEALDLGIEEIEKNETYLKDLELWKKKK 774

Query: 775 -AGEPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIV 833
             G+ P+KPQGNAIL AIN+ P+QYI++TLIKIKPSQLEDA+LV PFSYVL+FLKFIDIV
Sbjct: 775 IGGDAPIKPQGNAILTAINKTPEQYILETLIKIKPSQLEDAILVFPFSYVLKFLKFIDIV 834

Query: 834 MDDPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLG 893
           ++DP++L N L LICKNLF ++K+NHKELISQ+N+ LK Q+  VK++LR +L+ N DDLG
Sbjct: 835 LNDPKVLNNHLTLICKNLFFVIKSNHKELISQKNEDLKLQVDRVKDRLRGALRKNEDDLG 894

Query: 894 FNIQGLKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTLA 937
           +NIQGLKFIKQQWNL HN+EF            + KKR+FGT+ 
Sbjct: 895 YNIQGLKFIKQQWNLTHNFEFNDELDQNVQESKSGKKRVFGTIV 938

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 1268 bits (3282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/942 (62%), Positives = 764/942 (81%), Gaps = 7/942 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWL-PSSDSRKS-NVGQVLTGALENINLWDIKTGELL 58
           MVKSYQRFEQ +VFGVI++N+N VW+ P +  RK+ N+GQV+ G LENI +WDIKTGE +
Sbjct: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60

Query: 59  SVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGH 118
           + L+DGLPPG+ D K SKPAE T+L+YH ETNLLAAGYADGVIKIWDL+SKTVL+SF+GH
Sbjct: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120

Query: 119 KSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVST 178
           KS +T+L FD+TGTRL+S S+DSDII+WDLV E G++KLRSHKDAITG+WCE E+WL+ST
Sbjct: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180

Query: 179 AKDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSK 238
           +KDGL+K+WDLK+QQCVETH+A TGECW+LG+  D+ VT   DSQ+K+W LD   ENGSK
Sbjct: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240

Query: 239 IVEKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKR 298
           + EKG  EKQSKQRG+ ++F    D   F YIQN+DKT+EI+R+RK++EISRALKKREKR
Sbjct: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300

Query: 299 MKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTI 358
           +++KG ++E+I++  + + VSLM   FQ+++S YKIK+  WTV +NSK+ELVVTTS+N+I
Sbjct: 301 LQDKGMSEEEIKEA-MGSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359

Query: 359 EYYSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLKTK 418
           EYYSIPY KR P  P+P KL+TI+  G RT          NKLLA+ASNG LKIWN+KTK
Sbjct: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419

Query: 419 SCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDIT 478
            CIR+F+CGYALTCKFLP G L V+GTR G++QLFD+ +ST++++ + AH+AAIWSLD+T
Sbjct: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479

Query: 479 QDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPE 538
            DG++LVTGSADK+++FW F + +  V   ++K +P+++L HDTTLEL+DDILSV ISP+
Sbjct: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539

Query: 539 DKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           DK++AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS+DSKLI+T SADKNIKIWGL
Sbjct: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599

Query: 599 DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWA 658
           DFGDCHKSLFAHQDSIMNV FLPES+NFFS SKD  VKYWDG KFEC+QKLAAHQSEVW+
Sbjct: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659

Query: 659 LAITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGD--- 715
           +++++DG+ V+S+ HDHS+RVW+ET+DQVFL             DTLLTSLE G+GD   
Sbjct: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719

Query: 716 SAFKADIEDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKA 775
           S  K D E+  +E   V  QT+ESLK+GERLMEALE+G ++I A+E++N+    W+K K 
Sbjct: 720 SVKKGDNEES-EEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSKK 778

Query: 776 GEPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMD 835
           G  P++PQ N +L+A+ + P++YI++TL+KIKPSQ+EDAL+V+PFSY+L+FLKFID+V  
Sbjct: 779 GIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTT 838

Query: 836 DPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFN 895
              +L+  ++L+CK LF +++ N+KEL++Q+N  LK QIT VK+ LR SL++NVD+LGFN
Sbjct: 839 KAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFN 898

Query: 896 IQGLKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTLA 937
           I+G+KFIKQQW L H+ EF            +SKKR+FGTLA
Sbjct: 899 IEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTLA 940

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 1264 bits (3270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/942 (66%), Positives = 758/942 (80%), Gaps = 5/942 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKS-NVGQVLTGALENINLWDIKTGELLS 59
           MVKSYQRFEQ +VFGVI++ AN VWLP    R S + GQ++T ALEN+N+WDIKTGEL++
Sbjct: 1   MVKSYQRFEQSAVFGVISSEANNVWLPPLKGRSSGSPGQIITSALENVNIWDIKTGELIA 60

Query: 60  VLSDGLPPGSIDVK-SSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGH 118
            L DG+ PGS D K ++KPAEVT+L+YH +++LLA GY DG IK+WDL+SKTVL++ +GH
Sbjct: 61  QLQDGITPGSADSKVNTKPAEVTFLQYHPDSSLLAVGYRDGNIKVWDLVSKTVLINLNGH 120

Query: 119 KSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGE-DWLVS 177
           KS +T+LKFD   TRL+SGS DS+IIIWDLVSEVG+ KLRSHKD I+ ++ + + +WL+S
Sbjct: 121 KSSITVLKFDVNCTRLVSGSSDSNIIIWDLVSEVGICKLRSHKDRISDLYVDDDFNWLLS 180

Query: 178 TAKDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGS 237
            +KDGLIK+WDLKT QCVETHIA TGECW+LG+  D+V+TT   SQIK+W+LD   E GS
Sbjct: 181 VSKDGLIKVWDLKTNQCVETHIAHTGECWSLGIKDDVVITTSNTSQIKLWSLDLDGEVGS 240

Query: 238 KIVEKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREK 297
           K++EKG YEKQSKQRG SV F   +    F  I N+DKT+EIFRIR Q+EI+RALKKREK
Sbjct: 241 KLIEKGVYEKQSKQRGTSVKFIENSSGVAFFAIGNADKTIEIFRIRPQEEITRALKKREK 300

Query: 298 RMKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNT 357
           R+KEKG  DE IQQ   +++VS M+  FQ ++S +K+K+ SWT A NSK+ELV TTSSNT
Sbjct: 301 RLKEKGMEDEDIQQNIKESFVSTMMHSFQTVRSAFKLKSFSWTFATNSKLELVATTSSNT 360

Query: 358 IEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLKT 417
           IEYY+I YEKR P  P+P++LYTIE +G RT          N LLA+ASNGLLKIWNL+T
Sbjct: 361 IEYYTIAYEKREPTQPAPNRLYTIELQGLRTDIRATDISDDNMLLATASNGLLKIWNLRT 420

Query: 418 KSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDI 477
           K CIRTFDCGYALTCKFLP G L ++GTR G++QLFDL +ST IE+I+ AH+AAIWSLD+
Sbjct: 421 KQCIRTFDCGYALTCKFLPGGLLVILGTRNGELQLFDLASSTQIENIEGAHDAAIWSLDL 480

Query: 478 TQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISP 537
           T +GKRLVTGSADK++KFW+F +EQ  + GT+ K    + L HDTTLELNDD+L VKISP
Sbjct: 481 TSNGKRLVTGSADKTVKFWDFQLEQLPIEGTSGKSESKLTLNHDTTLELNDDVLCVKISP 540

Query: 538 EDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           EDK+LAVSLLDNTVK+FFLD+MKFFLSLYGHKLPVLSIDISFDSK++ITSSADKNIKIWG
Sbjct: 541 EDKHLAVSLLDNTVKIFFLDTMKFFLSLYGHKLPVLSIDISFDSKMVITSSADKNIKIWG 600

Query: 598 LDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVW 657
           LDFGDCHKSLFAHQDSIMNV FLPESHNFFS SKDG VKYWDGDKFECVQKL +HQSEVW
Sbjct: 601 LDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGQVKYWDGDKFECVQKLVSHQSEVW 660

Query: 658 ALAITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDSA 717
            LA+  DGS VVS+SHDHS+R+W+ET+DQVFL             +TLL SLEEG+GD A
Sbjct: 661 CLAMGLDGSFVVSTSHDHSIRIWQETEDQVFLEEEREKEMEEQYEETLLNSLEEGTGDDA 720

Query: 718 FKADIEDGM-DESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAG 776
           FK D  DG  DE+T V  QT+ESLK+ E+LM+AL+LG +EIEA+E+YN D   W+KKK G
Sbjct: 721 FKKDSVDGEGDEATDVHKQTIESLKANEKLMDALDLGLTEIEAMERYNSDMALWKKKKIG 780

Query: 777 -EPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMD 835
            E PVKP GNA+LLA+ + P+QYIM+TL +IKPSQLEDALL+LPFSYVL+FLKFIDIV+ 
Sbjct: 781 SEMPVKPSGNAVLLAVKKSPEQYIMETLARIKPSQLEDALLILPFSYVLKFLKFIDIVLK 840

Query: 836 DPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFN 895
           + ++L N LALICKNLF IV+ NHKELISQ+N+ LK QIT VK +LR +L+ N D LGFN
Sbjct: 841 NKKMLHNYLALICKNLFFIVRTNHKELISQKNEELKLQITRVKQELRNTLKQNEDALGFN 900

Query: 896 IQGLKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTLA 937
           IQGLKFIKQQW+LKHN+EF+            +KKRIF TL 
Sbjct: 901 IQGLKFIKQQWDLKHNFEFVDEYDQRIQEEKKAKKRIFETLV 942

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 1262 bits (3265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/938 (63%), Positives = 756/938 (80%), Gaps = 3/938 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60
           MV SYQRFEQ S FGVI +N+NCVW+P+  SR S  GQ++T +LENIN WDIKTG LL  
Sbjct: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSP-GQIITSSLENINCWDIKTGNLLKT 59

Query: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120
           LSD +PPGSID K  KPAEV YLEYH ETNLLAAGYADGVIKIWD+ ++TVL+ F+ H +
Sbjct: 60  LSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTA 119

Query: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK 180
            +T LKFD +GTRL+SGSRDS+IIIWDLV EVG+ KLRSHKD+ITGIW E +DWL+ST+K
Sbjct: 120 AITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSK 179

Query: 181 DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240
           DGLIK+WD+K+QQCVETH+A T ECW+L +  DLVVT   DS++KIW LD  +ENGSK+ 
Sbjct: 180 DGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLK 239

Query: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK 300
           EKG YEKQS+QR + V   T  DE  F Y+QN+DKT E+FRIR   E+S+ALKKREKR+K
Sbjct: 240 EKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTSSELSKALKKREKRLK 299

Query: 301 EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY 360
           EKG ++++IQ+    ++V+ ++QPFQ+++S++K K+ +WT  + SK+ELV TTS+NTIEY
Sbjct: 300 EKGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEY 359

Query: 361 YSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLKTKSC 420
           YSIPY+ + P   + SKLYTIE +GHRT          NKLLA+ASNG+LKIWN+ T+SC
Sbjct: 360 YSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSC 419

Query: 421 IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD 480
           IRTFDCGYAL CKFLP GTL V+GTR G++QLFDL +S ++E+ + AH+AAIWSLD+T D
Sbjct: 420 IRTFDCGYALCCKFLPGGTLVVVGTRGGELQLFDLASSIVLENKEAAHDAAIWSLDLTSD 479

Query: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540
           G+RL+TGSADK++KFWNF +E++L+  +TDK+   ++++HDTTLEL +DILSVKISPED+
Sbjct: 480 GRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDR 539

Query: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
           +LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDIS+DSKLIITSSADKNIKIWGLDF
Sbjct: 540 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDF 599

Query: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660
           GDCH+SLFAHQD+IMNV F+P+SHNFFS  KDG++KYWDG KF+C+QKL AH+SEVWALA
Sbjct: 600 GDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA 659

Query: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDSAFKA 720
           ++SDG   VS SHD S+RVW+ET+DQVFL             + LL++LE  + D  F  
Sbjct: 660 LSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFAR 719

Query: 721 DIEDGMD--ESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAGEP 778
           + E+  D  E T V  QT+ESLK+GERLMEAL+LG SE+EA E+Y+++   W K K+G+ 
Sbjct: 720 NSEEDTDVTEVTDVHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSGDQ 779

Query: 779 PVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPE 838
           P+KPQ N+IL+A+N+ P++YIMDTL++IKP+QLEDALLVLPFSYVL+FLKFID  ++  +
Sbjct: 780 PMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQ 839

Query: 839 ILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQG 898
           ++ N L LIC+NL  +VK NHKELI+Q+N+ LK QI  VK+KLR +L+ N+DDLGFNI+G
Sbjct: 840 LVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEG 899

Query: 899 LKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTL 936
           LKFIKQQWN+KHN+EF+           +SKKR+F T+
Sbjct: 900 LKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937

>AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR129W
           (DIP2)
          Length = 935

 Score = 1259 bits (3259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/938 (64%), Positives = 746/938 (79%), Gaps = 5/938 (0%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60
           MVKSYQRFEQ  VFGV+T N+NCVWLPS    K++ GQV+TGALE +  W+IKTGELL  
Sbjct: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQ--AKNSPGQVITGALEEVKCWEIKTGELLKT 58

Query: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120
           + DGLPPG+ID K+ KPAE TYL+YH+ET +LA GYADG IKIWD+ ++TVL+ F  H S
Sbjct: 59  MRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSS 118

Query: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK 180
            +TIL+FD TGTRL+SGSRD+ II+WDLV+E G+ KLRSHKDAITGIWCE +DWL+S +K
Sbjct: 119 AITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSK 178

Query: 181 DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240
           DGLIKLWD+K  QCVETH+A TGECW+L V  ++V+T   +S+IK+W LD  + NGS ++
Sbjct: 179 DGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLL 238

Query: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK 300
           EKG+YEKQSKQR   ++F T AD TTF Y  NSDKT+EIFRIR + EI++ALKKREKR K
Sbjct: 239 EKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFK 298

Query: 301 EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY 360
           EKG +DE+IQ+ F ++Y +L+L PFQ+++S +K+KA SWTV   SK+ELV+TT++NTIEY
Sbjct: 299 EKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEY 358

Query: 361 YSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLKTKSC 420
           YSIPY+K+ P  P+  KL++IE  GHRT          +KLLA+ASNG LK+WN+KTK+C
Sbjct: 359 YSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTC 418

Query: 421 IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD 480
           IR  DCGYAL CKFLP G L ++GTR GQ+QLFDL +ST++E+I+ AH AAIWSLD+T D
Sbjct: 419 IRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSD 478

Query: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540
           GKRLVT SADK++KFW+F +EQ+LV GT DKFVP MKLIHDTTL+L +D+  VKISPED+
Sbjct: 479 GKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDR 538

Query: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
           +LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS DSKLIITSSADKNIKIWGLDF
Sbjct: 539 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDF 598

Query: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660
           GDCHKSLFAHQDSIMNV FLPESHNFFS SKDG VKYWDG+ F+C+QKL  HQ EVWALA
Sbjct: 599 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALA 658

Query: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDSAFKA 720
           ++SDG  VVS SHD S+RVW+ET+DQVFL              TLLTSLE GSGD AF +
Sbjct: 659 VSSDGQAVVSVSHDRSIRVWEETEDQVFLEEEREKELEEQYEKTLLTSLEGGSGDDAFIS 718

Query: 721 DIEDGMD--ESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAGEP 778
           +  D     EST V  QT+ESLK+GERLMEAL+LG +EI+A EKY +  K W  KK G+ 
Sbjct: 719 NNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLW-NKKLGDQ 777

Query: 779 PVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPE 838
           P KPQ NAIL A+++ P+ Y+M+TL KIKPSQLEDALLVLPFSYVL+FLKFIDI + +  
Sbjct: 778 PTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKNDV 837

Query: 839 ILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQG 898
           IL  +L L+CK L  +V++NHKEL+SQ+N+ LK QI  VK++LR +L+++VDDLGFNIQG
Sbjct: 838 ILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNIQG 897

Query: 899 LKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTL 936
           LKF++  WN+ HNY+F            +SKKR+F T 
Sbjct: 898 LKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPTF 935

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 1159 bits (2999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/942 (59%), Positives = 723/942 (76%), Gaps = 13/942 (1%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60
           MVKSYQRFEQ  +FG+I+T+   ++LP+++S     G+++TGALENI +W +KT E+  V
Sbjct: 1   MVKSYQRFEQSGLFGLISTSNQSIYLPATNSTS---GKLITGALENIQIWTLKTNEV-EV 56

Query: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120
           L+DGLP G+++   SKP+ VT + +H ET LL  GY DGVIK+WDL+SK+VL+ F+GHKS
Sbjct: 57  LTDGLPIGAVETNISKPSVVTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQFNGHKS 116

Query: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGE-DWLVSTA 179
           GVT+L+ DS GTRL+SGS+DSD+IIWDLV EVG+ KLRSHKDAITGIW +   DWL+S A
Sbjct: 117 GVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDHNMDWLISVA 176

Query: 180 KDGLIKLWDLKTQ-QCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSK 238
           KDGLIK+WDLK   QCVETH+A TG+CW++ +  ++++TT  DSQ KIW LD  K NG K
Sbjct: 177 KDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWELDLEKSNGEK 236

Query: 239 IVEKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKR 298
           I E+GT+E +SKQRG+S  F T  + T F YIQN+DKT+EIFRIR ++EI +AL +REKR
Sbjct: 237 ISERGTFETESKQRGVSTEFITAPNGTRFFYIQNNDKTIEIFRIRPEEEIRKALNRREKR 296

Query: 299 MKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTI 358
           +++KG+++E+IQ+      +S++   F  ++S+YKIK+ +W  A+NSK+E+V+TTS+NTI
Sbjct: 297 LRDKGASEEEIQEAVNPNDISVLFHSFSTVRSSYKIKSSNWIQASNSKLEVVLTTSNNTI 356

Query: 359 EYYSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKIWNLKTK 418
           E Y IPY KR      P + Y +E +GHRT           KLL++ASNG LK+WNL TK
Sbjct: 357 ESYQIPYSKR--DAEPPVRRYNVELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTK 414

Query: 419 SCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDIT 478
            CIRTF CGYAL  + LP G L V+GTR+G++QLFDL +STL+ + + AH AAIWSLD+T
Sbjct: 415 KCIRTFSCGYALCSQMLPGGLLVVVGTRQGELQLFDLASSTLLSTTE-AHTAAIWSLDLT 473

Query: 479 QDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPE 538
            +GKRLVTGSADKS KFW+F + + LVPGT DK++P +KL+HDTTLEL DDIL+VKIS E
Sbjct: 474 SNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSE 533

Query: 539 DKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           D+YLAVSLLDNTVKVFF DS+KF+LSLYGHKLPVLSID S DSK++ITSSADKNIKIWG+
Sbjct: 534 DRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGV 593

Query: 599 DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWA 658
           DFGDCHKS+FAHQDSIM+V F  ++HNFFS  KDG VK WDGDKF+C+QKL  HQSEVW 
Sbjct: 594 DFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWC 653

Query: 659 LAITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDSAF 718
           +A++ DG TVVS+SHDHS+RVW+ETDDQVFL             +TLL SLE GSGD  F
Sbjct: 654 IAVSPDGRTVVSTSHDHSIRVWQETDDQVFLEEEKEREMEEEYEETLLKSLEGGSGDDQF 713

Query: 719 KADIEDG----MDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKK 774
             D   G    +DE + V  QT+ESLK+GE+LMEAL+LG +EIE+ E Y K  K W+KKK
Sbjct: 714 LRDKNSGDDGVIDEVSGVNKQTLESLKAGEKLMEALDLGVAEIESWENYEKSLKSWKKKK 773

Query: 775 AGEPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVM 834
           +GEPP+KPQ NAIL+A+  +P++YIMDTL KIKPSQLED+LLVLPFSYV++F KF D++M
Sbjct: 774 SGEPPMKPQSNAILIAMKIKPEKYIMDTLGKIKPSQLEDSLLVLPFSYVIKFFKFFDVIM 833

Query: 835 DDPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGF 894
              +++   L+LICK LF IV+ N+KEL++Q+N+ LK++I  VK  +RT LQ N DDLGF
Sbjct: 834 KQKDLVLLHLSLICKILFFIVRTNNKELVAQKNEELKQRIERVKTNIRTMLQKNADDLGF 893

Query: 895 NIQGLKFIKQQWNLKHNYEFIXXXXXXXXXXXNSKKRIFGTL 936
           NI GL FIKQQWNL+HN EF             +KKR+F T+
Sbjct: 894 NIAGLNFIKQQWNLRHNLEFTDDYSQLEHEKKVAKKRVFETV 935

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 146/656 (22%), Positives = 268/656 (40%), Gaps = 107/656 (16%)

Query: 72  VKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTG 131
           +++    ++T L+   +   L       ++KI+DL    ++ S     S   ++  DST 
Sbjct: 55  IENDDEQDITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMK-ISSPSYVVDSDSTS 113

Query: 132 TRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED----WLVSTA-KDGLIKL 186
           T L  G  D  I + D+ +      L+ H   I+ +   GE     WL+++   +G++K+
Sbjct: 114 TLLAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKI 173

Query: 187 WDLKTQQCVETHIAQTGECWALGVHGD--------LVVTTGTDSQIKIWNLDTSKENGSK 238
           WDL  ++C+ T    T     +  H           +++ G D  I  W  +  K+    
Sbjct: 174 WDLVKRKCIHTVQEHTAAVRGIDFHESKNNDESELFLISGGRDDVINYWQFNLKKK--CT 231

Query: 239 IVEKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKR 298
           +++     +Q +  G +         +  +Y   SD  +++  +    E  +A+K+  K 
Sbjct: 232 LLKTLPVSQQVESCGFA--------NSELIYTAGSDAFLQLISL----ESGKAVKRTHKP 279

Query: 299 MKEKGSTD-------EQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKI---- 347
           ++E  +          ++     D  ++L+     +   +  I+  S+    +  I    
Sbjct: 280 VEELFTVGVLSILGGSKLYMVISDQTLALINLEEALESESALIEVESYIAGNHGTIADMN 339

Query: 348 -------ELVVTTSSNTIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNK 400
                  +L + T+S T+    +  E  LP +    +LY    +GH+             
Sbjct: 340 FVGPELDKLALATNSPTLRIIPVSMEGGLPID---VELY----EGHKDLLNAVDATEDGL 392

Query: 401 LLASASNGLLKI-WNLKTKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTST 459
            LA+AS     I W  ++ S             KF+P          EG           
Sbjct: 393 WLATASKDSTAILWWYQSNSN------------KFVPYAKF------EG----------- 423

Query: 460 LIESIDVAHNAAIWSL---DITQDG--KRLVTGSADKSIKFWNFSIEQDLVP---GTTDK 511
                   H++A+ ++   +I   G  + ++T S D ++K W        VP    + + 
Sbjct: 424 --------HSSAVTAVGLPNIMHKGWPEFILTASNDLTVKKW-------AVPKPVASNES 468

Query: 512 F-VPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
           F + V+K+   T      DI ++ ++P D   A +  D T KV+ L+S +   +L  H+ 
Sbjct: 469 FELQVVKVSEYTRRAHEKDINALSVAPNDSTFATASYDKTCKVWDLESGEVKATLANHRR 528

Query: 571 PVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSS 630
            +  +      +LI T S DK IKIW LD     K+   H +++    F+ +     SSS
Sbjct: 529 GLWDVAFCQYERLIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSS 588

Query: 631 KDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWKETDDQ 686
            DGLVK WD    ECV+ L  H + +WAL +  DG  +VS+  D   + WK++ +Q
Sbjct: 589 ADGLVKIWDCSTGECVKTLDGHTNRIWALCVAEDGDLIVSADADGVFQFWKDSTEQ 644

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 92/205 (44%), Gaps = 21/205 (10%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
            A    D   K+WDL S  V  + + H+ G+  + F      + + S D  I IW L + 
Sbjct: 500 FATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTF 559

Query: 152 VGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV 210
             V     H +A+    +   +  LVS++ DGL+K+WD  T +CV+T    T   WAL V
Sbjct: 560 AVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWALCV 619

Query: 211 H--GDLVVTTGTDSQIKIWNLDTSKENGSKIVEKGTYEKQSKQRGLSV-------NFKTT 261
              GDL+V+   D   + W   T +E           ++ ++Q+ L V       N+ + 
Sbjct: 620 AEDGDLIVSADADGVFQFWKDSTEQER----------QQHNEQQHLKVEQEQSLQNYLSQ 669

Query: 262 ADET-TFLYIQNSDKTVEIFRIRKQ 285
            D T  FL     D  + +FR+ KQ
Sbjct: 670 GDWTNAFLLAITLDHPLRLFRVLKQ 694

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 73/155 (47%), Gaps = 15/155 (9%)

Query: 49  LWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMS 108
           +WD+++GE+ + L++               +V + +Y     L+A    D  IKIW L +
Sbjct: 511 VWDLESGEVKATLAN---------HRRGLWDVAFCQYE---RLIATCSGDKTIKIWSLDT 558

Query: 109 KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIW 168
             V+ +F GH + V    F +  T+L+S S D  + IWD  +   V  L  H + I  + 
Sbjct: 559 FAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWAL- 617

Query: 169 CEGE--DWLVSTAKDGLIKLWDLKTQQCVETHIAQ 201
           C  E  D +VS   DG+ + W   T+Q  + H  Q
Sbjct: 618 CVAEDGDLIVSADADGVFQFWKDSTEQERQQHNEQ 652

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 88/197 (44%), Gaps = 28/197 (14%)

Query: 331 TYKIKAVSWTVAANSKIELVVTTSSNTIEYYSIPYEK---RLPKNPSPS----------- 376
           T K  AV   VA+N   EL V   S   EY    +EK    L   P+ S           
Sbjct: 453 TVKKWAVPKPVASNESFELQVVKVS---EYTRRAHEKDINALSVAPNDSTFATASYDKTC 509

Query: 377 KLYTIEQ-------KGHRTXXXXXXXXXXNKLLASAS-NGLLKIWNLKTKSCIRTFD--C 426
           K++ +E          HR            +L+A+ S +  +KIW+L T + ++TF+   
Sbjct: 510 KVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTFAVVKTFEGHT 569

Query: 427 GYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVT 486
                C F+   T  V  + +G ++++D  T   ++++D  H   IW+L + +DG  +V+
Sbjct: 570 NAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLD-GHTNRIWALCVAEDGDLIVS 628

Query: 487 GSADKSIKFWNFSIEQD 503
             AD   +FW  S EQ+
Sbjct: 629 ADADGVFQFWKDSTEQE 645

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 65/150 (43%), Gaps = 5/150 (3%)

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
           + VP  K +     +   DI ++K++ + +YL  +     +K+F L   K   S+     
Sbjct: 44  QLVPERKTLFTIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISS- 102

Query: 571 PVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN----F 626
           P   +D    S L+     D +I +  ++ G    SL  H  +I +V F  E +      
Sbjct: 103 PSYVVDSDSTSTLLAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLL 162

Query: 627 FSSSKDGLVKYWDGDKFECVQKLAAHQSEV 656
            S   +G+VK WD  K +C+  +  H + V
Sbjct: 163 ASGDTNGMVKIWDLVKRKCIHTVQEHTAAV 192

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score =  122 bits (306), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 165/702 (23%), Positives = 280/702 (39%), Gaps = 134/702 (19%)

Query: 34  SNVGQVL-TGALENINLWDIKTGELLSVLSDGLPPGSIDV----KSSKPAEVTYLEYHDE 88
           S  G++L T  L+ IN+ D             L PGS  +     +    E+T L+   +
Sbjct: 26  SENGKILATPVLDEINIID-------------LTPGSRKILHKISNEDEQEITALKLTPD 72

Query: 89  TNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDL 148
              L       ++KI+ L +  V+ S     S   IL  DST T L  G  D  II+ D+
Sbjct: 73  GQYLTYVSQAQLLKIFHLKTGKVVRSMK-ISSPSYILDADSTSTLLAVGGTDGSIIVVDI 131

Query: 149 VSEVGVFKLRSHKDAITGIWCEGE----DWLVSTA-KDGLIKLWDLKTQQCVETHIAQTG 203
            +       + H   I+ +   G+     WL+++   +G++K+WDL  ++C+ T    T 
Sbjct: 132 ENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTS 191

Query: 204 ECWALGV-------HGDL-VVTTGTDSQIKIWNLDTSKENGSKIVEKGTYEKQSKQRGLS 255
               L +          L +++ G D  I +W+ +  K+       K        Q+  S
Sbjct: 192 AVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWDFNMKKK------CKLLKTLPVNQQVES 245

Query: 256 VNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMKEKGSTDEQIQQYFI- 314
             F    D    +Y    D   ++      D  S ++ KR         T++ I++ FI 
Sbjct: 246 CGFLKDGDGKRIIYTAGGDAIFQLI-----DSESGSVLKR---------TNKPIEELFII 291

Query: 315 ---------DTYVSLMLQPFQIIKSTYKIK------AVSWTVAANSKI------------ 347
                      ++ L  Q  Q+I     +K       V+ ++A N  I            
Sbjct: 292 GVLPILSNSQMFLVLSDQTLQLINVEEDLKNDEDTIQVTSSIAGNHGIIADMRYVGPELN 351

Query: 348 ELVVTTSSNTIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASAS- 406
           +L + T+S ++    +P +   P+   P  +   E  GH               +A+AS 
Sbjct: 352 KLALATNSPSLRIIPVP-DLSGPEASLPLDVEIYE--GHEDLLNSLDATEDGLWIATASK 408

Query: 407 NGLLKIWNLKTKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDV 466
           +    +W     SC   FD  YA   K+                               +
Sbjct: 409 DNTAIVWRYNENSC--KFDI-YA---KY-------------------------------I 431

Query: 467 AHNAAIWSL---DITQDG--KRLVTGSADKSIKFWNFSIEQDLVPGTTDKF-VPVMKLIH 520
            H+AA+ ++   +I   G  + L+T S D +IK W       ++P  T    V ++K+  
Sbjct: 432 GHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKW-------IIPKPTASMDVQIIKVSE 484

Query: 521 DTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFD 580
            T      DI ++ +SP D   A +  D T K++ L++ +   +L  HK  +  +     
Sbjct: 485 YTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQY 544

Query: 581 SKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDG 640
            KL+ TSS DK +KIW LD     K+L  H +++    F+ +     S   DGL+K WD 
Sbjct: 545 DKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDC 604

Query: 641 DKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWKE 682
              EC++ L  H + +WAL+  +DG  +VS+  D   + WK+
Sbjct: 605 SSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKD 646

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 116/269 (43%), Gaps = 21/269 (7%)

Query: 66  PPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVI---------KIWDLMSKTVLLSFS 116
           P  S+DV+  K +E T   +  + N L+    D +          KIW+L +  +  + +
Sbjct: 471 PTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLA 530

Query: 117 GHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWL 175
            HK G+  + F      L + S D  + IW L +   +  L  H +A+    +   +  L
Sbjct: 531 NHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQL 590

Query: 176 VSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIWNLDTSK 233
           +S   DGLIK+WD  + +C++T        WAL     GD++V+   D   + W  D ++
Sbjct: 591 ISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWK-DCTE 649

Query: 234 ENGSKIVEKGTYEKQSKQRGLSVNFKTTADET-TFLYIQNSDKTVEIFRIRKQDEISRAL 292
           +   +  EK   + + +Q     N+ +  D T  FL     D  + +F + K     RAL
Sbjct: 650 QEIEEEQEKAKLQVEQEQS--LQNYMSKGDWTNAFLLAMTLDHPMRLFNVLK-----RAL 702

Query: 293 KKREKRMKEKGSTDEQIQQYFIDTYVSLM 321
            +   R   +    E I    +D  +S++
Sbjct: 703 GESRSRQDTEEGKIEVIFNEELDQAISIL 731

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 137/608 (22%), Positives = 242/608 (39%), Gaps = 92/608 (15%)

Query: 124 ILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED----WLVSTA 179
           I+  DST T +  G  D  II+ D+ +       + H   I+ +   G +    WL+ + 
Sbjct: 123 IMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTNCWLLCSG 182

Query: 180 -KDGLIKLWDLKTQQCVETHIAQTGECWALGVH-----GDLVV----TTGTDSQIKIWNL 229
             +G++K+WDL  + C+ T          L V       D VV    +   D+ + +W  
Sbjct: 183 DTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDNIVNLWEF 242

Query: 230 DTSKENGSKIVEKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEIS 289
           +  K    K+++     +Q +  G   +      +   +Y    +   ++  + K   I 
Sbjct: 243 NLRKL--CKLLKTLPVNQQVESCGFIHDHDNELQD--IIYTAGGEAIFQLISLSKGSVIK 298

Query: 290 RALKKREKRMKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIE- 348
           R +K  E+ +   G+         +++Y+ +  Q  Q+I  T   KA+S T  +N  IE 
Sbjct: 299 RTVKPTEE-LFIIGTLPFTATNNDLNSYIVMSDQTLQMINLT---KALSPTELSNPIIEI 354

Query: 349 -----------------------LVVTTSSNTIEYYSIPYEKRLPKNPS--------PSK 377
                                  L + T+S T+    +P   +   +P+        P  
Sbjct: 355 ESCIAGNHGTIADMKFVGQDLNKLALATNSPTLRIIPVPSTMKEAADPNTQDNSADLPIN 414

Query: 378 LYTIEQKGHRTXXXXXXXXXXNKLLASASNGLLKI-WNLKTKSCIRTFDCGYALTCKFLP 436
           + T E  GH             + LA+AS     I W   +++  R F   YA   KF+ 
Sbjct: 415 METYE--GHTDLLNSLAATEDGQWLATASKDHTSILWKYSSETS-RFF--AYA---KFIG 466

Query: 437 -SGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKF 495
            S ++  +G     ++ +                            + L+T S D +IK 
Sbjct: 467 HSSSVTAVGLPNVLLRGYP---------------------------EFLITASNDLTIKK 499

Query: 496 WNF-SIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVF 554
           W   +  ++     +     ++K+   T    + DI S+ ISP D  +A    D + K++
Sbjct: 500 WKIPTPSKERSDDESKDKTHIIKVSEYTRHAHDKDINSISISPNDSLIATGSYDKSCKLW 559

Query: 555 FLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 614
            LDS +   +L  HK  +  +      KLI T S DK IK+W LD     K+   H +++
Sbjct: 560 NLDSGELVATLNNHKRGIWDVSFCQFDKLIATCSGDKTIKLWSLDTFAVLKTFAGHTNAV 619

Query: 615 MNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHD 674
               F+ +     SS  DGL+K WD    +C++ L  H + +WAL   +DG  +VS+  D
Sbjct: 620 QRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWALTTWNDGELIVSADAD 679

Query: 675 HSMRVWKE 682
             ++ W +
Sbjct: 680 GVLQFWND 687

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 100/212 (47%), Gaps = 11/212 (5%)

Query: 91  LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVS 150
           L+A G  D   K+W+L S  ++ + + HK G+  + F      + + S D  I +W L +
Sbjct: 546 LIATGSYDKSCKLWNLDSGELVATLNNHKRGIWDVSFCQFDKLIATCSGDKTIKLWSLDT 605

Query: 151 EVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALG 209
              +     H +A+    +   +  LVS+  DGLIK+WD  T  C++T        WAL 
Sbjct: 606 FAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWALT 665

Query: 210 V--HGDLVVTTGTDSQIKIWNLDTSKENGSKIVEKGTYEKQSKQRGLSV-NFKTTADET- 265
               G+L+V+   D  ++ WN  T  E    I++    EK+  +   S+ NF    D T 
Sbjct: 666 TWNDGELIVSADADGVLQFWNDCTELE----ILQNLENEKEKVENEQSLKNFLLNEDWTN 721

Query: 266 TFLYIQNSDKTVEIFRIRKQDEISRALKKREK 297
            FL     D  + +F + KQ  +S  L+++E+
Sbjct: 722 AFLLALTLDHPMRLFNVLKQSLLS--LQEQEE 751

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 84/177 (47%), Gaps = 20/177 (11%)

Query: 28  SSDSRKSNVGQVLTGALE-NINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYH 86
           +S S   N   + TG+ + +  LW++ +GEL++ L++               +V++ ++ 
Sbjct: 536 NSISISPNDSLIATGSYDKSCKLWNLDSGELVATLNN---------HKRGIWDVSFCQFD 586

Query: 87  DETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIW 146
               L+A    D  IK+W L +  VL +F+GH + V    F +   +L+S   D  I IW
Sbjct: 587 ---KLIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIW 643

Query: 147 DLVSEVGVFKLRSHKDAITGI--WCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQ 201
           D  +   +  L  H + I  +  W +GE  +VS   DG+++ W+     C E  I Q
Sbjct: 644 DCTTGDCLKTLDGHDNRIWALTTWNDGE-LIVSADADGVLQFWN----DCTELEILQ 695

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 79/164 (48%), Gaps = 17/164 (10%)

Query: 43  ALENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETN-LLAAGYADGVI 101
           AL+  NL  I+    ++     L P    +K+ K +  +Y+   D T+ L+A G  DG I
Sbjct: 87  ALKIYNLTAIEGETTMNTKQQSLQP----IKTLKLSSPSYIMDCDSTSTLVAVGGTDGSI 142

Query: 102 KIWDLMSKTVLLSFSGHKSGVTILKF----DSTGTRLMSGSRDSDIIIWDLVSEVGVFKL 157
            + D+ +  +  SF GH   ++ +KF    D+    L SG  +  + IWDLV    +  L
Sbjct: 143 IVVDIENGFITHSFKGHGGTISSVKFYGNNDTNCWLLCSGDTNGMVKIWDLVKRSCIHTL 202

Query: 158 RSHKDAITGIWC-----EGED---WLVSTAKDGLIKLWDLKTQQ 193
           + H  A+ G+       E ++    L+S ++D ++ LW+   ++
Sbjct: 203 QEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDNIVNLWEFNLRK 246

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 60/110 (54%), Gaps = 4/110 (3%)

Query: 399 NKLLASAS-NGLLKIWNLKTKSCIRTF--DCGYALTCKFLPSGTLCVIGTREGQIQLFDL 455
           +KL+A+ S +  +K+W+L T + ++TF         C F+      V    +G I+++D 
Sbjct: 586 DKLIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDC 645

Query: 456 VTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLV 505
            T   ++++D  H+  IW+L    DG+ +V+  AD  ++FWN   E +++
Sbjct: 646 TTGDCLKTLD-GHDNRIWALTTWNDGELIVSADADGVLQFWNDCTELEIL 694

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 82/186 (44%), Gaps = 26/186 (13%)

Query: 522 TTLELNDD--ILSVKISPEDKYL-AVSLLDNTVKVFFLDSMKFFLSLYGHKL-------- 570
           TT+  ND+  I  +K++P+ K+L +++L    +K++ L +++   ++   +         
Sbjct: 56  TTITNNDEQEITCLKLTPDGKFLISIALQSQALKIYNLTAIEGETTMNTKQQSLQPIKTL 115

Query: 571 ----PVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN- 625
               P   +D    S L+     D +I +  ++ G    S   H  +I +V F   +   
Sbjct: 116 KLSSPSYIMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTN 175

Query: 626 ---FFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWAL---AITSDGSTVV----SSSHDH 675
                S   +G+VK WD  K  C+  L  H S V  L   +++ +   VV    S S D+
Sbjct: 176 CWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDN 235

Query: 676 SMRVWK 681
            + +W+
Sbjct: 236 IVNLWE 241

 Score = 35.0 bits (79), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 58/149 (38%), Gaps = 29/149 (19%)

Query: 114 SFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVF----KLRSHKDAITGIWC 169
           ++ GH   +  L     G  L + S+D   I+W   SE   F    K   H  ++T +  
Sbjct: 417 TYEGHTDLLNSLAATEDGQWLATASKDHTSILWKYSSETSRFFAYAKFIGHSSSVTAVGL 476

Query: 170 EG------EDWLVSTAKDGLIKLWDLKT--------QQCVETHIAQTGE----------- 204
                    ++L++ + D  IK W + T        +   +THI +  E           
Sbjct: 477 PNVLLRGYPEFLITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHAHDKDIN 536

Query: 205 CWALGVHGDLVVTTGTDSQIKIWNLDTSK 233
             ++  +  L+ T   D   K+WNLD+ +
Sbjct: 537 SISISPNDSLIATGSYDKSCKLWNLDSGE 565

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score =  116 bits (290), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 151/656 (23%), Positives = 265/656 (40%), Gaps = 102/656 (15%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           E+T L+       L       +++I+ L SK ++ S     S V ++  DS+ T +  G 
Sbjct: 62  EITALKLTPNGEYLCFVSQAQLLRIYKLSSKKIIRSMKV-SSPVYVMDCDSSSTLVALGG 120

Query: 139 RDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED----W-LVSTAKDGLIKLWDLKTQQ 193
            D  + + D+ +       + H   I+ +   GE     W L S    G++K+WDL  + 
Sbjct: 121 TDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRN 180

Query: 194 CVET---HIAQT-GECWALGVHGDLV---VTTGTDSQIKIWNLDTSKENGSKIVEKGTYE 246
           C+ T   H A   G  + L    D V   +T G D  + ++ L+++K+  +K++      
Sbjct: 181 CIHTIQEHAAAVRGLDFRLSPADDGVLELLTGGRDDIVNLFQLNSTKK--AKLMRTIPVH 238

Query: 247 KQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMKE----- 301
           +Q +  G    F   + + +  Y    D   +I         S ++ KR K+  E     
Sbjct: 239 QQIEACG----FIRDSPDGSLFYTAGGDAVFQILSF-----TSASVAKRTKKPIEELFII 289

Query: 302 ------KGS------TDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKI-- 347
                 +GS      +D+ +  + ++   SL     +I+   +KI     TVA    +  
Sbjct: 290 GVLPIMQGSKVYLVLSDQTL--FLVNLSASLSKDGDEIVIE-HKIAGNHGTVADMRFVGK 346

Query: 348 ---ELVVTTSSNTIEYYSIPYEKR--LPKNPSPSKLYTIEQ---------KGHRTXXXXX 393
              +L + T+S  +   + P  K     K   P+    I+          +GH       
Sbjct: 347 ELDKLALATNSPALRVITAPVTKHNAAEKEDEPTSKVDIQNCLPLEVELYEGHTDLLNSL 406

Query: 394 XXXXXNKLLASAS-NGLLKIWNLKTKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQL 452
                 + LA+ S +  + +W L   S             KF P             + L
Sbjct: 407 DSSENGEWLATCSKDHTVILWKLNADS------------EKFKPYARFTGHAGPVTAVGL 454

Query: 453 FDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKF 512
            +++ +T  E I  A N                    D +IK W+       VP  T   
Sbjct: 455 PNVMRNTWPEFIITASN--------------------DLTIKKWS-------VPKPTSND 487

Query: 513 VPVMKL-IHDTTLELND-DILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
           V +  + + D T   ++ DI ++ ISP D   A +  D T K++ +DS +   +L  HK 
Sbjct: 488 VDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKR 547

Query: 571 PVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSS 630
            +  +      KL+ T S DK IK+W L+     K+L  H +++    F+  +    S+ 
Sbjct: 548 GLWDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTG 607

Query: 631 KDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWKETDDQ 686
            DGL+K WD    EC++ L AH + +WAL++ SDG   V++  D   + WK+  ++
Sbjct: 608 ADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWKDCSEE 663

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 98/225 (43%), Gaps = 13/225 (5%)

Query: 73  KSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGT 132
           + +   ++  L      ++ A    D   KIW++ S  +  + + HK G+  + F     
Sbjct: 500 RRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDK 559

Query: 133 RLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKT 191
            L + S D  I +W L S   V  L  H +A+    +      +VST  DGLIK+WDL T
Sbjct: 560 LLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLST 619

Query: 192 QQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIWNLDTSKENGSKIVEKG---TYE 246
            +C+ T  A +   WAL V   G   VT   D   + W  D S+E   + +E       +
Sbjct: 620 GECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWK-DCSEEEQKENLENQKLMVEQ 678

Query: 247 KQSKQRGLSVNFKTTADET-TFLYIQNSDKTVEIFRIRKQDEISR 290
           +QS Q     N+    D T  FL     +  + ++R+ ++   S+
Sbjct: 679 EQSLQ-----NYMAQGDWTNAFLLAMTLNHPMRLYRVLERSSASQ 718

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 59/108 (54%), Gaps = 4/108 (3%)

Query: 399 NKLLASAS-NGLLKIWNLKTKSCIRTFD--CGYALTCKFLPSGTLCVIGTREGQIQLFDL 455
           +KLLA+ S +  +K+W+L++ S ++T +        C F+      V    +G I+++DL
Sbjct: 558 DKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDL 617

Query: 456 VTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQD 503
            T   I ++D AH+  IW+L +  DGK  VT  AD   +FW    E++
Sbjct: 618 STGECIRTLD-AHSNRIWALSVLSDGKEFVTADADGVFQFWKDCSEEE 664

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 63/119 (52%), Gaps = 11/119 (9%)

Query: 72  VKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF--DS 129
           +K S P  V  ++    + L+A G  DG + + D+ +  V  SF GH + ++ +KF  + 
Sbjct: 98  MKVSSPVYV--MDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQ 155

Query: 130 TGT--RLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKL 186
           +G+  RL SG     + +WDLV    +  ++ H  A+ G+     D+ +S A DG+++L
Sbjct: 156 SGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGL-----DFRLSPADDGVLEL 209

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 67/152 (44%), Gaps = 9/152 (5%)

Query: 514 PVMKLIHDTTLELNDD--ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLP 571
           P  +LIH  T+E +D+  I ++K++P  +YL        ++++ L S K   S+     P
Sbjct: 47  PTKRLIH--TIENDDEQEITALKLTPNGEYLCFVSQAQLLRIYKLSSKKIIRSMKVSS-P 103

Query: 572 VLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN----FF 627
           V  +D    S L+     D ++ +  ++ G    S   H  +I +V F  E         
Sbjct: 104 VYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLA 163

Query: 628 SSSKDGLVKYWDGDKFECVQKLAAHQSEVWAL 659
           S    G+VK WD  +  C+  +  H + V  L
Sbjct: 164 SGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGL 195

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 18/95 (18%)

Query: 78  AEVTYLEYHDETN----LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF-----D 128
           A ++ +++H E +     LA+G   G++K+WDL+ +  + +   H + V  L F     D
Sbjct: 144 ATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGLDFRLSPAD 203

Query: 129 STGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDA 163
                L++G RD DI        V +F+L S K A
Sbjct: 204 DGVLELLTGGRD-DI--------VNLFQLNSTKKA 229

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score =  110 bits (275), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 100/199 (50%), Gaps = 5/199 (2%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLA 543
           L++ S D +IK W     +D         V V+K    T      DI ++ +SP D   A
Sbjct: 486 LLSASNDLTIKKWAVPKPED-----GKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFA 540

Query: 544 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDC 603
            +  D T K++ LD+ +   +L  HK  +  ++     KL+ T S DK +KIW LD    
Sbjct: 541 TASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDTYSV 600

Query: 604 HKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITS 663
            K+L  H +++    F+ ++    SS  DGLVK WD    ECV+ L AH + +WAL++  
Sbjct: 601 MKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWALSVLK 660

Query: 664 DGSTVVSSSHDHSMRVWKE 682
           DG  +V++  D   + WK+
Sbjct: 661 DGDIIVTADADGVFQFWKD 679

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 75/172 (43%), Gaps = 12/172 (6%)

Query: 68  GSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVI---------KIWDLMSKTVLLSFSGH 118
           G   V   K +E T   +  + N LA    D V          KIW L +  +  + + H
Sbjct: 506 GKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFATASYDKTCKIWSLDTGELEATLANH 565

Query: 119 KSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVS 177
           K G+  + F      L + S D  + IW L +   +  L  H +A+    +      LVS
Sbjct: 566 KRGLWDVNFCQYDKLLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQLVS 625

Query: 178 TAKDGLIKLWDLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIW 227
           +  DGL+KLWD  T +CV+T  A     WAL V   GD++VT   D   + W
Sbjct: 626 SGADGLVKLWDCSTGECVKTLDAHNNRIWALSVLKDGDIIVTADADGVFQFW 677

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 72/172 (41%), Gaps = 16/172 (9%)

Query: 467 AHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLEL 526
           AH   I +L ++ +     T S DK+ K W+    +                +  T    
Sbjct: 522 AHEKDINALAVSPNDSVFATASYDKTCKIWSLDTGE----------------LEATLANH 565

Query: 527 NDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIIT 586
              +  V     DK LA    D TVK++ LD+     +L GH   V        +K +++
Sbjct: 566 KRGLWDVNFCQYDKLLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQLVS 625

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYW 638
           S AD  +K+W    G+C K+L AH + I  +  L +     ++  DG+ ++W
Sbjct: 626 SGADGLVKLWDCSTGECVKTLDAHNNRIWALSVLKDGDIIVTADADGVFQFW 677

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 56/101 (55%), Gaps = 4/101 (3%)

Query: 399 NKLLASAS-NGLLKIWNLKTKSCIRTFD--CGYALTCKFLPSGTLCVIGTREGQIQLFDL 455
           +KLLA+ S +  +KIW+L T S ++T +        C F+      V    +G ++L+D 
Sbjct: 578 DKLLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDC 637

Query: 456 VTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFW 496
            T   ++++D AHN  IW+L + +DG  +VT  AD   +FW
Sbjct: 638 STGECVKTLD-AHNNRIWALSVLKDGDIIVTADADGVFQFW 677

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 94/199 (47%), Gaps = 23/199 (11%)

Query: 52  IKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETN-LLAAGYADGVIKIWDLMSKT 110
           +   +LL V    LP   I V+S K +   Y+   D T+ LLA G  DG + I D+ +  
Sbjct: 98  VSQAQLLRVYH--LPSKKI-VRSMKVSSPVYVMECDVTSTLLAIGGTDGSVSIIDIENGY 154

Query: 111 VLLSFSGHKSGVTILKF----DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITG 166
           V  SF GH   ++ +KF    +S   RL SG     + IWDLV    +  ++ H  A+ G
Sbjct: 155 VTHSFKGHGGTISSVKFHGELNSNVWRLASGDTTGVVKIWDLVKRKCLHTVQEHTMAVRG 214

Query: 167 ----IWCEGED--WLVSTAKDGLIKLWDLKTQ-QC-----VETHIAQTGECWALGVHG-- 212
               +  E ED   L+S  +D +I L+   ++ +C     +  H  Q   C  +   G  
Sbjct: 215 LDFRVLDEDEDQMQLISGGRDNIINLYQFDSRKKCKLLKTLPIH-QQVESCGFINTGGVQ 273

Query: 213 DLVVTTGTDSQIKIWNLDT 231
           + V T G+D+  +I +LDT
Sbjct: 274 NCVYTAGSDAVYQIVSLDT 292

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 62/140 (44%), Gaps = 8/140 (5%)

Query: 527 NDD---ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKL 583
           NDD   I +++I+P+ ++L        ++V+ L S K   S+     PV  ++    S L
Sbjct: 77  NDDEQEITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKVSS-PVYVMECDVTSTL 135

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN----FFSSSKDGLVKYWD 639
           +     D ++ I  ++ G    S   H  +I +V F  E ++      S    G+VK WD
Sbjct: 136 LAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLASGDTTGVVKIWD 195

Query: 640 GDKFECVQKLAAHQSEVWAL 659
             K +C+  +  H   V  L
Sbjct: 196 LVKRKCLHTVQEHTMAVRGL 215

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 69/161 (42%), Gaps = 17/161 (10%)

Query: 436 PSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKF 495
           P+ ++    + +   +++ L T  L E+    H   +W ++  Q  K L T S DK++K 
Sbjct: 534 PNDSVFATASYDKTCKIWSLDTGEL-EATLANHKRGLWDVNFCQYDKLLATCSGDKTVKI 592

Query: 496 WNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFF 555
           W+            D +  VMK +   T    + +       ++K L  S  D  VK++ 
Sbjct: 593 WSL-----------DTY-SVMKTLEGHT----NAVQRCSFISKNKQLVSSGADGLVKLWD 636

Query: 556 LDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
             + +   +L  H   + ++ +  D  +I+T+ AD   + W
Sbjct: 637 CSTGECVKTLDAHNNRIWALSVLKDGDIIVTADADGVFQFW 677

 Score = 35.4 bits (80), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 57/134 (42%), Gaps = 20/134 (14%)

Query: 567 GHKLPVLSIDISFDSKLIITSSADKNIKIWGLD----FGDCHKSLFAHQDSIM-----NV 617
           GH+  + S+D + D   + T+S D  + +W  D        +     H   +      NV
Sbjct: 418 GHEDLLNSLDATEDGMWLATASKDNFVILWRYDEQTELFKQYAKFVGHAGPVTAVGLPNV 477

Query: 618 CFLPESHNFFSSSKDGLVKYW------DGDKFECVQKLA-----AHQSEVWALAITSDGS 666
              P      S+S D  +K W      DG     V K +     AH+ ++ ALA++ + S
Sbjct: 478 MNRPWPEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDS 537

Query: 667 TVVSSSHDHSMRVW 680
              ++S+D + ++W
Sbjct: 538 VFATASYDKTCKIW 551

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 78/195 (40%), Gaps = 42/195 (21%)

Query: 115 FSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVF----KLRSHKDAITGI--- 167
           + GH+  +  L     G  L + S+D+ +I+W    +  +F    K   H   +T +   
Sbjct: 416 YEGHEDLLNSLDATEDGMWLATASKDNFVILWRYDEQTELFKQYAKFVGHAGPVTAVGLP 475

Query: 168 ------WCEGEDWLVSTAKDGLIKLWDL-KTQQCVET-HIAQTGE-----------CWAL 208
                 W E   +L+S + D  IK W + K +   +T H+ +  E             A+
Sbjct: 476 NVMNRPWPE---FLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAV 532

Query: 209 GVHGDLVVTTGTDSQIKIWNLDTSKENGSKIVEKGTYEKQSKQRGL-SVNFKTTADETTF 267
             +  +  T   D   KIW+LDT +   +           + +RGL  VNF         
Sbjct: 533 SPNDSVFATASYDKTCKIWSLDTGELEAT---------LANHKRGLWDVNF---CQYDKL 580

Query: 268 LYIQNSDKTVEIFRI 282
           L   + DKTV+I+ +
Sbjct: 581 LATCSGDKTVKIWSL 595

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 100/205 (48%), Gaps = 9/205 (4%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVPGTTDKF--VPVMKLIHDTTLELNDDILSVKISPEDKY 541
           L+T S D +IK WN       +P  +DK   + ++K    T      DI ++ +SP D  
Sbjct: 488 LLTASNDLTIKKWN-------IPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSV 540

Query: 542 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFG 601
            A +  D T K++ L++ +   +L  HK  +  +      KL+ T S DK IKIW LD  
Sbjct: 541 FATASYDKTSKIWDLETGELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTF 600

Query: 602 DCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAI 661
              ++L  H +++    F+ +     SS  DGL+K WD    ECV+ L  H + +WAL I
Sbjct: 601 SVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALTI 660

Query: 662 TSDGSTVVSSSHDHSMRVWKETDDQ 686
             DG  + S+  D   + W +  +Q
Sbjct: 661 QRDGELIASADADGVFQFWTDCSEQ 685

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 114/263 (43%), Gaps = 10/263 (3%)

Query: 65  LPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTI 124
           L  GS   + +   ++  L      ++ A    D   KIWDL +  +  + + HK G+  
Sbjct: 514 LIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLETGELTATLANHKRGLWD 573

Query: 125 LKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGL 183
           + F      L + S D  I IW L +   V  L  H +A+    +   +  LVS+  DGL
Sbjct: 574 VSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGL 633

Query: 184 IKLWDLKTQQCVETHIAQTGECWALGVH--GDLVVTTGTDSQIKIWNLDTSKENGSKIVE 241
           IK+WD  + +CV+T        WAL +   G+L+ +   D   + W  D S++   + +E
Sbjct: 634 IKIWDCSSGECVKTLDGHANRIWALTIQRDGELIASADADGVFQFWT-DCSEQQREQDLE 692

Query: 242 KGTYEKQSKQRGLSV-NFKTTAD-ETTFLYIQNSDKTVEIFRIRKQD-EISRALKKREKR 298
           +   EK+  ++  S+ N+    D    FL     D  + +F + +Q    S   +KR++ 
Sbjct: 693 R---EKELVEQEQSLQNYLANEDWANAFLLAITLDHPMRLFNVLRQSLHYSPESEKRDET 749

Query: 299 MKEKGSTDEQIQQYFIDTYVSLM 321
           +      D  I     D  V LM
Sbjct: 750 VIFNKELDHVISTLTSDQLVLLM 772

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 71/147 (48%), Gaps = 14/147 (9%)

Query: 49  LWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMS 108
           +WD++TGEL + L++               +V++ +Y     LLA    D  IKIW L +
Sbjct: 552 IWDLETGELTATLAN---------HKRGLWDVSFCQY---DKLLATCSGDKTIKIWSLDT 599

Query: 109 KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIW 168
            +V+ +  GH + V    F +  T+L+S   D  I IWD  S   V  L  H + I  + 
Sbjct: 600 FSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALT 659

Query: 169 CEGEDWLVSTA-KDGLIKLW-DLKTQQ 193
            + +  L+++A  DG+ + W D   QQ
Sbjct: 660 IQRDGELIASADADGVFQFWTDCSEQQ 686

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 86/190 (45%), Gaps = 18/190 (9%)

Query: 323 QPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEYYSIPYEKRLPKNPSPSKLYTIE 382
           +P   ++  + IK   +T  A+ K    ++ S N   + +  Y+K        SK++ +E
Sbjct: 504 KPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFATASYDK-------TSKIWDLE 556

Query: 383 Q-------KGHRTXXXXXXXXXXNKLLASAS-NGLLKIWNLKTKSCIRTFD--CGYALTC 432
                     H+           +KLLA+ S +  +KIW+L T S +RT +        C
Sbjct: 557 TGELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRC 616

Query: 433 KFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKS 492
            F+   T  V    +G I+++D  +   ++++D  H   IW+L I +DG+ + +  AD  
Sbjct: 617 HFINKQTQLVSSGADGLIKIWDCSSGECVKTLD-GHANRIWALTIQRDGELIASADADGV 675

Query: 493 IKFWNFSIEQ 502
            +FW    EQ
Sbjct: 676 FQFWTDCSEQ 685

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 94/201 (46%), Gaps = 33/201 (16%)

Query: 72  VKSSKPAEVTYLEYHDETN-LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF--- 127
           ++S K +  +Y+   + T+ L+A G  DG I + D+ +  V  SF GH   ++ LKF   
Sbjct: 125 MRSMKISSPSYIMDSEATSTLVAVGGTDGSIIVVDIENGYVTHSFKGHGGTISCLKFFGE 184

Query: 128 -DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEG--------EDWLVST 178
            +S    L SG  +  I +W+LV+      ++ H  A+ GI            +  ++S 
Sbjct: 185 ANSNVWLLASGDTNGMIKVWNLVTRKCTHTVQEHTSAVRGIDIRSISDDTKSMQLQMISG 244

Query: 179 AKDGLIKLWDL------KTQQCVETH--IAQTGECWALGVHGDLVVTTGTDSQIKIWNLD 230
            +D ++  W+L      K  Q +  H  + Q G   + G H +L+ T+G D+ ++  +L 
Sbjct: 245 GRDDVVNYWELDNKKKCKLLQTIPAHQQVEQCGFIASPG-HKNLIYTSGGDAIMQFISL- 302

Query: 231 TSKENGSKIVEKGTYEKQSKQ 251
                     EKG+  K+SK+
Sbjct: 303 ----------EKGSIVKKSKK 313

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 50/242 (20%), Positives = 109/242 (45%), Gaps = 42/242 (17%)

Query: 472 IWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDIL 531
           I  L I+Q G++L++  +D+S+ +    +E +L      K     +L +++ L  N   +
Sbjct: 321 IGVLPISQ-GEKLISVMSDQSLHY--LDVESNL------KATNEEELTYESALAGNHGTI 371

Query: 532 S--VKISPEDKYLAVSLLDNTVKVF-------FLDSMKFF---LSLY-GHKLPVLSIDIS 578
           +  V + P+ ++LA++    T+++         +D+       + +Y GH+  + ++D +
Sbjct: 372 ADMVFVGPKFQHLALATNSPTLRIIPTPLDDSTVDTNNLLPIDVDMYEGHEDLLNAVDAT 431

Query: 579 FDSKLIITSSADKNIKIWGLDFGDC----HKSLFAHQDSIM-----NVCFLPESHNFFSS 629
            D   + T+S DK   +W  D        +     H  S+      NV          ++
Sbjct: 432 EDGLWLATASKDKTAIVWRYDDETAKFKPYAKFIGHSSSVTAVGLPNVMLRHWPEFLLTA 491

Query: 630 SKDGLVKYWD----GDKFECVQKLA-------AHQSEVWALAITSDGSTVVSSSHDHSMR 678
           S D  +K W+     DK E +  +        AH+ ++ AL+++ + S   ++S+D + +
Sbjct: 492 SNDLTIKKWNIPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSK 551

Query: 679 VW 680
           +W
Sbjct: 552 IW 553

 Score = 35.4 bits (80), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 32/154 (20%), Positives = 65/154 (42%), Gaps = 5/154 (3%)

Query: 514 PVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 573
           P  + +   + E   +I ++K++ + KYL  +     +K+  + + K   S+     P  
Sbjct: 77  PTRQKLQTISNEDEQEITALKLTADGKYLCFTSQAQLLKIVEVATGKVMRSMKISS-PSY 135

Query: 574 SIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN----FFSS 629
            +D    S L+     D +I +  ++ G    S   H  +I  + F  E+++      S 
Sbjct: 136 IMDSEATSTLVAVGGTDGSIIVVDIENGYVTHSFKGHGGTISCLKFFGEANSNVWLLASG 195

Query: 630 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAITS 663
             +G++K W+    +C   +  H S V  + I S
Sbjct: 196 DTNGMIKVWNLVTRKCTHTVQEHTSAVRGIDIRS 229

>KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 826

 Score =  107 bits (266), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 102/203 (50%), Gaps = 5/203 (2%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLA 543
           ++T S D +IK W         PG       V+K+   T    + DI ++ ISP D   A
Sbjct: 469 IITASNDLTIKKWTVP-----KPGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFA 523

Query: 544 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDC 603
            +  D T KV+ +DS +   +L  HK  +  +      KL+ T S DK +K+W LD    
Sbjct: 524 TASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSV 583

Query: 604 HKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITS 663
            K+L  H +++    F+ ++    S+  DGL+K WD    ECV+ L AH++ +WAL++  
Sbjct: 584 VKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALSVLH 643

Query: 664 DGSTVVSSSHDHSMRVWKETDDQ 686
           DG   V++  D   + WK+  ++
Sbjct: 644 DGDEFVTADADGVFQFWKDCSEE 666

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 89/195 (45%), Gaps = 7/195 (3%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
            A    D   K+WD+ S  +  + + HK G+  + F      L + S D  + +W L + 
Sbjct: 522 FATASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTL 581

Query: 152 VGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV 210
             V  L  H +A+    +      LVST  DGLIKLWDL T +CV T  A     WAL V
Sbjct: 582 SVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALSV 641

Query: 211 --HGDLVVTTGTDSQIKIWNLDTSKENGSKIVEKGTYEKQSKQRGLSVNFKTTADET-TF 267
              GD  VT   D   + W  D S+E   + +E   ++++ +Q     N+ +  D T  F
Sbjct: 642 LHDGDEFVTADADGVFQFWK-DCSEEQEKENLEN--HKRKVEQDQSLQNYMSQGDWTNAF 698

Query: 268 LYIQNSDKTVEIFRI 282
           L     D  + ++R+
Sbjct: 699 LLAMTLDHPMRLYRV 713

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 53/101 (52%), Gaps = 4/101 (3%)

Query: 399 NKLLASAS-NGLLKIWNLKTKSCIRTFD--CGYALTCKFLPSGTLCVIGTREGQIQLFDL 455
           +KLLA+ S +  +K+W+L T S ++T +        C F+      V    +G I+L+DL
Sbjct: 561 DKLLATCSGDKTVKVWSLDTLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDL 620

Query: 456 VTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFW 496
            T   + ++D AH   IW+L +  DG   VT  AD   +FW
Sbjct: 621 STGECVRTLD-AHENRIWALSVLHDGDEFVTADADGVFQFW 660

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 84/180 (46%), Gaps = 20/180 (11%)

Query: 72  VKSSKPAEVTY-LEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF--- 127
           V+S K +   Y ++    + L+A G  DG + + D+ +  V  S  GH + ++ +KF   
Sbjct: 95  VRSMKVSSPVYVIDCDPSSTLVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGE 154

Query: 128 -DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDW------LVSTAK 180
            +ST  RL SG  +  + +WDLV    +  ++ H  A+ G+     D       L+S  +
Sbjct: 155 LNSTTWRLGSGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGLDFRVSDADDDVLELLSGGR 214

Query: 181 DGLIKLWDL------KTQQCVETHIAQTGECWAL--GVHGDLVVTTGTDSQIKIWNLDTS 232
           D ++ L+ L      K  + +  H  Q   C  +  G H DL  T G D+  +I +L T+
Sbjct: 215 DDIVNLYQLGSTKKVKLVKTIPVH-QQIEACGFIHDGEHQDLFYTAGGDAVYQILSLATA 273

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 69/153 (45%), Gaps = 5/153 (3%)

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
           +  P  +++H    +   +I ++K++P+ +YL        ++++ L S +   S+     
Sbjct: 44  ELAPTKRVLHRIENDDEQEITALKLTPDGEYLCYVSQAQLLRIYHLRSKRVVRSMKVSS- 102

Query: 571 PVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN----F 626
           PV  ID    S L+     D ++ +  ++ G    SL  H  +I +V F  E ++     
Sbjct: 103 PVYVIDCDPSSTLVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRL 162

Query: 627 FSSSKDGLVKYWDGDKFECVQKLAAHQSEVWAL 659
            S   +G+VK WD  +  C+  +  H + V  L
Sbjct: 163 GSGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGL 195

 Score = 38.5 bits (88), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 59/130 (45%), Gaps = 11/130 (8%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF-----DSTGTRLMSGSRDSDIIIW 146
           L +G  +GV+K+WDL+ ++ L +   H + V  L F     D     L+SG RD  + ++
Sbjct: 162 LGSGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGLDFRVSDADDDVLELLSGGRDDIVNLY 221

Query: 147 DLVSEVGVFKLRS---HKD-AITGIWCEGE--DWLVSTAKDGLIKLWDLKTQQCVETHIA 200
            L S   V  +++   H+     G   +GE  D   +   D + ++  L T   ++    
Sbjct: 222 QLGSTKKVKLVKTIPVHQQIEACGFIHDGEHQDLFYTAGGDAVYQILSLATASVIKKTNK 281

Query: 201 QTGECWALGV 210
              E + +GV
Sbjct: 282 PIEELFIIGV 291

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 29/149 (19%), Positives = 57/149 (38%), Gaps = 29/149 (19%)

Query: 115 FSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVF----KLRSHKDAITGI--- 167
           + GH   +  L     G  L + S+D  +I+W   SE+  F    K   H   +T +   
Sbjct: 399 YEGHTDLLNALDSSEDGKWLATCSKDHTVILWRYSSELEKFKAYAKFTGHAGPVTAVGLP 458

Query: 168 ------WCEGEDWLVSTAKDGLIKLWDLKT--QQCVETHIAQTGE-----------CWAL 208
                 W E   ++++ + D  IK W +     +  E H+ +  +             ++
Sbjct: 459 NVMRSAWPE---FIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDKDINALSI 515

Query: 209 GVHGDLVVTTGTDSQIKIWNLDTSKENGS 237
             +     T   D   K+W++D+ +  G+
Sbjct: 516 SPNDSTFATASYDKTCKVWDVDSGELQGT 544

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 101/207 (48%), Gaps = 11/207 (5%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVP----GTTDKFVPVMKLIHDTTLELNDDILSVKISPED 539
           L++ S D ++K W        VP      T+  +PV+K    T      DI ++ ISP D
Sbjct: 447 LLSSSTDMTVKKWK-------VPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSISPND 499

Query: 540 KYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599
              A +  D T K++ L + +   +L  HK  +  +      KLI T S DK IKIW L+
Sbjct: 500 SIFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLE 559

Query: 600 FGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWAL 659
             +   +L  H +++  + F+ ++    S   DGLVK WD    EC++ L AH + +WAL
Sbjct: 560 NYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWAL 619

Query: 660 AITSDGSTVVSSSHDHSMRVWKETDDQ 686
            +  DG   V++  D   + WK+  ++
Sbjct: 620 EVADDGDRFVTADADGLFQFWKDNSEE 646

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 94/216 (43%), Gaps = 7/216 (3%)

Query: 73  KSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGT 132
           + +   ++  L      ++ A    D   KIWDL++  ++ + + HK G+  + F     
Sbjct: 483 RRAHEKDINALSISPNDSIFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDK 542

Query: 133 RLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKT 191
            + + S D  I IW L +      L  H +A+  I +      LVS   DGL+K+WD  T
Sbjct: 543 LIATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCST 602

Query: 192 QQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIWNLDTSKENGSKIVEKGTYEKQS 249
            +C+ T  A     WAL V   GD  VT   D   + W  D S+E   + +EK   + + 
Sbjct: 603 GECLRTLDAHDNRIWALEVADDGDRFVTADADGLFQFWK-DNSEEEHEQDLEKKRLKVEQ 661

Query: 250 KQRGLSVNFKTTAD-ETTFLYIQNSDKTVEIFRIRK 284
           +Q     N+ +  D    FL     D  + ++ + K
Sbjct: 662 EQS--LQNYLSKGDWVNAFLLAMTLDHPMRLYNVLK 695

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 84/176 (47%), Gaps = 13/176 (7%)

Query: 72  VKSSKPAEVTYLEYHDETN-LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF--- 127
           V+S K +   Y+   DET+ LL  G  DG + I+D+ +  V  SF GH   ++ +KF   
Sbjct: 95  VRSMKVSSPVYVMDCDETSTLLVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGE 154

Query: 128 -DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WC--EGEDWLVSTAKDGL 183
            D     L SG  +  + IWDLV    +  ++ H  A+ G+ +C  + E  L+S  +D +
Sbjct: 155 LDGANWLLASGDTNGVVKIWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEI 214

Query: 184 IKLWDL---KTQQCVETHIA--QTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKE 234
           I L      KT + ++T     Q   C  +  H  L+   G ++  +I  L + K+
Sbjct: 215 INLHHFDYKKTCKLLKTLPVKQQIEACGFIANHESLIYHAGDNAVYQIVCLQSGKQ 270

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 65/140 (46%), Gaps = 13/140 (9%)

Query: 49  LWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMS 108
           +WD+ TGEL++ L++    G  DV   +         HD+  L+A    D  IKIW L +
Sbjct: 513 IWDLVTGELVATLANH-KRGLWDVSFCQ---------HDK--LIATCSGDKTIKIWSLEN 560

Query: 109 KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIW 168
             +  +  GH + V  + F +   +L+S   D  + IWD  +   +  L +H + I  + 
Sbjct: 561 YNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWALE 620

Query: 169 CEGE-DWLVSTAKDGLIKLW 187
              + D  V+   DGL + W
Sbjct: 621 VADDGDRFVTADADGLFQFW 640

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 71/152 (46%), Gaps = 9/152 (5%)

Query: 516 MKLIHDTTLELNDD----ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLP 571
           +K  H+   ++N+D    I ++K++P+  YL     +  ++++ L S K   S+     P
Sbjct: 45  LKERHEIVHKINNDDEQEITALKLTPDGSYLCFVAQNQLLRIYSLASKKIVRSMKVSS-P 103

Query: 572 VLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPE--SHNFFSS 629
           V  +D    S L++    D ++ I+ ++ G    S   H   I +V F  E    N+  +
Sbjct: 104 VYVMDCDETSTLLVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANWLLA 163

Query: 630 SKD--GLVKYWDGDKFECVQKLAAHQSEVWAL 659
           S D  G+VK WD  K  C+  +  H + V  L
Sbjct: 164 SGDTNGVVKIWDLVKRRCMHTIQEHTAAVRGL 195

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 59/109 (54%), Gaps = 6/109 (5%)

Query: 399 NKLLASAS-NGLLKIWNLKTKSCIRTFDCGYALTCK---FLPSGTLCVIGTREGQIQLFD 454
           +KL+A+ S +  +KIW+L+  +   T + G+    +   F+      V    +G ++++D
Sbjct: 541 DKLIATCSGDKTIKIWSLENYNIKATLE-GHTNAVQRISFINKNKQLVSCGADGLVKIWD 599

Query: 455 LVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQD 503
             T   + ++D AH+  IW+L++  DG R VT  AD   +FW  + E++
Sbjct: 600 CSTGECLRTLD-AHDNRIWALEVADDGDRFVTADADGLFQFWKDNSEEE 647

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 46/101 (45%), Gaps = 10/101 (9%)

Query: 405 ASNGLLKIWNLKTKSCIRTFDCG---YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLI 461
           A N LL+I++L +K  +R+       Y + C    + TL VIG  +G + +FD+    + 
Sbjct: 79  AQNQLLRIYSLASKKIVRSMKVSSPVYVMDCD--ETSTLLVIGGTDGSVSIFDIENGYVT 136

Query: 462 ESIDVAHNAAIWSLDITQ--DGKR--LVTGSADKSIKFWNF 498
            S    H   I S+      DG    L +G  +  +K W+ 
Sbjct: 137 HSFK-GHGGIISSVKFYGELDGANWLLASGDTNGVVKIWDL 176

 Score = 35.4 bits (80), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 64/140 (45%), Gaps = 23/140 (16%)

Query: 564 SLYGHKLPVL-SIDISFDSKLIITSSADKNIKIWGL--DFGDC--HKSLFAHQDSIMNVC 618
           ++YG  + +L ++D S D   I T+S D  + +W      GD   +     H  S+  V 
Sbjct: 375 NMYGGHVDLLNALDASEDGLWIATASKDHTVLLWRYSEQLGDFKQYAKFIGHAGSVTAVA 434

Query: 619 F--LPESH--NF-FSSSKDGLVKYWD---------GDKFECVQ----KLAAHQSEVWALA 660
              + + H  NF  SSS D  VK W           D+   V+       AH+ ++ AL+
Sbjct: 435 LPNIMDQHFPNFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALS 494

Query: 661 ITSDGSTVVSSSHDHSMRVW 680
           I+ + S   ++S+D + ++W
Sbjct: 495 ISPNDSIFATASYDKTCKIW 514

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 97/200 (48%), Gaps = 8/200 (4%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVPGTTDKF-VPVMKLIHDTTLELNDDILSVKISPEDKYL 542
           L+T S D +IK W        VP  T    V ++K+   T      DI ++ +SP D   
Sbjct: 454 LLTASNDLTIKKWK-------VPKPTSIMDVQIIKVSEYTRHAHEKDINALSVSPNDSIF 506

Query: 543 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGD 602
           A +  D T K++ L++ +   +L  HK  +  +      KL+ TSS DK +KIW LD   
Sbjct: 507 ATASYDKTCKIWSLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFS 566

Query: 603 CHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIT 662
             K+L  H +++    F+ +     S   DGL+K WD    EC+  L  H + +WAL   
Sbjct: 567 VMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNRLWALNTM 626

Query: 663 SDGSTVVSSSHDHSMRVWKE 682
           +DG  +VS+  D   + WK+
Sbjct: 627 NDGDMIVSADADGVFQFWKD 646

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 75/174 (43%), Gaps = 12/174 (6%)

Query: 66  PPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVI---------KIWDLMSKTVLLSFS 116
           P   +DV+  K +E T   +  + N L+    D +          KIW L +  +  + +
Sbjct: 471 PTSIMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWSLENGELEATLA 530

Query: 117 GHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWL 175
            HK G+  + F      L + S D  + IW L +   +  L  H +A+    +   +  L
Sbjct: 531 NHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRCSFINKQKQL 590

Query: 176 VSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIW 227
           VS   DGLIK+WD  + +C+ T        WAL     GD++V+   D   + W
Sbjct: 591 VSCGADGLIKIWDCSSGECLNTLDGHNNRLWALNTMNDGDMIVSADADGVFQFW 644

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 93/199 (46%), Gaps = 22/199 (11%)

Query: 52  IKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETN-LLAAGYADGVIKIWDLMSKT 110
           +   +LL +    L  G I V+S K +  +Y+   D T+ LLA G  DG I I D+ +  
Sbjct: 79  VSQAQLLKIFQ--LKTGRI-VRSLKISSPSYILDTDPTSTLLAVGGTDGSIVIVDIENGY 135

Query: 111 VLLSFSGHKSGVTILKF----DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITG 166
           +  S  GH   ++ LKF    DS    L SG  +  + +WDLV    +  L+ H  A+ G
Sbjct: 136 ITHSLKGHGGTISSLKFYGQLDSETWLLASGDTNGMVKVWDLVKRKCLLTLQEHSSAVRG 195

Query: 167 I-WCEGEDW------LVSTAKDGLIKLWDL---KTQQCVETHIA--QTGECWALGVHGD- 213
           +   EGE        L+S  +D ++ +WD    K  + V+T     Q   C  L  H   
Sbjct: 196 LDIIEGESGDGSSLKLLSGGRDDIVNVWDFDMKKKCKLVKTLPVNQQVESCGFLKNHDGK 255

Query: 214 -LVVTTGTDSQIKIWNLDT 231
            ++ T G D+  ++ +L++
Sbjct: 256 RIIYTAGGDAIFQLIDLES 274

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 81/174 (46%), Gaps = 11/174 (6%)

Query: 517 KLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 576
           K++H  + E   +I +++++P+ +YLA       +K+F L + +   SL     P   +D
Sbjct: 51  KILHKISNEDEQEITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLKISS-PSYILD 109

Query: 577 ISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFL----PESHNFFSSSKD 632
               S L+     D +I I  ++ G    SL  H  +I ++ F      E+    S   +
Sbjct: 110 TDPTSTLLAVGGTDGSIVIVDIENGYITHSLKGHGGTISSLKFYGQLDSETWLLASGDTN 169

Query: 633 GLVKYWDGDKFECVQKLAAHQSEVWALAI----TSDGST--VVSSSHDHSMRVW 680
           G+VK WD  K +C+  L  H S V  L I    + DGS+  ++S   D  + VW
Sbjct: 170 GMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNVW 223

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 54/101 (53%), Gaps = 4/101 (3%)

Query: 399 NKLLASAS-NGLLKIWNLKTKSCIRTFD--CGYALTCKFLPSGTLCVIGTREGQIQLFDL 455
           +KLLA++S +  +KIW+L T S ++T +        C F+      V    +G I+++D 
Sbjct: 545 DKLLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDC 604

Query: 456 VTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFW 496
            +   + ++D  HN  +W+L+   DG  +V+  AD   +FW
Sbjct: 605 SSGECLNTLD-GHNNRLWALNTMNDGDMIVSADADGVFQFW 644

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 63/140 (45%), Gaps = 13/140 (9%)

Query: 49  LWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMS 108
           +W ++ GEL + L++               +V++ +Y     LLA    D  +KIW L +
Sbjct: 517 IWSLENGELEATLAN---------HKRGLWDVSFCQYD---KLLATSSGDKTVKIWSLDT 564

Query: 109 KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIW 168
            +V+ +  GH + V    F +   +L+S   D  I IWD  S   +  L  H + +  + 
Sbjct: 565 FSVMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNRLWALN 624

Query: 169 CEGE-DWLVSTAKDGLIKLW 187
              + D +VS   DG+ + W
Sbjct: 625 TMNDGDMIVSADADGVFQFW 644

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 70/365 (19%), Positives = 144/365 (39%), Gaps = 93/365 (25%)

Query: 401 LLASA-SNGLLKIWNLKTKSCIRTF---------------DCGYALTCKFLPSGTLCVIG 444
           LLAS  +NG++K+W+L  + C+ T                + G   + K L  G      
Sbjct: 162 LLASGDTNGMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGG------ 215

Query: 445 TREGQIQLFDL---VTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIE 501
            R+  + ++D        L++++ V             DGKR++  +   +I F    +E
Sbjct: 216 -RDDIVNVWDFDMKKKCKLVKTLPVNQQVESCGFLKNHDGKRIIYTAGGDAI-FQLIDLE 273

Query: 502 QDLVPGTTDK---------FVPVMK------LIHDTTLEL---------NDDILSVK--- 534
              V   T+K          +P+M       ++ D TL+L          +D ++ +   
Sbjct: 274 SGTVLKRTNKPIEELFIIGVLPIMNDSEMFLVMSDQTLQLINIEEVLENENDTINARSTI 333

Query: 535 ------------ISPEDKYLAVSLLDNTVKVFFLD-------SMKFFLSLY-GHKLPVLS 574
                       + PE   LA++    ++++  +        S+   + +Y GH+  + S
Sbjct: 334 AGNNGIIADMRFVGPELNKLALATNSPSLRIIPIPDLSGADASLPLDVEIYEGHEDLLNS 393

Query: 575 IDISFDSKLIITSSADKNIKIWGLDFG----DCHKSLFAHQDSIMNVCF---LPESHNFF 627
           +D + D   I T+S D    +W  +      D +     H  ++  V     +P+ +  F
Sbjct: 394 LDATEDGLWIATASKDNTAILWKYNERTSKFDIYAKYIGHSSAVTAVGLPNVMPKGYPEF 453

Query: 628 --SSSKDGLVKYWDGDKFECVQKLA----------AHQSEVWALAITSDGSTVVSSSHDH 675
             ++S D  +K W   K   +  +           AH+ ++ AL+++ + S   ++S+D 
Sbjct: 454 LLTASNDLTIKKWKVPKPTSIMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDK 513

Query: 676 SMRVW 680
           + ++W
Sbjct: 514 TCKIW 518

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 100/206 (48%), Gaps = 14/206 (6%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVPGTT------DKFVP-VMKLIHDTTLELNDDILSVKIS 536
           ++T S D +IK W        VP  T      D F P  +KL   T    + DI ++ IS
Sbjct: 473 VITASNDSTIKKWK-------VPKPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALSIS 525

Query: 537 PEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           P D   A +  D T K++ L+S     +L  HK  +  +      K I+T+S DK IK+W
Sbjct: 526 PNDSIFATASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDKFIVTASGDKTIKMW 585

Query: 597 GLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEV 656
            LD     K+   H +++    F+ +     S   DGL+K WD    EC++ L  H + +
Sbjct: 586 SLDTFTVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGECIKTLDGHSNRI 645

Query: 657 WALAITSDGSTVVSSSHDHSMRVWKE 682
           WAL++ +DG  ++S+  D   + W++
Sbjct: 646 WALSVINDGDVIISADADGVFQFWRD 671

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 105/239 (43%), Gaps = 22/239 (9%)

Query: 66  PPGSIDVKSS-KPAEVTYLEY----HDET----------NLLAAGYADGVIKIWDLMSKT 110
           P  ++D   S KP EV   EY    HD+           ++ A    D   KIWDL S  
Sbjct: 490 PTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALSISPNDSIFATASYDKTCKIWDLESGD 549

Query: 111 VLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WC 169
           +  +   HK G+  + F      +++ S D  I +W L +   V     H +A+    + 
Sbjct: 550 LKATLVNHKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFI 609

Query: 170 EGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIW 227
             +  LVS   DGLIK+WD  + +C++T    +   WAL V   GD++++   D   + W
Sbjct: 610 NKQKQLVSCGADGLIKIWDCSSGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFW 669

Query: 228 NLDTSKENGSKIVEKGTYEKQSKQRGLSVNFKTTADET-TFLYIQNSDKTVEIFRIRKQ 285
             D + EN  K +EK   + + +Q     N+    D T  FL     D  + +F + ++
Sbjct: 670 R-DCTGENREKDLEKERLKVEQEQS--LQNYLANEDWTNAFLLAMTLDHPLRLFNVLRK 725

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 72/172 (41%), Gaps = 16/172 (9%)

Query: 467 AHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLEL 526
           AH+  I +L I+ +     T S DK+ K W      DL  G           +  T +  
Sbjct: 514 AHDKDINALSISPNDSIFATASYDKTCKIW------DLESGD----------LKATLVNH 557

Query: 527 NDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIIT 586
              +  V     DK++  +  D T+K++ LD+     +  GH   V         K +++
Sbjct: 558 KRGLWDVSFCQYDKFIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQLVS 617

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYW 638
             AD  IKIW    G+C K+L  H + I  +  + +     S+  DG+ ++W
Sbjct: 618 CGADGLIKIWDCSSGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFW 669

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 91/186 (48%), Gaps = 24/186 (12%)

Query: 72  VKSSKPAEVTYLEYHDETN-LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF--- 127
           VKS K +  +Y+   D+T+ LLA G  DG + + D+ +  +  SF GH + ++ +KF   
Sbjct: 96  VKSLKISSPSYVMSIDQTSTLLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVKFYSD 155

Query: 128 ----DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-------WCEGED--- 173
               ++ G  L SG     I + D+V    ++  + H  AI G+         E ++   
Sbjct: 156 ASTQNNEGWLLFSGDTAGMIKVCDMVKRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLL 215

Query: 174 WLVSTAKDGLIKLWDL---KTQQCVET--HIAQTGECWAL-GVHGDLVVTTGTDSQIKIW 227
            L+S  +D ++ LW+    +  + ++T     Q   C  L G + DL+ T G+D+  +I 
Sbjct: 216 QLLSGGRDDIVNLWEFNLRRKSKLIKTIPVYQQVEACGFLNGNYEDLIYTGGSDAIFQIL 275

Query: 228 NLDTSK 233
           ++ ++K
Sbjct: 276 SISSNK 281

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 55/101 (54%), Gaps = 4/101 (3%)

Query: 399 NKLLASAS-NGLLKIWNLKTKSCIRTFD--CGYALTCKFLPSGTLCVIGTREGQIQLFDL 455
           +K + +AS +  +K+W+L T + ++TF+        C+F+      V    +G I+++D 
Sbjct: 570 DKFIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDC 629

Query: 456 VTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFW 496
            +   I+++D  H+  IW+L +  DG  +++  AD   +FW
Sbjct: 630 SSGECIKTLD-GHSNRIWALSVINDGDVIISADADGVFQFW 669

 Score = 38.9 bits (89), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 70/162 (43%), Gaps = 19/162 (11%)

Query: 436 PSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKF 495
           P+ ++    + +   +++DL +  L  ++ V H   +W +   Q  K +VT S DK+IK 
Sbjct: 526 PNDSIFATASYDKTCKIWDLESGDLKATL-VNHKRGLWDVSFCQYDKFIVTASGDKTIKM 584

Query: 496 WNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDD-ILSVKISPEDKYLAVSLLDNTVKVF 554
           W+            D F  V       T E + + +   +   + K L     D  +K++
Sbjct: 585 WSL-----------DTFTVV------KTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIW 627

Query: 555 FLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
              S +   +L GH   + ++ +  D  +II++ AD   + W
Sbjct: 628 DCSSGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFW 669

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 63/146 (43%), Gaps = 13/146 (8%)

Query: 527 NDD---ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSL-YGHKLPVLSIDISFDSK 582
           NDD   I ++++SP+ KYL  +  +  +K++ +   KF  SL       V+SID +  S 
Sbjct: 58  NDDEQEITALQLSPDGKYLCYASTNQLLKIYNIVEKKFVKSLKISSPSYVMSIDQT--ST 115

Query: 583 LIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN-------FFSSSKDGLV 635
           L+     D ++ +  ++      S   H  +I  V F  ++          FS    G++
Sbjct: 116 LLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVKFYSDASTQNNEGWLLFSGDTAGMI 175

Query: 636 KYWDGDKFECVQKLAAHQSEVWALAI 661
           K  D  K  C+     H S +  L I
Sbjct: 176 KVCDMVKRRCLYTFQEHTSAIRGLDI 201

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 64/140 (45%), Gaps = 27/140 (19%)

Query: 567 GHKLPVLSIDISFDSKLIITSSADKNIKIWG----LDFGDCHKSLFAHQDSIMNVCFLPE 622
           GH   + S+D + DS  I T+S D +  +W     L+    +     H  S+  V  LP 
Sbjct: 405 GHTDLLNSLDSTEDSLWIATASKDNSCILWRYNAVLEKYQIYAKFLGHASSVTAVG-LPN 463

Query: 623 --SHNF----FSSSKDGLVKYW----------DGDKFECVQ-KLA-----AHQSEVWALA 660
             + N+     ++S D  +K W          + D F+  + KL+     AH  ++ AL+
Sbjct: 464 VLTKNYPDYVITASNDSTIKKWKVPKPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALS 523

Query: 661 ITSDGSTVVSSSHDHSMRVW 680
           I+ + S   ++S+D + ++W
Sbjct: 524 ISPNDSIFATASYDKTCKIW 543

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 100/205 (48%), Gaps = 7/205 (3%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVPGTTDKFVPV--MKLIHDTTLELNDDILSVKISPEDKY 541
           L+T S D +IK W         P   D+ V    +K+   T      DI ++ ISP D  
Sbjct: 423 LLTASNDLTIKKWKIP-----KPSAGDEEVEFHDVKISEYTRRAHEKDINALSISPNDSI 477

Query: 542 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFG 601
            A +  D T K++ L++ +   +L  HK  +  +      K+I T S DK IKIW LD  
Sbjct: 478 FATASYDKTCKIWDLETGESVATLSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWSLDTF 537

Query: 602 DCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAI 661
              K+L  H +++    F+ + +   S+  DGL+K WD    EC+  L  H + +WAL +
Sbjct: 538 SVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIWALCV 597

Query: 662 TSDGSTVVSSSHDHSMRVWKETDDQ 686
            +DG  +VS+  D   + W++  D+
Sbjct: 598 QNDGDLIVSADADGVFQFWRDCTDE 622

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 96/218 (44%), Gaps = 9/218 (4%)

Query: 73  KSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGT 132
           + +   ++  L      ++ A    D   KIWDL +   + + S HK G+  + F     
Sbjct: 459 RRAHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVATLSNHKRGLWDVSFCQFDK 518

Query: 133 RLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKT 191
            + + S D  I IW L +   +  L  H +A+    +   ++ LVST  DGLIK+WD+  
Sbjct: 519 IIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISN 578

Query: 192 QQCVETHIAQTGECWALGVH--GDLVVTTGTDSQIKIWN--LDTSKENGSKIVEKGTYEK 247
            +C+ T        WAL V   GDL+V+   D   + W    D  +E      ++   ++
Sbjct: 579 GECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFWRDCTDEQREEDMAKEKERIEQE 638

Query: 248 QSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQ 285
           QS Q  L+    T A    FL   + D  + +F + ++
Sbjct: 639 QSLQNYLNERDWTNA----FLLAISLDHPMRLFNVLRE 672

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 70/172 (40%), Gaps = 16/172 (9%)

Query: 467 AHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLEL 526
           AH   I +L I+ +     T S DK+ K W+    + +   +  K               
Sbjct: 461 AHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVATLSNHK--------------- 505

Query: 527 NDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIIT 586
              +  V     DK +A    D T+K++ LD+     +L GH   V           +++
Sbjct: 506 -RGLWDVSFCQFDKIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVS 564

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYW 638
           + AD  IKIW +  G+C  +L  H + I  +C   +     S+  DG+ ++W
Sbjct: 565 TGADGLIKIWDISNGECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFW 616

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 74/157 (47%), Gaps = 13/157 (8%)

Query: 49  LWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMS 108
           +WD++TGE ++ LS+               +V++ ++     ++A    D  IKIW L +
Sbjct: 489 IWDLETGESVATLSN---------HKRGLWDVSFCQF---DKIIATCSGDKTIKIWSLDT 536

Query: 109 KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIW 168
            +V+ +  GH + V    F +   +L+S   D  I IWD+ +   +  L  H + I  + 
Sbjct: 537 FSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIWALC 596

Query: 169 CEGE-DWLVSTAKDGLIKLWDLKTQQCVETHIAQTGE 204
            + + D +VS   DG+ + W   T +  E  +A+  E
Sbjct: 597 VQNDGDLIVSADADGVFQFWRDCTDEQREEDMAKEKE 633

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 4/101 (3%)

Query: 399 NKLLASAS-NGLLKIWNLKTKSCIRTFD--CGYALTCKFLPSGTLCVIGTREGQIQLFDL 455
           +K++A+ S +  +KIW+L T S I+T +        C F+      V    +G I+++D+
Sbjct: 517 DKIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDI 576

Query: 456 VTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFW 496
                I ++D  HN  IW+L +  DG  +V+  AD   +FW
Sbjct: 577 SNGECISTLD-GHNNRIWALCVQNDGDLIVSADADGVFQFW 616

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 79/177 (44%), Gaps = 10/177 (5%)

Query: 514 PVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 573
           PV K++H  +     +I ++K++P+ KYL        +K+  + + K   S+     P  
Sbjct: 16  PVKKILHTISNNDEQEITALKVTPDGKYLIFVSQAQLLKIVNVSTGKIIKSMKVSS-PSY 74

Query: 574 SIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN----FFSS 629
            ID    S L+     D ++ +  ++ G    SL  H  +I ++ F  E ++      S 
Sbjct: 75  IIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSG 134

Query: 630 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAIT-----SDGSTVVSSSHDHSMRVWK 681
             +G+VK WD  K +C+  +  H S V  + I      +D   +V+   D+ +  W+
Sbjct: 135 DTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWE 191

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 83/172 (48%), Gaps = 14/172 (8%)

Query: 72  VKSSKPAEVTYLEYHDETN-LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF--- 127
           +KS K +  +Y+   D+T+ L+  G  DG + + D+ +  +  S  GH   ++ LKF   
Sbjct: 64  IKSMKVSSPSYIIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGE 123

Query: 128 -DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGED-----WLVSTAK 180
            +S    L SG  +  + IWDLV    +  ++ H   + G+   E E+      LV+  +
Sbjct: 124 LNSNIWLLCSGDTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGR 183

Query: 181 DGLIKLWD--LKTQQCVETHIAQTGECWALG-VHGDLVVTTGTDSQIKIWNL 229
           D ++  W+  LK +  +   I    +  + G ++ D + T G+D+  ++ +L
Sbjct: 184 DNIVNFWEFNLKKKCTLVKTIPAHQQIESSGFINHDFIYTAGSDAVFQVISL 235

 Score = 35.4 bits (80), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 32/161 (19%), Positives = 69/161 (42%), Gaps = 17/161 (10%)

Query: 436 PSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKF 495
           P+ ++    + +   +++DL T   + ++   H   +W +   Q  K + T S DK+IK 
Sbjct: 473 PNDSIFATASYDKTCKIWDLETGESVATLS-NHKRGLWDVSFCQFDKIIATCSGDKTIKI 531

Query: 496 WNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFF 555
           W+            D F  V+K +   T    + +       +   L  +  D  +K++ 
Sbjct: 532 WSL-----------DTF-SVIKTLEGHT----NAVQKCSFINKQNQLVSTGADGLIKIWD 575

Query: 556 LDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           + + +   +L GH   + ++ +  D  LI+++ AD   + W
Sbjct: 576 ISNGECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFW 616

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 57/267 (21%), Positives = 110/267 (41%), Gaps = 37/267 (13%)

Query: 440 LCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQ-----DGKRLVTGSADKSIK 494
           LC  G   G ++++DLV    I ++   H + +  +DI +     D  +LVTG  D  + 
Sbjct: 131 LCS-GDTNGMVKIWDLVKRKCIHTVQ-EHTSPVRGVDIVESENDTDVLQLVTGGRDNIVN 188

Query: 495 FWNFSIEQDLVPGTTDKFVPVMKLI-------HDTTLELNDDILSVKISPEDKYLAVSLL 547
           FW F++++     T  K +P  + I       HD       D +   IS ++  +     
Sbjct: 189 FWEFNLKKKC---TLVKTIPAHQQIESSGFINHDFIYTAGSDAVFQVISLKNGQVIKRTR 245

Query: 548 DNTVKVF------FLDSMKFFLSLYGHKLPVLSIDISFDS---KLIITSS--ADKNIKIW 596
               ++F       L+  +++L +    L ++ +  + +    +LI + S  A  +  I 
Sbjct: 246 KPIEELFIIGVLPILNGTEYYLVMSDQSLNLIDVQGALEEEEDELISSKSCIAGNHGIIA 305

Query: 597 GLDF--GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQS 654
            + F   D      A     + +  +P ++    +  +  +   D D +E       H+ 
Sbjct: 306 DMTFVGPDLKHLALATNSPTLRLIPVPNTNKSDGNEDESFLPI-DVDMYE------GHED 358

Query: 655 EVWALAITSDGSTVVSSSHDHSMRVWK 681
            + A+  T DG  + ++S DHS  VWK
Sbjct: 359 LLNAIDSTEDGLWIATASKDHSAIVWK 385

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 117/267 (43%), Gaps = 47/267 (17%)

Query: 467 AHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIE------------------------- 501
            H   + SLD T+DG  L T S D S   W F++E                         
Sbjct: 379 GHEDLLNSLDATEDGLWLATCSKDSSAILWRFNVETAKFFPYAKFTGHSASVTAVALPNV 438

Query: 502 ------QDLVPGTTDKFVPVMKLIHDTTLELND----------------DILSVKISPED 539
                 + L+  + D  V   K+      +++D                DI ++ ++P D
Sbjct: 439 MLRGWPEFLITASNDLTVKRWKVPKPANEDISDLLTIKQSEYTFHVHAKDINALSLAPND 498

Query: 540 KYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599
              A +  D T K++ +++ +   +L GHK  +  +      KL+ TSS DK IKIW LD
Sbjct: 499 SLFATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLATSSGDKTIKIWNLD 558

Query: 600 FGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWAL 659
              C K+L  H +++    F+ +     SS  DGL+K WD    +C++ L  H + +WA+
Sbjct: 559 TFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGHGNRIWAM 618

Query: 660 AITSDGSTVVSSSHDHSMRVWKETDDQ 686
            + +DG  ++S+  D   + W++  ++
Sbjct: 619 NVCNDGDLIISADADGVFQFWRDCTEE 645

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 70/152 (46%), Gaps = 3/152 (1%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           ++  L      +L A    D   KIWD+ +     + +GHK G+  + F      L + S
Sbjct: 488 DINALSLAPNDSLFATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLATSS 547

Query: 139 RDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVET 197
            D  I IW+L +   V  L  H +A+    +   +  LVS+  DGLIK+WD  T  C++T
Sbjct: 548 GDKTIKIWNLDTFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKT 607

Query: 198 HIAQTGECWALGV--HGDLVVTTGTDSQIKIW 227
                   WA+ V   GDL+++   D   + W
Sbjct: 608 LDGHGNRIWAMNVCNDGDLIISADADGVFQFW 639

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 96/510 (18%), Positives = 200/510 (39%), Gaps = 97/510 (19%)

Query: 80  VTYLEYHDETN----LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDST----G 131
           ++ L++H E N    LLA+G  +GV K+WDL+ +  L +   H S +  L F        
Sbjct: 146 ISSLKFHGELNGDKWLLASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDC 205

Query: 132 TRLMSGSRDSDIIIWDLVSEVGVFKLRS---HKDAITGIWCEGEDWLVSTAKDGLIKLWD 188
            +L+SG RD  + +W+   +     L++   H+   +  +    D + +   + +++L  
Sbjct: 206 VKLLSGGRDDIVNLWEFNMKKHSKLLKTVPVHQQVESCGFVRESDLVYTAGGEAVLQLIS 265

Query: 189 LKTQQCVETHIAQTGECWALGVHGDLVVTTG-------TDSQIKIWNLDTSKEN-GSKIV 240
           L++Q+ ++       E + +GV   L + +G       +D  +++ N++ +  N   +++
Sbjct: 266 LESQKVIKKTQKPIEELFIVGV---LPILSGREFYLVLSDQTLQLINMEEAISNFDDELI 322

Query: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRAL-----KKR 295
              +    +   G   + +        + +  +   + I  I +  E S  L     +  
Sbjct: 323 NVAS--SIAGNHGTIADIRVVGPGLNKIALATNSPALRIIPIPQTSENSLPLDVEVYEGH 380

Query: 296 EKRMKEKGSTDEQIQQYFIDTYVSLMLQPFQI--------IKSTYKIKAVSWTVAANSKI 347
           E  +    +T++ +         S +L  F +         K T    +V+     N  +
Sbjct: 381 EDLLNSLDATEDGLWLATCSKDSSAILWRFNVETAKFFPYAKFTGHSASVTAVALPNVML 440

Query: 348 ----ELVVTTSSN-TIEYYSIPYEKRLPKNPSPSKLYTIEQKG-----HRTXXXXXXXXX 397
               E ++T S++ T++ + +P     P N   S L TI+Q       H           
Sbjct: 441 RGWPEFLITASNDLTVKRWKVPK----PANEDISDLLTIKQSEYTFHVHAKDINALSLAP 496

Query: 398 XNKLLASAS-NGLLKIWNLKTK-------------------------------------- 418
            + L A+AS +   KIW+++T                                       
Sbjct: 497 NDSLFATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLATSSGDKTIKIWN 556

Query: 419 ----SCIRTFD--CGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAI 472
               SC++T +        C F+      V    +G I+++D +T   ++++D  H   I
Sbjct: 557 LDTFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLD-GHGNRI 615

Query: 473 WSLDITQDGKRLVTGSADKSIKFWNFSIEQ 502
           W++++  DG  +++  AD   +FW    E+
Sbjct: 616 WAMNVCNDGDLIISADADGVFQFWRDCTEE 645

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 87/177 (49%), Gaps = 18/177 (10%)

Query: 73  KSSKPAEVTYLEYHDETN-LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDS-- 129
           +S K +  +Y+   D T+ L+A G  DG I + D+ +  +  SF GH   ++ LKF    
Sbjct: 96  RSMKISSPSYVMDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGEL 155

Query: 130 TGTRLMSGSRDSDII--IWDLVSEVGVFKLRSHKDAITGI---WCEGEDW--LVSTAKDG 182
            G + +  S D++ +  +WDLV    +  ++ H  AI G+     EGED   L+S  +D 
Sbjct: 156 NGDKWLLASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDD 215

Query: 183 LIKLWDL------KTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSK 233
           ++ LW+       K  + V  H  Q  E        DLV T G ++ +++ +L++ K
Sbjct: 216 IVNLWEFNMKKHSKLLKTVPVH--QQVESCGFVRESDLVYTAGGEAVLQLISLESQK 270

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 78/187 (41%), Gaps = 20/187 (10%)

Query: 454 DLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFV 513
           DL+T    E     H   I +L +  +     T S DK+ K W      D+  G +   +
Sbjct: 471 DLLTIKQSEYTFHVHAKDINALSLAPNDSLFATASYDKTCKIW------DVETGESKATL 524

Query: 514 PVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 573
              K            +  V     DK LA S  D T+K++ LD+     +L GH   V 
Sbjct: 525 AGHK----------RGLWDVSFCQYDKLLATSSGDKTIKIWNLDTFSCVKTLEGHTNAVQ 574

Query: 574 SIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSI--MNVCFLPESHNFFSSSK 631
                   K +++S AD  IKIW    GDC K+L  H + I  MNVC   +     S+  
Sbjct: 575 RCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGHGNRIWAMNVC--NDGDLIISADA 632

Query: 632 DGLVKYW 638
           DG+ ++W
Sbjct: 633 DGVFQFW 639

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 70/154 (45%), Gaps = 17/154 (11%)

Query: 49  LWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMS 108
           +WD++TGE  + L+ G   G  D        V++ +Y     LLA    D  IKIW+L +
Sbjct: 512 IWDVETGESKATLA-GHKRGLWD--------VSFCQYD---KLLATSSGDKTIKIWNLDT 559

Query: 109 KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI- 167
            + + +  GH + V    F +   +L+S   D  I IWD ++   +  L  H + I  + 
Sbjct: 560 FSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGHGNRIWAMN 619

Query: 168 WCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQ 201
            C   D ++S   DG+ + W    + C E    Q
Sbjct: 620 VCNDGDLIISADADGVFQFW----RDCTEEQREQ 649

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 79/179 (44%), Gaps = 15/179 (8%)

Query: 514 PVMKLIHDTTLELNDD---ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
           P  KL+H  T+E NDD   I +++++P+ +YL        +K+F LDSMK   S+     
Sbjct: 47  PTQKLLH--TIE-NDDEQEITALRLTPDGRYLCYVSQAQQLKIFSLDSMKITRSMKISS- 102

Query: 571 PVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN----F 626
           P   +D    S LI     D +I +  ++ G    S   H  +I ++ F  E +      
Sbjct: 103 PSYVMDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGELNGDKWLL 162

Query: 627 FSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIT----SDGSTVVSSSHDHSMRVWK 681
            S   +G+ K WD  K  C+  +  H S +  L        D   ++S   D  + +W+
Sbjct: 163 ASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDIVNLWE 221

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 66/161 (40%), Gaps = 17/161 (10%)

Query: 436 PSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKF 495
           P+ +L    + +   +++D+ T     ++   H   +W +   Q  K L T S DK+IK 
Sbjct: 496 PNDSLFATASYDKTCKIWDVETGESKATL-AGHKRGLWDVSFCQYDKLLATSSGDKTIKI 554

Query: 496 WNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFF 555
           WN            D F  V  L   T     + +       + K L  S  D  +K++ 
Sbjct: 555 WNL-----------DTFSCVKTLEGHT-----NAVQRCAFMNKQKQLVSSGADGLIKIWD 598

Query: 556 LDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
             +     +L GH   + ++++  D  LII++ AD   + W
Sbjct: 599 CITGDCLKTLDGHGNRIWAMNVCNDGDLIISADADGVFQFW 639

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 99/200 (49%), Gaps = 6/200 (3%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVPGTT-DKFVPVMKLIHDTTLELNDDILSVKISPEDKYL 542
           L+T S D +IK W         P TT ++   ++K+   T      DI ++ ISP D   
Sbjct: 452 LLTASNDLTIKKWKIP-----KPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIF 506

Query: 543 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGD 602
           A +  D T K++ L++ +   +L  HK  +  +      KLI T S DK IKIW LD   
Sbjct: 507 ATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFS 566

Query: 603 CHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIT 662
             K+L  H +++    F+ +     SS  DGL+K WD    +C++ L  H + +WAL   
Sbjct: 567 VMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNRIWALTEI 626

Query: 663 SDGSTVVSSSHDHSMRVWKE 682
           +DG  +VS+  D   + WK+
Sbjct: 627 NDGDMIVSADADGVFQFWKD 646

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 104/237 (43%), Gaps = 16/237 (6%)

Query: 73  KSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGT 132
           + +   ++  L      ++ A    D   KIWDL +  +  + S HK G+  + F     
Sbjct: 487 RRAHEKDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDK 546

Query: 133 RLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAIT-GIWCEGEDWLVSTAKDGLIKLWDLKT 191
            + + S D  I IW L +   +  L  H +A+   ++   +  LVS+  DGLIK+WD  T
Sbjct: 547 LIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCST 606

Query: 192 QQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIWN--LDTSKENGSKIVEKGTYEK 247
             C++T        WAL     GD++V+   D   + W    +  KE   ++ ++   ++
Sbjct: 607 GDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFWKDCTELEKEQNLELEKEKVEKE 666

Query: 248 QSKQRGLSVNFKTTADET-TFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMKEKG 303
           Q+ +     N+    D T  FL     D  + +F + KQ     +L  R+   +E+G
Sbjct: 667 QTLK-----NYLLNEDWTNAFLLALTLDHPMRVFNVLKQ-----SLNARKAGSEEQG 713

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 108/229 (47%), Gaps = 29/229 (12%)

Query: 72  VKSSKPAEVTYLEYHDETN-LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF--- 127
           ++S K +   Y+   D T+ L+A G  DG I + D+ +  +  S  GH + ++ LKF   
Sbjct: 100 IRSMKMSSPCYIMDCDSTSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQ 159

Query: 128 -DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCE--GEDW-LVSTAKDGL 183
            +S    L SG  +  + +WDLV    +  ++ H +A+ G+     G++W L+S  +D +
Sbjct: 160 ANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNV 219

Query: 184 IKLWDLK-TQQC-----VETHIAQTGECWALG-VHGDLVVTTGTDSQIKIWNLDTSKENG 236
             LW+    ++C     +  H  Q   C  +   H DL+ T G D+ ++  +L       
Sbjct: 220 CTLWNFNLKKKCTLLKTIPVH-QQVESCGFINHEHDDLIYTAGGDALLQFISL------- 271

Query: 237 SKIVEKGTYEKQSKQR--GLSVNFKTTADETTFLYIQNSDKTVEIFRIR 283
               EK T  K++K+    L +       E   +Y+  SD+T+E+  I+
Sbjct: 272 ----EKATMIKKTKKHIEELFIIGVLPILENDKMYLVMSDQTLELVDIK 316

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 97/499 (19%), Positives = 194/499 (38%), Gaps = 83/499 (16%)

Query: 78  AEVTYLEYHDETN----LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGT- 132
           A ++ L++  + N    LL +G  +G++K+WDL+ +  L +   H + V  L     G  
Sbjct: 149 ATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDE 208

Query: 133 -RLMSGSRDSDIIIWDL-----VSEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKL 186
            +L+SG RD+   +W+       + +    +    ++   I  E +D + +   D L++ 
Sbjct: 209 WQLISGGRDNVCTLWNFNLKKKCTLLKTIPVHQQVESCGFINHEHDDLIYTAGGDALLQF 268

Query: 187 WDLKTQQCVETHIAQTGECWALGV----HGDLVVTTGTDSQIKIWNLDTSKEN-GSKIVE 241
             L+    ++       E + +GV      D +    +D  +++ ++ ++  N  S I+E
Sbjct: 269 ISLEKATMIKKTKKHIEELFIIGVLPILENDKMYLVMSDQTLELVDIKSNLLNESSDIIE 328

Query: 242 KGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRI--RKQDEIS---RALKKRE 296
             +    +   G   + K        L +  +  T+ I  +   +Q+E+       +  E
Sbjct: 329 IESC--IAGNNGTIADMKFVGPNHDKLALATNSPTLRIIPVPSSEQEELPINVEMYEGHE 386

Query: 297 KRMKEKGSTDEQI--------QQYFIDTYVSLM--LQPF-QIIKSTYKIKAVSW-TVAAN 344
             +    +TD+ +            +  Y S++   QP+ + I  +  + AV    V   
Sbjct: 387 DLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNVMLR 446

Query: 345 SKIELVVTTSSN-TIEYYSIPYEK-RLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLL 402
              E ++T S++ TI+ + IP     + ++    K+    ++ H            + + 
Sbjct: 447 GYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIF 506

Query: 403 ASAS-NGLLKIWNLKTKSCIRTFD-----------CGY---ALTC------KFLPSGTLC 441
           A+AS +   KIW+L+      T             C Y     TC      K     T  
Sbjct: 507 ATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFS 566

Query: 442 VIGTREGQ------------------------IQLFDLVTSTLIESIDVAHNAAIWSLDI 477
           V+ T EG                         I+++D  T   ++++D  H+  IW+L  
Sbjct: 567 VMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLD-GHDNRIWALTE 625

Query: 478 TQDGKRLVTGSADKSIKFW 496
             DG  +V+  AD   +FW
Sbjct: 626 INDGDMIVSADADGVFQFW 644

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 66/152 (43%), Gaps = 23/152 (15%)

Query: 49  LWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMS 108
           +WD++ GEL + LS+               +V + +Y     L+A    D  IKIW L +
Sbjct: 517 IWDLENGELTATLSN---------HKRGLWDVAFCQYD---KLIATCSGDKTIKIWSLDT 564

Query: 109 KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIW 168
            +V+ +  GH + V    F +   +L+S   D  I IWD  +   +  L  H +    IW
Sbjct: 565 FSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNR---IW 621

Query: 169 CEGE----DWLVSTAKDGLIKLWDLKTQQCVE 196
              E    D +VS   DG+ + W    + C E
Sbjct: 622 ALTEINDGDMIVSADADGVFQFW----KDCTE 649

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 74/167 (44%), Gaps = 13/167 (7%)

Query: 527 NDD---ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKF----FLSLYGHKLPVLSIDISF 579
           NDD   I ++K++P+ +YL+    +  +K+F LD  K      +       P   +D   
Sbjct: 57  NDDEQEITALKLTPDAQYLSFISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPCYIMDCDS 116

Query: 580 DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN----FFSSSKDGLV 635
            S L+     D +I +  ++ G    SL  H  +I  + F  ++++      S   +G+V
Sbjct: 117 TSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMV 176

Query: 636 KYWDGDKFECVQKLAAHQSEVWALAITSDGS--TVVSSSHDHSMRVW 680
           K WD  K +C+  +  H + V  L +   G    ++S   D+   +W
Sbjct: 177 KVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLW 223

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 67/354 (18%), Positives = 141/354 (39%), Gaps = 76/354 (21%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTF----DCGYALTCKFLPSGTLCVIGTREGQIQLFDL- 455
           L +  +NG++K+W+L  + C+ T     +    L  + +      + G R+    L++  
Sbjct: 167 LCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNFN 226

Query: 456 --VTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFV 513
                TL+++I V            +    + T   D  ++F   S+E+  +   T K +
Sbjct: 227 LKKKCTLLKTIPVHQQVESCGFINHEHDDLIYTAGGDALLQF--ISLEKATMIKKTKKHI 284

Query: 514 ---------PVMK------LIHDTTLELND----------DILSVK-------------- 534
                    P+++      ++ D TLEL D          DI+ ++              
Sbjct: 285 EELFIIGVLPILENDKMYLVMSDQTLELVDIKSNLLNESSDIIEIESCIAGNNGTIADMK 344

Query: 535 -ISPEDKYLAVSLLDNTVKVFFLDS-----MKFFLSLY-GHKLPVLSIDISFDSKLIITS 587
            + P    LA++    T+++  + S     +   + +Y GH+  + S+D + D   + T+
Sbjct: 345 FVGPNHDKLALATNSPTLRIIPVPSSEQEELPINVEMYEGHEDLLNSLDTTDDGLWMATA 404

Query: 588 SADKNIKIWG----LDFGDCHKSLFAHQDSIM-----NVCFLPESHNFFSSSKDGLVKYW 638
           S D    +W     ++    +     H  ++      NV          ++S D  +K W
Sbjct: 405 SKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNVMLRGYPEFLLTASNDLTIKKW 464

Query: 639 DGDKF------EC-VQKLA-----AHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
              K       +C + K++     AH+ ++ ALAI+ + S   ++S+D + ++W
Sbjct: 465 KIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFATASYDKTCKIW 518

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 81/212 (38%), Gaps = 32/212 (15%)

Query: 400 KLLASASNGL-LKIWNLKTKSCIRTFDCGYALTCKFL--------------PSGTLCVIG 444
           + L +ASN L +K W +   S     DC      ++               P+ ++    
Sbjct: 450 EFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFATA 509

Query: 445 TREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDL 504
           + +   +++DL    L  ++   H   +W +   Q  K + T S DK+IK W+       
Sbjct: 510 SYDKTCKIWDLENGELTATLS-NHKRGLWDVAFCQYDKLIATCSGDKTIKIWSL------ 562

Query: 505 VPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLS 564
                D F  VMK +   T    + +       +   L  S  D  +K++   +     +
Sbjct: 563 -----DTF-SVMKTLEGHT----NAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKT 612

Query: 565 LYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           L GH   + ++    D  +I+++ AD   + W
Sbjct: 613 LDGHDNRIWALTEINDGDMIVSADADGVFQFW 644

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score =  103 bits (257), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 111/239 (46%), Gaps = 11/239 (4%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVPGTTDK----FVPVMKLIHDTTLELNDDILSVKISPED 539
           L+T S D +IK W        VP   D+       ++K    T      DI ++ +SP D
Sbjct: 448 LLTASNDLTIKRWK-------VPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPND 500

Query: 540 KYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599
              A +  D T K++ +D+ +   +L  HK  +  +       L+ T S D++I +W L+
Sbjct: 501 SIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLE 560

Query: 600 FGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWAL 659
                K+L  H +++  V F+  +    S+  DGLVK WD    ECV+ L AH + +WAL
Sbjct: 561 SFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWAL 620

Query: 660 AITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDSAF 718
           A+ +DG  ++++  D   + W++  ++                 +L   + EG  ++AF
Sbjct: 621 AVANDGQLIITADADGVFQFWEDNSEEEHERNIEQEKLRVEQEQSLQNYISEGDWNNAF 679

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 95/211 (45%), Gaps = 12/211 (5%)

Query: 90  NLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLV 149
           ++ A    D   KIW++ +  V  + + HK G+  + F      L + S D  I +W L 
Sbjct: 501 SIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLE 560

Query: 150 SEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWAL 208
           S   +  L  H +A+  + +  G   LVST  DGL+K+WD  T +CV T  A     WAL
Sbjct: 561 SFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWAL 620

Query: 209 GV--HGDLVVTTGTDSQIKIWNLDTSKENGSKIVEKGTYEKQSKQRGLSVNFKTTAD-ET 265
            V   G L++T   D   + W  D S+E   + +E+     + +Q     N+ +  D   
Sbjct: 621 AVANDGQLIITADADGVFQFWE-DNSEEEHERNIEQEKLRVEQEQS--LQNYISEGDWNN 677

Query: 266 TFLYIQNSDKTVEIFRIRKQDEISRALKKRE 296
            FL     D  + ++ +     + RA+ K +
Sbjct: 678 AFLLAMTLDHPMRLYHV-----LERAIAKAQ 703

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 88/175 (50%), Gaps = 15/175 (8%)

Query: 72  VKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF---- 127
           +K S PA V  L+  + + LLA G  DG + ++D+ +  V  S  GH + ++ +KF    
Sbjct: 98  MKISSPAYV--LDCDESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEV 155

Query: 128 DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWC---EG-EDWLVSTAKDGL 183
           DS    L SG  +  + IWDLV    +  ++ H  A+ G+     EG E  L+S  +D +
Sbjct: 156 DSGMWLLASGDTNGMVKIWDLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDV 215

Query: 184 IKL--WDLKTQQCVETHIA---QTGECWALGVHGDLVVTTGTDSQIKIWNLDTSK 233
           + +  +D+K +  +   I    Q   C  +G +  L+ T G D+  +I +L++ K
Sbjct: 216 VHVHHFDMKKKCKLLQTIPVKRQIESCGFIGDNTSLIYTAGGDAVYQIISLESGK 270

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 67/148 (45%), Gaps = 5/148 (3%)

Query: 518 LIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDI 577
           +IH    E   D+ +++++P+ +YL  +  +  ++ + L++ +   S+     P   +D 
Sbjct: 51  IIHKIENEDEQDVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISS-PAYVLDC 109

Query: 578 SFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN----FFSSSKDG 633
              S L+     D ++ ++ +  G    SL  H  +I +V F  E  +      S   +G
Sbjct: 110 DESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNG 169

Query: 634 LVKYWDGDKFECVQKLAAHQSEVWALAI 661
           +VK WD  K  C+  +  H + V  L I
Sbjct: 170 MVKIWDLVKRRCIHTVQEHTAAVRGLDI 197

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 58/107 (54%), Gaps = 6/107 (5%)

Query: 401 LLASASNGL-LKIWNLKTKSCIRTFDCGYALTCK---FLPSGTLCVIGTREGQIQLFDLV 456
           LLA+ S    + +W+L++ + ++T + G+    +   F+      V    +G ++++D  
Sbjct: 544 LLATCSGDRSINLWSLESFTVLKTLE-GHTNAVQRVSFINGNKQLVSTGADGLVKIWDCS 602

Query: 457 TSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQD 503
           T   + ++D AHN  IW+L +  DG+ ++T  AD   +FW  + E++
Sbjct: 603 TGECVRTLD-AHNNRIWALAVANDGQLIITADADGVFQFWEDNSEEE 648

 Score = 32.7 bits (73), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 56/147 (38%), Gaps = 31/147 (21%)

Query: 115 FSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVF----KLRSHKDAITGI--- 167
           + GH   +  L   S G  L + S+D  +I+W        F    K   H   +T I   
Sbjct: 378 YEGHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTAIALP 437

Query: 168 ------WCEGEDWLVSTAKDGLIKLWDLKT---QQCVE-THIAQTGE-----------CW 206
                 W E   +L++ + D  IK W +     ++ +E  HI +  E             
Sbjct: 438 NVMNRNWPE---FLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAI 494

Query: 207 ALGVHGDLVVTTGTDSQIKIWNLDTSK 233
           ++  +  +  T   D   KIWN+DT +
Sbjct: 495 SMSPNDSIFATASYDKTCKIWNVDTGE 521

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score =  103 bits (257), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 97/207 (46%), Gaps = 10/207 (4%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHD---TTLELNDDILSVKISPEDK 540
           L+T S D ++K W        VP  TD+F   +  I     T      DI  + ISP D 
Sbjct: 471 LITASNDLTVKKWK-------VPKPTDRFDIEIYSISSSEYTRRAHEKDINMLSISPNDS 523

Query: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
             A +  D T K++ L++ +   +L  HK  +  +      K I T+S DK +KIW LD 
Sbjct: 524 IFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDT 583

Query: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660
               K+L  H +++    F  +     S+  DGLVK WD    EC+  L  H + +WAL 
Sbjct: 584 FTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWALN 643

Query: 661 ITSDGSTVVSSSHDHSMRVWKETDDQV 687
           +  DG  V+++  D   + WK+  ++ 
Sbjct: 644 VIKDGDIVITADADGVFQFWKDRTEEA 670

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 101/229 (44%), Gaps = 16/229 (6%)

Query: 70  IDVKSSKPAEVTYLEYHDETNLL---------AAGYADGVIKIWDLMSKTVLLSFSGHKS 120
           I++ S   +E T   +  + N+L         A    D   KIWDL +  +  + + HK 
Sbjct: 494 IEIYSISSSEYTRRAHEKDINMLSISPNDSIFATASYDKTCKIWDLETGELKATLNNHKR 553

Query: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTA 179
           G+  + F      + + S D  + IW L +   V  L  H +A+    +   +  LVST 
Sbjct: 554 GLWDVSFCQYDKFIATASGDKTVKIWSLDTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTG 613

Query: 180 KDGLIKLWDLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIWNLDTSKENGS 237
            DGL+KLWD  T +C+ T        WAL V   GD+V+T   D   + W  D ++E   
Sbjct: 614 ADGLVKLWDCSTGECINTLDGHDNRIWALNVIKDGDIVITADADGVFQFWK-DRTEEARE 672

Query: 238 KIVEKGTYEKQSKQRGLSVNFKTTADET-TFLYIQNSDKTVEIFRIRKQ 285
           + +EK   + +  Q     N+ ++ D T  FL     D    ++ + KQ
Sbjct: 673 EDIEKEKLKVEQMQT--LENYISSGDWTNAFLLAITLDHPARLYNVLKQ 719

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 73/152 (48%), Gaps = 16/152 (10%)

Query: 52  IKTGELLSVLSDGLPPGSIDVKSSKPAEVTY-LEYHDETNLLAAGYADGVIKIWDLMSKT 110
           +   +LL +    L  G I VKS K +  +Y LE    + LLA G  DG + + D+ +  
Sbjct: 91  VSQAQLLKIFK--LSTGKI-VKSMKISSPSYVLETDPTSTLLAIGGTDGSVTVIDIENGY 147

Query: 111 VLLSFSGHKSGVTILKF---DSTGTRLM-SGSRDSDIIIWDLVSEVGVFKLRSHKDAITG 166
           +  S  GH + ++ LKF     T T L+ SG  +  + IWDLVS   +  L+ H  A+ G
Sbjct: 148 ITHSLKGHGATISSLKFYGEQHTNTWLLSSGDTNGMVKIWDLVSRKAIHTLQEHNSAVRG 207

Query: 167 I--------WCEGEDWLVSTAKDGLIKLWDLK 190
           I          E    L++ A+D +I  W+ K
Sbjct: 208 IDFKLIEKKNSEDSLQLITGARDDVINHWEFK 239

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 92/209 (44%), Gaps = 25/209 (11%)

Query: 311 QYFIDTYVSLMLQPFQIIKST-------YKIKAVSWTVAANSKIELVVTTSSNTIEYYSI 363
           +Y I     L ++ +++ K T       Y I +  +T  A+ K   +++ S N   + + 
Sbjct: 469 EYLITASNDLTVKKWKVPKPTDRFDIEIYSISSSEYTRRAHEKDINMLSISPNDSIFATA 528

Query: 364 PYEKRLPKNPSPSKLYTIEQ-------KGHRTXXXXXXXXXXNKLLASAS-NGLLKIWNL 415
            Y+K         K++ +E          H+           +K +A+AS +  +KIW+L
Sbjct: 529 SYDK-------TCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSL 581

Query: 416 KTKSCIRTFD--CGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIW 473
            T + ++T +        C F       V    +G ++L+D  T   I ++D  H+  IW
Sbjct: 582 DTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLD-GHDNRIW 640

Query: 474 SLDITQDGKRLVTGSADKSIKFWNFSIEQ 502
           +L++ +DG  ++T  AD   +FW    E+
Sbjct: 641 ALNVIKDGDIVITADADGVFQFWKDRTEE 669

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 71/154 (46%), Gaps = 13/154 (8%)

Query: 49  LWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMS 108
           +WD++TGEL + L++               +V++ +Y      +A    D  +KIW L +
Sbjct: 536 IWDLETGELKATLNN---------HKRGLWDVSFCQYD---KFIATASGDKTVKIWSLDT 583

Query: 109 KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI- 167
            TV+ +  GH + V    F +   +L+S   D  + +WD  +   +  L  H + I  + 
Sbjct: 584 FTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWALN 643

Query: 168 WCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQ 201
             +  D +++   DG+ + W  +T++  E  I +
Sbjct: 644 VIKDGDIVITADADGVFQFWKDRTEEAREEDIEK 677

 Score = 38.9 bits (89), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 59/137 (43%), Gaps = 8/137 (5%)

Query: 527 NDD---ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKL 583
           NDD   I ++ ++P+ +YL        +K+F L + K   S+     P   ++    S L
Sbjct: 70  NDDEQEITALALTPDAQYLCYVSQAQLLKIFKLSTGKIVKSMKISS-PSYVLETDPTSTL 128

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN----FFSSSKDGLVKYWD 639
           +     D ++ +  ++ G    SL  H  +I ++ F  E H       S   +G+VK WD
Sbjct: 129 LAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGDTNGMVKIWD 188

Query: 640 GDKFECVQKLAAHQSEV 656
               + +  L  H S V
Sbjct: 189 LVSRKAIHTLQEHNSAV 205

 Score = 36.2 bits (82), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 8/83 (9%)

Query: 444 GTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDI-------TQDGKRLVTGSADKSIKFW 496
           G   G ++++DLV+   I ++   HN+A+  +D        ++D  +L+TG+ D  I  W
Sbjct: 178 GDTNGMVKIWDLVSRKAIHTLQ-EHNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHW 236

Query: 497 NFSIEQDLVPGTTDKFVPVMKLI 519
            F    +L      K +PV + I
Sbjct: 237 EFKDVTNLKRCKLLKTIPVHQQI 259

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 97/200 (48%), Gaps = 8/200 (4%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVPGTTDKF-VPVMKLIHDTTLELNDDILSVKISPEDKYL 542
           L+T S D +IK W        +P  T  F V  +K+   T      DI ++ ISP D   
Sbjct: 454 LLTASNDLTIKKWK-------IPKPTFPFDVQTIKVSEYTRHAHEKDINALSISPNDSIF 506

Query: 543 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGD 602
           A +  D T K++ L++ +   +L  HK  +  +      KL+ T S DK +KIW LD   
Sbjct: 507 ATASYDKTCKIWNLENGELEATLSNHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDTFS 566

Query: 603 CHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIT 662
             K+L  H +++    F+ +     S   DGL+K WD    EC++ L  H + +WAL   
Sbjct: 567 VMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLKTLDGHNNRLWALNTM 626

Query: 663 SDGSTVVSSSHDHSMRVWKE 682
           +DG  +VS+  D   + WK+
Sbjct: 627 NDGDIIVSADADGVFQFWKD 646

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 76/174 (43%), Gaps = 12/174 (6%)

Query: 66  PPGSIDVKSSKPAEVTYLEYHDETNLL---------AAGYADGVIKIWDLMSKTVLLSFS 116
           P    DV++ K +E T   +  + N L         A    D   KIW+L +  +  + S
Sbjct: 471 PTFPFDVQTIKVSEYTRHAHEKDINALSISPNDSIFATASYDKTCKIWNLENGELEATLS 530

Query: 117 GHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWL 175
            HK G+  + F      L + S D  + IW L +   +  L  H +A+    +   +  L
Sbjct: 531 NHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQL 590

Query: 176 VSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIW 227
           VS   DGLIK+WD  + +C++T        WAL     GD++V+   D   + W
Sbjct: 591 VSCGADGLIKIWDCSSGECLKTLDGHNNRLWALNTMNDGDIIVSADADGVFQFW 644

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 87/179 (48%), Gaps = 19/179 (10%)

Query: 72  VKSSKPAEVTYLEYHDETN-LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF--- 127
           V+S K +  +Y+   D T+ LLA G  DG I + D+ +  +  SF GH   ++ LKF   
Sbjct: 96  VRSMKISSPSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQ 155

Query: 128 -DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITG---IWCEGEDW----LVSTA 179
            DS    L SG  +  + +WDLV    +  L+ H  A+ G   +  +  D     L+S  
Sbjct: 156 LDSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGG 215

Query: 180 KDGLIKLWDL---KTQQCVETHIA--QTGECWALGVHGD--LVVTTGTDSQIKIWNLDT 231
           +D +I +WD    KT + ++T     Q   C  L  H D  L+ T G D+  ++ +L++
Sbjct: 216 RDDIINIWDFNMKKTCKLIKTLPVNQQVESCGFLRYHDDKHLIYTAGGDAIFQLIDLES 274

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 54/101 (53%), Gaps = 4/101 (3%)

Query: 399 NKLLASAS-NGLLKIWNLKTKSCIRTFD--CGYALTCKFLPSGTLCVIGTREGQIQLFDL 455
           +KLLA+ S +  +KIW+L T S ++T +        C F+      V    +G I+++D 
Sbjct: 545 DKLLATCSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDC 604

Query: 456 VTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFW 496
            +   ++++D  HN  +W+L+   DG  +V+  AD   +FW
Sbjct: 605 SSGECLKTLD-GHNNRLWALNTMNDGDIIVSADADGVFQFW 644

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 72/163 (44%), Gaps = 12/163 (7%)

Query: 503 DLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFF 562
           DL PG+ +       +IH  + E   +I ++K++P+ +YL        +K+F L + K  
Sbjct: 44  DLTPGSRN-------IIHRISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVV 96

Query: 563 LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPE 622
            S+     P   +D    S L+     D +I +  ++ G    S   H  +I ++ F  +
Sbjct: 97  RSMKISS-PSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQ 155

Query: 623 SHN----FFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAI 661
             +      S   +G+VK WD  K +C+  L  H S V  L I
Sbjct: 156 LDSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDI 198

 Score = 32.0 bits (71), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 66/164 (40%), Gaps = 31/164 (18%)

Query: 100 VIKIWDLMSKTVLLS-----FSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGV 154
           +I I DL   T  L      + GH+  +  L     G  + + S+D+  I+W        
Sbjct: 364 IIPIPDLAGTTASLPLDVEIYEGHEDLLNSLDATEDGLWIATASKDNSAIVWKYNENTRK 423

Query: 155 FKLRS----HKDAITGIWCEG------EDWLVSTAKDGLIKLW---------DLKTQQCV 195
           F++ S    H  A+T +           ++L++ + D  IK W         D++T +  
Sbjct: 424 FEVYSKYIGHSSAVTAVGLPKIMPKGYPEFLLTASNDLTIKKWKIPKPTFPFDVQTIKVS 483

Query: 196 E-THIAQTGECWALGVHGD--LVVTTGTDSQIKIWNLDTSKENG 236
           E T  A   +  AL +  +  +  T   D   KIWNL    ENG
Sbjct: 484 EYTRHAHEKDINALSISPNDSIFATASYDKTCKIWNL----ENG 523

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 99/199 (49%), Gaps = 6/199 (3%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLA 543
           L+T S D +IK W         P +T+  V ++K+   T      DI ++ +SP D   A
Sbjct: 455 LLTASNDLTIKKWKIP-----KPTSTND-VQIIKVSEYTRHAHEKDINALSVSPNDSIFA 508

Query: 544 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDC 603
            +  D T K++ L++ +   +L  HK  +  +      KL+ T S DK +KIW L+    
Sbjct: 509 TASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSV 568

Query: 604 HKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITS 663
            K+L  H +++    F+ +     S   DGL+K WD    EC++ L  H + +WAL   +
Sbjct: 569 MKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWALNTMN 628

Query: 664 DGSTVVSSSHDHSMRVWKE 682
           DG T+VS+  D   + WK+
Sbjct: 629 DGDTIVSADADGIFQFWKD 647

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 76/174 (43%), Gaps = 12/174 (6%)

Query: 66  PPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVI---------KIWDLMSKTVLLSFS 116
           P  + DV+  K +E T   +  + N L+    D +          KIW+L +  +  + +
Sbjct: 472 PTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLA 531

Query: 117 GHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWL 175
            HK G+  + F      L + S D  + IW L +   +  L  H +A+    +   +  L
Sbjct: 532 NHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSVMKTLEGHTNAVQRCSFINKQKQL 591

Query: 176 VSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIW 227
           VS   DGLIK+WD  + +C++T        WAL     GD +V+   D   + W
Sbjct: 592 VSCGADGLIKIWDCYSGECLKTLDGHNNRLWALNTMNDGDTIVSADADGIFQFW 645

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 64/135 (47%), Gaps = 13/135 (9%)

Query: 72  VKSSKPAEVTYLEYHDETN-LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF--- 127
           V+S K +  +Y+   D T+ LLA G  DG I + D+ +  +  S  GH   ++ LKF   
Sbjct: 96  VRSMKISSPSYILDTDSTSTLLAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQ 155

Query: 128 -DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI---WCEGEDW-----LVST 178
            DS    L SG  +  + +WDLV    +  L+ H  A+ G+     E  D      L+S 
Sbjct: 156 LDSKVWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDITEVENNDGPSHLKLISG 215

Query: 179 AKDGLIKLWDLKTQQ 193
            +D ++  WD   ++
Sbjct: 216 GRDDIVNFWDFDMKK 230

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 55/101 (54%), Gaps = 4/101 (3%)

Query: 399 NKLLASAS-NGLLKIWNLKTKSCIRTFD--CGYALTCKFLPSGTLCVIGTREGQIQLFDL 455
           +KLLA+ S +  +KIW+L+T S ++T +        C F+      V    +G I+++D 
Sbjct: 546 DKLLATCSGDKTVKIWSLETFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDC 605

Query: 456 VTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFW 496
            +   ++++D  HN  +W+L+   DG  +V+  AD   +FW
Sbjct: 606 YSGECLKTLD-GHNNRLWALNTMNDGDTIVSADADGIFQFW 645

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 94/215 (43%), Gaps = 26/215 (12%)

Query: 477 ITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKIS 536
           +++DGK L T   D          E +++  T D      K++H  + E   +I +++++
Sbjct: 25  VSEDGKILATPILD----------EINIIDLTADS----RKILHKISNEDEQEITALQLT 70

Query: 537 PEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           P+ +YL        +K+F L + K   S+     P   +D    S L+     D +I + 
Sbjct: 71  PDGQYLTYVSQAQLLKIFQLKTGKVVRSMKISS-PSYILDTDSTSTLLAVGGTDGSIIVV 129

Query: 597 GLDFGDCHKSLFAHQDSIMNVCFLPESHN----FFSSSKDGLVKYWDGDKFECVQKLAAH 652
            ++ G    SL  H  +I ++ F  +  +      S   +G+VK WD  K +C+  L  H
Sbjct: 130 DIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVKRKCLHTLQEH 189

Query: 653 QSEVWALAIT----SDGST---VVSSSHDHSMRVW 680
            S V  L IT    +DG +   ++S   D  +  W
Sbjct: 190 TSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFW 224

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 64/140 (45%), Gaps = 13/140 (9%)

Query: 49  LWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMS 108
           +W+++ GEL + L++               +V++ +Y     LLA    D  +KIW L +
Sbjct: 518 IWNLENGELEATLAN---------HKRGLWDVSFCQYD---KLLATCSGDKTVKIWSLET 565

Query: 109 KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIW 168
            +V+ +  GH + V    F +   +L+S   D  I IWD  S   +  L  H + +  + 
Sbjct: 566 FSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWALN 625

Query: 169 CEGE-DWLVSTAKDGLIKLW 187
              + D +VS   DG+ + W
Sbjct: 626 TMNDGDTIVSADADGIFQFW 645

>Kpol_1031.49 s1031
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 bp, 760 aa] {ON}
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 nt, 761 aa]
          Length = 760

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 101/209 (48%), Gaps = 12/209 (5%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVPGTT-----DKFVPVMKLIHDTTLELNDDILSVKISPE 538
           ++T S D ++K W        VP  T     D  + ++K+   T      DI ++ I+P 
Sbjct: 396 IITSSNDFTVKKWK-------VPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPN 448

Query: 539 DKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           D   A +  D T K++ LDS +   +L  HK  +  +      K I T+S DK IKIW L
Sbjct: 449 DSIFATASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKTIKIWSL 508

Query: 599 DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWA 658
           +      +L  H +++    F+ +     S+  DGL+K WD    EC++ L  H + +WA
Sbjct: 509 ETFKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWA 568

Query: 659 LAITSDGSTVVSSSHDHSMRVWKETDDQV 687
           L +  DG  ++++  D   + WK+  ++V
Sbjct: 569 LCVLRDGDMIITADADGVFQFWKDCTEEV 597

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 97/218 (44%), Gaps = 9/218 (4%)

Query: 73  KSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGT 132
           + +   ++  L      ++ A    D   KIWDL S  ++ + + HK G+  + F     
Sbjct: 433 RRAHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDK 492

Query: 133 RLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKT 191
            + + S D  I IW L +   V  L  H +A+    +   +  +VST  DGLIK+WD  +
Sbjct: 493 YIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSS 552

Query: 192 QQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIWNLDTSKENGSKIVEKGTYEKQS 249
            +C++T        WAL V   GD+++T   D   + W  D ++E   + +EK     + 
Sbjct: 553 GECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFWK-DCTEEVKEQDLEKEKLRVEQ 611

Query: 250 KQ--RGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQ 285
           +Q  R    N + T     FL     D  + ++ + KQ
Sbjct: 612 EQSLRNFIANGEWT---NAFLLAMTLDHPMRLYNVLKQ 646

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 98/504 (19%), Positives = 192/504 (38%), Gaps = 88/504 (17%)

Query: 82  YLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGT-----RLMS 136
           Y E  D   LLA+G  + ++K+WDL+ +  + +   H S V  + F  + T      L++
Sbjct: 98  YGESEDSVWLLASGDTN-MVKVWDLVKRKCIHTLQEHSSAVRGIDFKQSSTDSDIIHLVT 156

Query: 137 GSRDSDIIIWDL-----VSEVGVFKLRSHKDAITGIWCEGEDWLVSTA-KDGLIKLWDLK 190
           G RD+ I  W +        +  F +    +A   I    +D  + TA  D + ++  L 
Sbjct: 157 GGRDNIINHWTISGLKNFKLIRTFPVHQQVEACGFIKSTEDDNCIYTAGGDAVFQILSLS 216

Query: 191 TQQCVETHIAQTGECWALGV----HGDLVVTTGTDSQIKIWNL-DTSKENGSKIVEKGTY 245
               ++     T E + +GV    +   +    +D  +++ +L DT +E+   I  K + 
Sbjct: 217 NGSVIKKTKKPTEELFIIGVLPIKNFTKLYLVLSDQTLQLIDLIDTFEEDSEIITIKSSI 276

Query: 246 EKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQD---EISRALKKREKRMKEK 302
              +   G   + +    E   + +  +  T+ I  +  +D    I   ++  +      
Sbjct: 277 ---AGNHGTIADMRLVGPELKSIALATNSPTLRIIPVISEDNKNNIPLGVELYDGHEDLL 333

Query: 303 GSTDEQIQQYFIDTYV---SLMLQPF-----------QIIKSTYKIKAVSW-TVAANSKI 347
            S D      +I T     + ML  F           Q I     + +VS   V  N   
Sbjct: 334 NSLDATEDGLWIATASKDNTAMLWRFNDSENKFKKYAQFIGHASSVTSVSLPNVINNGWP 393

Query: 348 ELVVTTSSN-TIEYYSIPYEKRLPKNPSPSKLYTIEQ---KGHRTXXXXXXXXXXNKLLA 403
           E ++T+S++ T++ + +P   +   N     L  + +   + H            + + A
Sbjct: 394 EFIITSSNDFTVKKWKVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFA 453

Query: 404 SAS-NGLLKIWNLKTKSCIRT--------FDCGYALTCKFLPSG------------TLCV 442
           +AS +   KIW+L +   + T        +D  +    K++ +             T  V
Sbjct: 454 TASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKV 513

Query: 443 IGTREGQ------------------------IQLFDLVTSTLIESIDVAHNAAIWSLDIT 478
           + T EG                         I+++D  +   ++++D  H   IW+L + 
Sbjct: 514 VNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLD-GHANRIWALCVL 572

Query: 479 QDGKRLVTGSADKSIKFWNFSIEQ 502
           +DG  ++T  AD   +FW    E+
Sbjct: 573 RDGDMIITADADGVFQFWKDCTEE 596

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 68/152 (44%), Gaps = 19/152 (12%)

Query: 49  LWDIKTGELLSVLSD---GLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWD 105
           +WD+ +GEL++ L++   GL             +V++ +Y      +A    D  IKIW 
Sbjct: 463 IWDLDSGELMATLANHKRGL------------WDVSFCQYD---KYIATASGDKTIKIWS 507

Query: 106 LMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAIT 165
           L +  V+ +  GH + V    F +   +++S   D  I IWD  S   +  L  H + I 
Sbjct: 508 LETFKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIW 567

Query: 166 GIWC-EGEDWLVSTAKDGLIKLWDLKTQQCVE 196
            +      D +++   DG+ + W   T++  E
Sbjct: 568 ALCVLRDGDMIITADADGVFQFWKDCTEEVKE 599

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 80/361 (22%), Positives = 139/361 (38%), Gaps = 84/361 (23%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTFD--CGYALTCKFLPSGT-----LCVIGTREGQIQ-- 451
           LLAS    ++K+W+L  + CI T            F  S T       V G R+  I   
Sbjct: 107 LLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDFKQSSTDSDIIHLVTGGRDNIINHW 166

Query: 452 -LFDLVTSTLIESIDVAHNA-AIWSLDITQDGKRLVTGSADKSIKFWNFS---------- 499
            +  L    LI +  V     A   +  T+D   + T   D   +  + S          
Sbjct: 167 TISGLKNFKLIRTFPVHQQVEACGFIKSTEDDNCIYTAGGDAVFQILSLSNGSVIKKTKK 226

Query: 500 -IEQDLVPGT--TDKFVPVMKLIHDTTLELND---------DILSVK------------- 534
             E+  + G      F  +  ++ D TL+L D         +I+++K             
Sbjct: 227 PTEELFIIGVLPIKNFTKLYLVLSDQTLQLIDLIDTFEEDSEIITIKSSIAGNHGTIADM 286

Query: 535 --ISPEDKYLAVSLLDNTVKVFFL------DSMKFFLSLY-GHKLPVLSIDISFDSKLII 585
             + PE K +A++    T+++  +      +++   + LY GH+  + S+D + D   I 
Sbjct: 287 RLVGPELKSIALATNSPTLRIIPVISEDNKNNIPLGVELYDGHEDLLNSLDATEDGLWIA 346

Query: 586 TSSADKNIKIWGLDFGDC------HKSLFAHQDSIMNVCFLPESHN------FFSSSKDG 633
           T+S D    +W   F D       +     H  S+ +V  LP   N        +SS D 
Sbjct: 347 TASKDNTAMLW--RFNDSENKFKKYAQFIGHASSVTSVS-LPNVINNGWPEFIITSSNDF 403

Query: 634 LVKYW---------DGDKFECVQKLA-----AHQSEVWALAITSDGSTVVSSSHDHSMRV 679
            VK W         D D    + K++     AH+ ++ AL+I  + S   ++S+D + ++
Sbjct: 404 TVKKWKVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFATASYDKTCKI 463

Query: 680 W 680
           W
Sbjct: 464 W 464

 Score = 35.0 bits (79), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 65/154 (42%), Gaps = 21/154 (13%)

Query: 157 LRSHKDAITGI--WCEGED--WLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV-- 210
           L+ H   I+ +  + E ED  WL+++    ++K+WDL  ++C+  H  Q       G+  
Sbjct: 85  LKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCI--HTLQEHSSAVRGIDF 142

Query: 211 -----HGDLV--VTTGTDSQIKIWNLDTSKENGSKIVEKGTYEKQSKQRGLSVNFKTTAD 263
                  D++  VT G D+ I  W +   K    K++      +Q +  G     K+T D
Sbjct: 143 KQSSTDSDIIHLVTGGRDNIINHWTISGLK--NFKLIRTFPVHQQVEACGF---IKSTED 197

Query: 264 ETTFLYIQNSDKTVEIFRIRKQDEISRALKKREK 297
           +   +Y    D   +I  +     I +  K  E+
Sbjct: 198 DNC-IYTAGGDAVFQILSLSNGSVIKKTKKPTEE 230

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 109/238 (45%), Gaps = 10/238 (4%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVPGTTD---KFVPVMKLIHDTTLELNDDILSVKISPEDK 540
           ++T S D +IK W        VP  T    + + ++K    T      DI ++ ISP D 
Sbjct: 456 IITASNDLTIKKWK-------VPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDS 508

Query: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
             A +  D T K++ LD  +F  +L  HK  +  +      KL+ T S DK IKIW L+ 
Sbjct: 509 LFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLES 568

Query: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660
               K+L  H +++    F+ ++    S+  DGLV  WD    E V+ L AH + +WALA
Sbjct: 569 YAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALA 628

Query: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLXXXXXXXXXXXXXDTLLTSLEEGSGDSAF 718
           + +DG + V++  D     W++  ++                 +L   L EG   +AF
Sbjct: 629 VMNDGESFVTADADGFFEFWRDNSEEEHERNLEQEKLKIEQEQSLQNYLSEGDWTNAF 686

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 88/202 (43%), Gaps = 11/202 (5%)

Query: 90  NLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLV 149
           +L A    D   KIW+L       + + HK G+  + F      L + S D  I IW L 
Sbjct: 508 SLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLE 567

Query: 150 SEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWAL 208
           S   V  L  H +A+    +      L+ST  DGL+ +WDL T + V+T  A     WAL
Sbjct: 568 SYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWAL 627

Query: 209 GV--HGDLVVTTGTDSQIKIWNLDTSKENGSKIVEKGTY---EKQSKQRGLSVNFKTTAD 263
            V   G+  VT   D   + W  D S+E   + +E+      ++QS Q  LS    T A 
Sbjct: 628 AVMNDGESFVTADADGFFEFWR-DNSEEEHERNLEQEKLKIEQEQSLQNYLSEGDWTNA- 685

Query: 264 ETTFLYIQNSDKTVEIFRIRKQ 285
              FL     D  + ++ + +Q
Sbjct: 686 ---FLLAMTLDHPMRLYNVLRQ 704

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 95/242 (39%), Gaps = 37/242 (15%)

Query: 454 DLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFV 513
           DL+     E    AH   I ++ I+ +     T S DK+ K WN    +           
Sbjct: 480 DLILVKTSEYTRRAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGE----------- 528

Query: 514 PVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 573
                   T       +  V     DK LA    D T+K++ L+S     +L GH   V 
Sbjct: 529 -----FQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQ 583

Query: 574 SIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDG 633
                  +K +I++ AD  + IW L  G+  K+L AH + I  +  + +  +F ++  DG
Sbjct: 584 RCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMNDGESFVTADADG 643

Query: 634 LVKYWDGD--------------KFECVQKLAAHQSEV-WALAITSDGSTVVSSSHDHSMR 678
             ++W  +              K E  Q L  + SE  W  A       +++ + DH MR
Sbjct: 644 FFEFWRDNSEEEHERNLEQEKLKIEQEQSLQNYLSEGDWTNAF------LLAMTLDHPMR 697

Query: 679 VW 680
           ++
Sbjct: 698 LY 699

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 60/108 (55%), Gaps = 4/108 (3%)

Query: 399 NKLLASAS-NGLLKIWNLKTKSCIRTFD--CGYALTCKFLPSGTLCVIGTREGQIQLFDL 455
           +KLLA+ S +  +KIW+L++ + ++T +        C F+      +    +G + ++DL
Sbjct: 549 DKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDL 608

Query: 456 VTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQD 503
            T   ++++D AHN  IW+L +  DG+  VT  AD   +FW  + E++
Sbjct: 609 STGESVKTLD-AHNNRIWALAVMNDGESFVTADADGFFEFWRDNSEEE 655

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 71/155 (45%), Gaps = 15/155 (9%)

Query: 49  LWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMS 108
           +W++  GE  + L++               +V + +Y     LLA    D  IKIW L S
Sbjct: 521 IWNLDDGEFQATLAN---------HKRGLWDVAFCQYD---KLLATCSGDKTIKIWSLES 568

Query: 109 KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAI--TG 166
             V+ +  GH + V    F +   +L+S   D  +IIWDL +   V  L +H + I    
Sbjct: 569 YAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALA 628

Query: 167 IWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQ 201
           +  +GE ++ + A DG  + W   +++  E ++ Q
Sbjct: 629 VMNDGESFVTADA-DGFFEFWRDNSEEEHERNLEQ 662

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 61/120 (50%), Gaps = 10/120 (8%)

Query: 72  VKSSKPAEVTYLEYHDETN-LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF--- 127
           ++S K +   Y+   D+T+ LLA G  DG + + D+ +  V  S  GH + ++ +KF   
Sbjct: 95  IRSMKISSPVYVMNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGE 154

Query: 128 -DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKL 186
            +S   +L SG  +  I +WDLV       ++ H  A+ G+     D+ V+  + G ++L
Sbjct: 155 LNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGL-----DFRVTDEEKGTLQL 209

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 63/147 (42%), Gaps = 5/147 (3%)

Query: 517 KLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 576
           +++H    E   DI ++ ++P+  YL        ++V+ L   +   S+     PV  ++
Sbjct: 50  RVLHSVDTEDEQDITALHLTPDGSYLCFVSQAQLLRVYSLKQERIIRSMKISS-PVYVMN 108

Query: 577 ISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN----FFSSSKD 632
               S L+     D ++ +  ++ G    SL  H  +I +V F  E ++      S   +
Sbjct: 109 CDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTN 168

Query: 633 GLVKYWDGDKFECVQKLAAHQSEVWAL 659
           G++K WD  K  C   +  H + V  L
Sbjct: 169 GMIKVWDLVKRNCQCTIQEHTTAVRGL 195

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 9/73 (12%)

Query: 78  AEVTYLEYHDETNL----LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDST--- 130
           A ++ +++H E N     LA+G  +G+IK+WDL+ +    +   H + V  L F  T   
Sbjct: 144 ATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLDFRVTDEE 203

Query: 131 -GT-RLMSGSRDS 141
            GT +L+SG RD+
Sbjct: 204 KGTLQLLSGGRDN 216

 Score = 32.0 bits (71), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 70/164 (42%), Gaps = 21/164 (12%)

Query: 460 LIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLI 519
           ++ S+D      I +L +T DG  L   S  + ++   +S++Q+ +  +     PV  + 
Sbjct: 51  VLHSVDTEDEQDITALHLTPDGSYLCFVSQAQLLRV--YSLKQERIIRSMKISSPVYVMN 108

Query: 520 HDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDI-- 577
            D T  L               LA+   D +V V  +++     SL GH   + S+    
Sbjct: 109 CDQTSTL---------------LAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHG 153

Query: 578 SFDSKLIITSSADKN--IKIWGLDFGDCHKSLFAHQDSIMNVCF 619
             +S++   +S D N  IK+W L   +C  ++  H  ++  + F
Sbjct: 154 ELNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLDF 197

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 113/254 (44%), Gaps = 29/254 (11%)

Query: 440 LCVIGTREGQIQLFDLVTSTLIESID------------VAHNAAIWSLDITQDGKRLVTG 487
           L   G ++ QI+LF L  S L    D            V H+  ++S   + D + LV+ 
Sbjct: 510 LAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLVGHSGTVYSTSFSPDNRYLVSS 569

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLL 547
           S DK+++ W+      LV                +    N  +  VK SP   Y A +  
Sbjct: 570 SEDKTVRLWSLDTHSALV----------------SYKGHNHPVWDVKFSPLGHYFATASH 613

Query: 548 DNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSL 607
           D+T +++  D +       GH   V  +    +   + T S+DK  ++W +  GDC +  
Sbjct: 614 DHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLF 673

Query: 608 FAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAITSDGS 666
                 +++ C  P+     + S+DG++  WD    + ++++  H ++ +++LA   +G+
Sbjct: 674 LGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGN 733

Query: 667 TVVSSSHDHSMRVW 680
            ++S   DHS+RVW
Sbjct: 734 ALISGGADHSVRVW 747

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 80/178 (44%), Gaps = 17/178 (9%)

Query: 516 MKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKF-------------F 562
           M   H+T    N D+ S++ S + +  A    D+ +K+F LD                  
Sbjct: 489 MYTFHNT----NRDMTSLEFSDDCRLAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATS 544

Query: 563 LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPE 622
            +L GH   V S   S D++ +++SS DK +++W LD      S   H   + +V F P 
Sbjct: 545 KTLVGHSGTVYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPL 604

Query: 623 SHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
            H F ++S D   + W  D    ++  A H ++V  ++   +G  + + S D + R+W
Sbjct: 605 GHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMW 662

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 66/145 (45%), Gaps = 6/145 (4%)

Query: 90  NLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLV 149
           +  A    D   ++W       L  F+GH + V  + F   G  L +GS D    +WD+ 
Sbjct: 606 HYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIA 665

Query: 150 SE--VGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVET---HIAQTGE 204
           +   V +F   +     T +  +G  WL + ++DG+I +WD+ T + ++    H      
Sbjct: 666 TGDCVRLFLGLTAPVISTCVSPDGR-WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIY 724

Query: 205 CWALGVHGDLVVTTGTDSQIKIWNL 229
             A    G+ +++ G D  +++W+L
Sbjct: 725 SLAYCKEGNALISGGADHSVRVWDL 749

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 64/156 (41%), Gaps = 9/156 (5%)

Query: 85  YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDII 144
           +  +   L +   D  +++W L + + L+S+ GH   V  +KF   G    + S D    
Sbjct: 559 FSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDHTAR 618

Query: 145 IWDLVSEVGVFKLRSHKDAITGIWC----EGEDWLVSTAKDGLIKLWDLKTQQCVETHIA 200
           +W   S   ++ LR     +  + C        +L + + D   ++WD+ T  CV   + 
Sbjct: 619 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLG 675

Query: 201 QTGECWALGVH--GDLVVTTGTDSQIKIWNLDTSKE 234
            T    +  V   G  + T   D  I +W++ T K 
Sbjct: 676 LTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKR 711

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 62/136 (45%), Gaps = 12/136 (8%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFL-----PSGTLCVIGTREGQIQLFDL 455
           L   +S+   ++W++ T  C+R F     LT   +     P G     G+ +G I ++D+
Sbjct: 650 LFTGSSDKTCRMWDIATGDCVRLF---LGLTAPVISTCVSPDGRWLSTGSEDGIINVWDI 706

Query: 456 VTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNF-SIEQDLVPGTTDKFVP 514
            T   ++ +      AI+SL   ++G  L++G AD S++ W+      +  P     FV 
Sbjct: 707 GTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDLKKATTESGPEPEQAFV- 765

Query: 515 VMKLIHDTTLELNDDI 530
               + D T  +N DI
Sbjct: 766 --GYLGDVTGSINQDI 779

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           +V  + +H     L  G +D   ++WD+ +   +  F G  + V        G  L +GS
Sbjct: 637 DVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGS 696

Query: 139 RDSDIIIWDLVSEVGVFKLRSH-KDAITGI-WCEGEDWLVSTAKDGLIKLWDLK 190
            D  I +WD+ +   + ++R H K+AI  + +C+  + L+S   D  +++WDLK
Sbjct: 697 EDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDLK 750

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/170 (20%), Positives = 67/170 (39%), Gaps = 18/170 (10%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIW-------------DLMSKTVLLSFSGHKSGVTIL 125
           ++T LE+ D+  L AAG+ D  IK++             DL       +  GH   V   
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLVGHSGTVYST 557

Query: 126 KFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLI 184
            F      L+S S D  + +W L +   +   + H   +  + +     +  + + D   
Sbjct: 558 SFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDHTA 617

Query: 185 KLWD---LKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDT 231
           +LW    +   +    H+    +C +   +G  + T  +D   ++W++ T
Sbjct: 618 RLWSCDHIYPLRIFAGHLNDV-DCVSFHPNGCYLFTGSSDKTCRMWDIAT 666

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 11/65 (16%)

Query: 47  INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDL 106
           IN+WDI TG+ L  +           +      +  L Y  E N L +G AD  +++WDL
Sbjct: 701 INVWDIGTGKRLKQM-----------RGHGKNAIYSLAYCKEGNALISGGADHSVRVWDL 749

Query: 107 MSKTV 111
              T 
Sbjct: 750 KKATT 754

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 125/279 (44%), Gaps = 43/279 (15%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++DL T  ++ ++   H   I+SLD    G +LV+G
Sbjct: 354 YIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQ-GHEQDIYSLDYFPAGDKLVSG 412

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP D KY+A   
Sbjct: 413 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 455

Query: 547 LDNTVKVFFLDSMKFFLS---------LYGHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD TV+V+  DS   FL            GHK  V S+  + D + +I+ S D+++K+W 
Sbjct: 456 LDRTVRVW--DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWD 513

Query: 598 L-------DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLA 650
           L           C  +   H+D +++V    +     S SKD  V +WD      +  L 
Sbjct: 514 LRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQ 573

Query: 651 AHQSEVWALAITS------DGSTVVSSSHDHSMRVWKET 683
            H++ V ++A+ +      D     + S D   R+WK T
Sbjct: 574 GHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIWKYT 612

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 105/233 (45%), Gaps = 36/233 (15%)

Query: 32  RKSNVGQVL-TGALENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAE----------- 79
           R SN G+ L TG  +   ++ + TGELL+ LSD    G  +  S+ PA            
Sbjct: 283 RFSNDGEYLATGCNKTTQVYKVSTGELLARLSDDSVAGVNNEASTGPANNGTADNGGENS 342

Query: 80  ------------VTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF 127
                       +  + +  +   LA G  D +I+IWDL +K +L++  GH+  +  L +
Sbjct: 343 ATIQPASSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDY 402

Query: 128 DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIK 185
              G +L+SGS D  + IWDL +      L S +D +T +     D  ++ + + D  ++
Sbjct: 403 FPAGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRTVR 461

Query: 186 LWDLKTQQCVETHIAQ----TGE-----CWALGVHGDLVVTTGTDSQIKIWNL 229
           +WD +T   VE   ++    TG             G  V++   D  +K+W+L
Sbjct: 462 VWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDL 514

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 96/212 (45%), Gaps = 23/212 (10%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSG--TLCVIGTREGQIQLFDLV 456
           +KL++ + +  ++IW+L+T  C  T      +T   +  G       G+ +  ++++D  
Sbjct: 407 DKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSE 466

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           T  L+E +D        H  +++S+  T+DG+ +++GS D+S+K W+    + L    + 
Sbjct: 467 TGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDL---RGLNGQKSH 523

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
               V    H       D +LSV  + +D+Y+     D  V  +   S    L L GH+ 
Sbjct: 524 ATCEVTYTGH------KDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRN 577

Query: 571 PVLSIDI------SFDSKLIITSSADKNIKIW 596
            V+S+ +        D  +  T S D   +IW
Sbjct: 578 SVISVAVVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 54.7 bits (130), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 89/221 (40%), Gaps = 26/221 (11%)

Query: 460 LIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLI 519
           L  S+D  H++ +  +  + DG+ L TG  +K+ + +  S  + L            +L 
Sbjct: 269 LHHSLD--HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTGELLA-----------RLS 314

Query: 520 HDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISF 579
            D+   +N++       P +   A +  +N+  +    S   +         + S+  S 
Sbjct: 315 DDSVAGVNNE---ASTGPANNGTADNGGENSATIQPASSSDLY---------IRSVCFSP 362

Query: 580 DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWD 639
           D K + T + DK I+IW L       +L  H+  I ++ + P      S S D  V+ WD
Sbjct: 363 DGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWD 422

Query: 640 GDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
               +C   L+             DG  + + S D ++RVW
Sbjct: 423 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVW 463

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 63/137 (45%), Gaps = 13/137 (9%)

Query: 39  VLTGALEN-INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYA 97
           +  G+L+  + +WD +TG L+  L         ++ +     V  + +  +   + +G  
Sbjct: 451 IAAGSLDRTVRVWDSETGFLVERLDS-----ENELSTGHKDSVYSVVFTRDGQGVISGSL 505

Query: 98  DGVIKIWDLMS-------KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVS 150
           D  +K+WDL          T  ++++GHK  V  +        ++SGS+D  ++ WD  S
Sbjct: 506 DRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTAS 565

Query: 151 EVGVFKLRSHKDAITGI 167
              +  L+ H++++  +
Sbjct: 566 GNPLLMLQGHRNSVISV 582

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 124/275 (45%), Gaps = 39/275 (14%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++DL T  ++ ++   H   I+SLD    G +LV+G
Sbjct: 408 YIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLK-GHEQDIYSLDYFPSGNKLVSG 466

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISP-EDKYLAVSL 546
           S D++++ W      DL  GT              TL + D + +V +SP E K++A   
Sbjct: 467 SGDRTVRIW------DLTTGTC-----------SLTLSIEDGVTTVAVSPGEGKFIAAGS 509

Query: 547 LDNTVKVFFLDSMKFFLSL-------YGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599
           LD TV+V+  D+      L        GH+  V S+  + D K +++ S D+++K+W L+
Sbjct: 510 LDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

Query: 600 -------FGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAH 652
                    +C  +   H+D +++V          S SKD  V +WD      +  L  H
Sbjct: 570 GLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGH 629

Query: 653 QSEVWALAITS------DGSTVVSSSHDHSMRVWK 681
           ++ V ++ + +      +     + S D   R+WK
Sbjct: 630 RNSVISVTVANGHPLGPEYGVFATGSGDCKARIWK 664

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 95/212 (44%), Gaps = 23/212 (10%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSGT--LCVIGTREGQIQLFDLV 456
           NKL++ + +  ++IW+L T +C  T      +T   +  G       G+ +  ++++D  
Sbjct: 461 NKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSD 520

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           T  L+E +D        H  +++S+  T+DGK +V+GS D+S+K WN +    L    + 
Sbjct: 521 TGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN---GLSGQKSH 577

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
               V    H       D +LSV  +  D+Y+     D  V  +   S    L L GH+ 
Sbjct: 578 AECEVTYTGH------KDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRN 631

Query: 571 PVLSIDISFDSKL------IITSSADKNIKIW 596
            V+S+ ++    L        T S D   +IW
Sbjct: 632 SVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 119/259 (45%), Gaps = 37/259 (14%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTFDCG----YALTCKFLPSGTLCVIGTREGQIQLFDLV 456
           L   A + L++IW+L+TK  + T        Y+L   + PSG   V G+ +  ++++DL 
Sbjct: 421 LATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSL--DYFPSGNKLVSGSGDRTVRIWDLT 478

Query: 457 TSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVM 516
           T T   ++ +       ++    +GK +  GS D++++ W+           +D    V 
Sbjct: 479 TGTCSLTLSIEDGVTTVAVS-PGEGKFIAAGSLDRTVRVWD-----------SDTGFLVE 526

Query: 517 KLIHDTTLELN----DDILSVKISPEDKYLAVSLLDNTVKVFFLDSM-------KFFLSL 565
           +L  D+  EL     D + SV  + + K +    LD +VK++ L+ +       +  ++ 
Sbjct: 527 RL--DSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTY 584

Query: 566 YGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFL----- 620
            GHK  VLS+  + + + I++ S D+ +  W    G+    L  H++S+++V        
Sbjct: 585 TGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVTVANGHPL 644

Query: 621 -PESHNFFSSSKDGLVKYW 638
            PE   F + S D   + W
Sbjct: 645 GPEYGVFATGSGDCKARIW 663

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 74/151 (49%), Gaps = 12/151 (7%)

Query: 91  LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVS 150
            LA G  D +I+IWDL +K ++++  GH+  +  L +  +G +L+SGS D  + IWDL +
Sbjct: 420 FLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTT 479

Query: 151 EVGVFKLRSHKDAITGIWCE-GEDWLVSTAK-DGLIKLWDLKTQQCVETHIAQ----TGE 204
                 L S +D +T +    GE   ++    D  +++WD  T   VE   ++    TG 
Sbjct: 480 GTCSLTL-SIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGH 538

Query: 205 -----CWALGVHGDLVVTTGTDSQIKIWNLD 230
                       G  VV+   D  +K+WNL+
Sbjct: 539 RDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 91/206 (44%), Gaps = 27/206 (13%)

Query: 41  TGALEN-INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADG 99
           TGA +  I +WD++T +++  L                 ++  L+Y    N L +G  D 
Sbjct: 423 TGAEDKLIRIWDLETKKIVMTLK------------GHEQDIYSLDYFPSGNKLVSGSGDR 470

Query: 100 VIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRS 159
            ++IWDL + T  L+ S      T+      G  + +GS D  + +WD  +   V +L S
Sbjct: 471 TVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDS 530

Query: 160 -------HKDAI-TGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV- 210
                  H+D++ + ++      +VS + D  +KLW+L      ++H     EC      
Sbjct: 531 ENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSH----AECEVTYTG 586

Query: 211 HGDLVVTTGTDSQIKIWNLDTSKENG 236
           H D V++  T +Q   + L  SK+ G
Sbjct: 587 HKDFVLSVAT-TQNDEYILSGSKDRG 611

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 49/111 (44%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS 629
           L + S+  S D K + T + DK I+IW L+      +L  H+  I ++ + P  +   S 
Sbjct: 407 LYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSG 466

Query: 630 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           S D  V+ WD     C   L+             +G  + + S D ++RVW
Sbjct: 467 SGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVW 517

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 89/222 (40%), Gaps = 41/222 (18%)

Query: 47  INLWDIKTGELLSVLS--DGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIW 104
           + +WD+ TG     LS  DG+               T      E   +AAG  D  +++W
Sbjct: 472 VRIWDLTTGTCSLTLSIEDGV--------------TTVAVSPGEGKFIAAGSLDRTVRVW 517

Query: 105 DLMSKTVLLSF-------SGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGV--- 154
           D  +  ++          +GH+  V  + F   G  ++SGS D  + +W+L    G    
Sbjct: 518 DSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSH 577

Query: 155 ----FKLRSHKDAITGIWC-EGEDWLVSTAKDGLIKLWDLKT-------QQCVETHIAQT 202
                    HKD +  +   + +++++S +KD  +  WD K+       Q    + I+ T
Sbjct: 578 AECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVT 637

Query: 203 -GECWALGVHGDLVVTTGTDSQIKIWNLD--TSKENGSKIVE 241
                 LG    +  T   D + +IW      S++N ++I E
Sbjct: 638 VANGHPLGPEYGVFATGSGDCKARIWKYSKKNSQQNSTQIKE 679

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 62/139 (44%), Gaps = 17/139 (12%)

Query: 39  VLTGALEN-INLWDIKTGELLSVL--SDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAG 95
           +  G+L+  + +WD  TG L+  L   + L  G  D        V  + +  +   + +G
Sbjct: 505 IAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRD-------SVYSVVFTRDGKGVVSG 557

Query: 96  YADGVIKIWDLMS-------KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDL 148
             D  +K+W+L             ++++GHK  V  +        ++SGS+D  ++ WD 
Sbjct: 558 SLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDT 617

Query: 149 VSEVGVFKLRSHKDAITGI 167
            S   +  L+ H++++  +
Sbjct: 618 KSGNPLLMLQGHRNSVISV 636

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 74/276 (26%), Positives = 124/276 (44%), Gaps = 42/276 (15%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++++    ++  +   H   I+SLD   DG++LV+G
Sbjct: 343 YIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLK-GHEQDIYSLDYFPDGQKLVSG 401

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISP-EDKYLAVSL 546
           S D+SI+ W+    Q                    TL + D + +V +SP E K +A   
Sbjct: 402 SGDRSIRIWDLKTGQ-----------------CSLTLSIEDGVTTVAVSPNEGKLIAAGS 444

Query: 547 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD +V+++  DS   FL         S  GH+  V S+  + D + +++ S D+ +K+W 
Sbjct: 445 LDRSVRIW--DSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWN 502

Query: 598 LD-----FGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAH 652
           L       G C  +   H+D +++V    +    FS SKD  V  WD D    +  L  H
Sbjct: 503 LGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGH 562

Query: 653 QSEVWALAITS----DGST---VVSSSHDHSMRVWK 681
           ++ V ++A  +    DG       + S D   R+WK
Sbjct: 563 RNSVISVATVNSNVDDGKNYKLFATGSGDCKARIWK 598

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 116/234 (49%), Gaps = 15/234 (6%)

Query: 466 VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQ---DLVPGTTDKFVPVMKLIHDT 522
           + H++ +  +  +QDGK L TG  +++ + ++ +  +    L+  T +  +      ++ 
Sbjct: 276 LPHDSVVCCVKFSQDGKYLATG-CNRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNE 334

Query: 523 TLELNDD--ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFD 580
           T+    D  I S+  SP+ ++LA    D  ++++ +   K  + L GH+  + S+D   D
Sbjct: 335 TVTTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPD 394

Query: 581 SKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS-SKDGLVKYWD 639
            + +++ S D++I+IW L  G C  +L + +D +  V   P      ++ S D  V+ WD
Sbjct: 395 GQKLVSGSGDRSIRIWDLKTGQCSLTL-SIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWD 453

Query: 640 GDKFECVQKL-------AAHQSEVWALAITSDGSTVVSSSHDHSMRVWKETDDQ 686
                 V++L         HQ  V+++A T DG  VVS S D ++++W   D Q
Sbjct: 454 SSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQ 507

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 106/227 (46%), Gaps = 21/227 (9%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTFDCG----YALTCKFLPSGTLCVIGTREGQIQLFDLV 456
           L   A + L++IWN+K +  +          Y+L   + P G   V G+ +  I+++DL 
Sbjct: 356 LATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSL--DYFPDGQKLVSGSGDRSIRIWDLK 413

Query: 457 TSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVM 516
           T     ++ +       ++    +GK +  GS D+S++ W+ S         T   V  +
Sbjct: 414 TGQCSLTLSIEDGVTTVAVS-PNEGKLIAAGSLDRSVRIWDSS---------TGFLVERL 463

Query: 517 KLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLD-----SMKFFLSLYGHKLP 571
              +++     D + SV  + + +++    LD TVK++ L      + K  ++  GHK  
Sbjct: 464 DSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDF 523

Query: 572 VLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVC 618
           VLS+  S D K I + S D+ + IW  D G+    L  H++S+++V 
Sbjct: 524 VLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRNSVISVA 570

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 97/217 (44%), Gaps = 22/217 (10%)

Query: 41  TGALENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAE---------VTYLEYHDETNL 91
           TG      ++D+ TGEL   L D     +I   +++  E         +  + +  +   
Sbjct: 296 TGCNRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNETVTTTADLYIRSICFSPDGEF 355

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
           LA G  D +I+IW++  + +++   GH+  +  L +   G +L+SGS D  I IWDL + 
Sbjct: 356 LATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTG 415

Query: 152 VGVFKLRSHKDAITGIWCE-GEDWLVSTAK-DGLIKLWDLKTQQCVETHIA--QTGECWA 207
                L S +D +T +     E  L++    D  +++WD  T   VE   +  ++G    
Sbjct: 416 QCSLTL-SIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQ 474

Query: 208 LGVH-------GDLVVTTGTDSQIKIWNL-DTSKENG 236
             V+       G  VV+   D  +K+WNL DT    G
Sbjct: 475 DSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTG 511

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 63/135 (46%), Gaps = 11/135 (8%)

Query: 39  VLTGALE-NINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYA 97
           +  G+L+ ++ +WD  TG L+  L      G+    S     V  + +  +   + +G  
Sbjct: 440 IAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDS-----VYSVAFTKDGQHVVSGSL 494

Query: 98  DGVIKIWDLM-----SKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEV 152
           D  +K+W+L      +    +++ GHK  V  +   +    + SGS+D  +IIWD  S  
Sbjct: 495 DRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGN 554

Query: 153 GVFKLRSHKDAITGI 167
            +  L+ H++++  +
Sbjct: 555 PILMLQGHRNSVISV 569

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 116/263 (44%), Gaps = 47/263 (17%)

Query: 467 AHNAAIWSLDITQDGKRLVTGSADKSIKFWNF------------------SIEQDLVPGT 508
            H+  + SL  T+DG+ L T S DK+   W++                  S+    +P  
Sbjct: 388 GHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCLPNV 447

Query: 509 TDKFVP--VMKLIHDTTL----------ELND-----------------DILSVKISPED 539
            +K  P  ++   +D T+          +LN+                 DI ++ ++P D
Sbjct: 448 MEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPND 507

Query: 540 KYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599
              A +  D T K++ +D+ +   +L  HK  +  +      K I T S DK +KIW L+
Sbjct: 508 SIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLE 567

Query: 600 FGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWAL 659
                K+L  H +++    F+ +     S+  DGL+K WD    +C++ L  H + +WAL
Sbjct: 568 SFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWAL 627

Query: 660 AITSDGSTVVSSSHDHSMRVWKE 682
           ++  DG  ++S+  D   + WK+
Sbjct: 628 SVLEDGDLIISADADSVFQFWKD 650

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 77/169 (45%), Gaps = 3/169 (1%)

Query: 69  SIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFD 128
           SI  + +   ++  +      ++ A    D   K+W++ +   + + + HK G+  + F 
Sbjct: 487 SIYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFC 546

Query: 129 STGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLW 187
            +   + + S D  + IW L S   +  L  H +A+    +   +  LVS   DGLIK+W
Sbjct: 547 ESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVW 606

Query: 188 DLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIWNLDTSKE 234
           D+ +  C++     +   WAL V   GDL+++   DS  + W   T  E
Sbjct: 607 DIASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAE 655

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 88/177 (49%), Gaps = 17/177 (9%)

Query: 73  KSSKPAEVTYLEYHDETN-LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF-DST 130
           +S K +  +Y+   D T+ L+A G  DG I + D+ +  +  SF GH   ++ LKF    
Sbjct: 98  RSLKVSSPSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGEL 157

Query: 131 GTRL-MSGSRDSDII--IWDLVSEVGVFKLRSHKDAITGI-WCEGEDW----LVSTAKDG 182
           GT + + GS D++ +  +WDLV+    F ++ H  AI GI + + +D     L++  +D 
Sbjct: 158 GTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDN 217

Query: 183 LIKLWDL----KTQQCVETHIAQTG-ECWALGVHGD--LVVTTGTDSQIKIWNLDTS 232
           ++ LW      K+ + V+T  A    E      H D     T G D+  +I +L+ S
Sbjct: 218 VLNLWRFNIKGKSSKLVKTIPAHLQIEACGFITHNDETFAYTAGGDAVFQIIDLNES 274

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 66/152 (43%), Gaps = 17/152 (11%)

Query: 49  LWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMS 108
           LW++ TGE ++ L++    G  DV            + +    +A    D  +KIW L S
Sbjct: 521 LWNVDTGEPVATLANH-KRGLWDV-----------SFCESEKWIATCSGDKTVKIWSLES 568

Query: 109 KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIW 168
            TVL +  GH + V    F +   +L+S   D  I +WD+ S   +  L  H + I  + 
Sbjct: 569 FTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALS 628

Query: 169 C-EGEDWLVSTAKDGLIKLWDLKTQQCVETHI 199
             E  D ++S   D + + W    + C E  I
Sbjct: 629 VLEDGDLIISADADSVFQFW----KDCTEAEI 656

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 52/97 (53%), Gaps = 3/97 (3%)

Query: 410 LKIWNLKTKSCIRTFD--CGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVA 467
           +KIW+L++ + ++T +        C F+      V    +G I+++D+ +   I+++D  
Sbjct: 561 VKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLD-G 619

Query: 468 HNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDL 504
           H+  IW+L + +DG  +++  AD   +FW    E ++
Sbjct: 620 HSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEI 656

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 72/179 (40%), Gaps = 9/179 (5%)

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
           + +P  KL+H        +I  + ++P+ KYL        VK+  +++     SL     
Sbjct: 46  QLIPNRKLLHSIDNADEQEITGISLTPDGKYLIYVSQSQLVKIVNVETGVITRSLKVSS- 104

Query: 571 PVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPE-SHNFF-- 627
           P   +     S L+     D +I +  ++ G    S   H  +I ++ F  E   N +  
Sbjct: 105 PSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLL 164

Query: 628 -SSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIT----SDGSTVVSSSHDHSMRVWK 681
            S   +G+ K WD    +C   +  H S +  +  T     D   +++   D+ + +W+
Sbjct: 165 GSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWR 223

 Score = 35.4 bits (80), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 32/161 (19%), Positives = 69/161 (42%), Gaps = 17/161 (10%)

Query: 436 PSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKF 495
           P+ ++    + +   +L+++ T   + ++   H   +W +   +  K + T S DK++K 
Sbjct: 505 PNDSIFATASYDKTCKLWNVDTGEPVATL-ANHKRGLWDVSFCESEKWIATCSGDKTVKI 563

Query: 496 WNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFF 555
           W+            + F  V+K +   T    + +       + K L  +  D  +KV+ 
Sbjct: 564 WSL-----------ESFT-VLKTLEGHT----NAVQRCSFMNKQKQLVSAGADGLIKVWD 607

Query: 556 LDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
           + S     +L GH   + ++ +  D  LII++ AD   + W
Sbjct: 608 IASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFW 648

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 44/217 (20%), Positives = 83/217 (38%), Gaps = 30/217 (13%)

Query: 449 QIQLFDLVTST-LIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPG 507
           +I +  L+ +  L+ SID A    I  + +T DGK L+  S  + +K  N  +E  ++  
Sbjct: 41  EINIIQLIPNRKLLHSIDNADEQEITGISLTPDGKYLIYVSQSQLVKIVN--VETGVITR 98

Query: 508 TTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYG 567
           +     P   +  D               P    +A+   D ++ V  +++     S  G
Sbjct: 99  SLKVSSPSYVMTCD---------------PTSTLVAIGGTDGSITVIDIENGYIAHSFKG 143

Query: 568 HKLPVLSIDI--SFDSKLIITSSADKN--IKIWGLDFGDCHKSLFAHQDSIMNVCFLPES 623
           H   + S+       + + +  S D N   K+W L    C  ++  H  +I  + F    
Sbjct: 144 HGGTISSLKFYGELGTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKND 203

Query: 624 H----NFFSSSKDGLVKYW----DGDKFECVQKLAAH 652
                N  +  +D ++  W     G   + V+ + AH
Sbjct: 204 DKDVLNLITGGRDNVLNLWRFNIKGKSSKLVKTIPAH 240

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 96.3 bits (238), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 125/279 (44%), Gaps = 43/279 (15%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++DL +  ++ ++   H   I+SLD    G +LV+G
Sbjct: 371 YIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQ-GHEQDIYSLDYFPAGDKLVSG 429

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP D KY+A   
Sbjct: 430 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 472

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD TV+V+  DS   FL            GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 473 LDRTVRVW--DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWD 530

Query: 598 L-------DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLA 650
           L           C  +   H+D +++V    +     S SKD  V +WD      +  L 
Sbjct: 531 LRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQ 590

Query: 651 AHQSEVWALAITS------DGSTVVSSSHDHSMRVWKET 683
            H++ V ++A+ +      D     + S D   R+WK T
Sbjct: 591 GHRNSVISVAVVNGFPLGPDIGVFATGSGDCKARIWKYT 629

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 117/250 (46%), Gaps = 35/250 (14%)

Query: 460 LIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFS-------IEQDLVPGTTDKF 512
           L  S+D  H++ +  +  + DG+ L TG  +K+ + +  S       +  D V G  ++ 
Sbjct: 286 LHHSLD--HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTGELVARLSDDSVSGINNES 342

Query: 513 VPVMKLIHDTTLELNDD--------------ILSVKISPEDKYLAVSLLDNTVKVFFLDS 558
             V+    +   E  D+              I SV  SP+ KYLA    D  ++++ L S
Sbjct: 343 SSVVA--GNGATEKGDESSATIQPGSSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSS 400

Query: 559 MKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVC 618
            K  ++L GH+  + S+D       +++ S D+ ++IW L  G C  +L + +D +  V 
Sbjct: 401 KKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVA 459

Query: 619 FLPESHNFFSS-SKDGLVKYWDGDKFECVQKL-------AAHQSEVWALAITSDGSTVVS 670
             P    + ++ S D  V+ WD +    V++L         H+  V+++  T DG +VVS
Sbjct: 460 VSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVS 519

Query: 671 SSHDHSMRVW 680
            S D S+++W
Sbjct: 520 GSLDRSVKLW 529

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 105/233 (45%), Gaps = 36/233 (15%)

Query: 32  RKSNVGQVL-TGALENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETN 90
           R SN G+ L TG  +   ++ + TGEL++ LSD    G  +  SS  A     E  DE++
Sbjct: 300 RFSNDGEYLATGCNKTTQVYKVSTGELVARLSDDSVSGINNESSSVVAGNGATEKGDESS 359

Query: 91  -----------------------LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF 127
                                   LA G  D +I+IWDL SK +L++  GH+  +  L +
Sbjct: 360 ATIQPGSSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDY 419

Query: 128 DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIK 185
              G +L+SGS D  + IWDL +      L S +D +T +     D  ++ + + D  ++
Sbjct: 420 FPAGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRTVR 478

Query: 186 LWDLKTQQCVETHIAQ----TGE-----CWALGVHGDLVVTTGTDSQIKIWNL 229
           +WD +T   VE   ++    TG             G  VV+   D  +K+W+L
Sbjct: 479 VWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDL 531

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 96/212 (45%), Gaps = 23/212 (10%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSG--TLCVIGTREGQIQLFDLV 456
           +KL++ + +  ++IW+L+T  C  T      +T   +  G       G+ +  ++++D  
Sbjct: 424 DKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSE 483

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           T  L+E +D        H  +++S+  T+DG+ +V+GS D+S+K W+    + L    + 
Sbjct: 484 TGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDL---RGLNGQKSH 540

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
               V    H       D +LSV  + +D+Y+     D  V  +   S    L L GH+ 
Sbjct: 541 ATCEVTYTGH------KDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRN 594

Query: 571 PVLSIDI------SFDSKLIITSSADKNIKIW 596
            V+S+ +        D  +  T S D   +IW
Sbjct: 595 SVISVAVVNGFPLGPDIGVFATGSGDCKARIW 626

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 63/137 (45%), Gaps = 13/137 (9%)

Query: 39  VLTGALEN-INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYA 97
           +  G+L+  + +WD +TG L+  L         ++ +     V  + +  +   + +G  
Sbjct: 468 IAAGSLDRTVRVWDSETGFLVERLDS-----ENELSTGHKDSVYSVVFTRDGRSVVSGSL 522

Query: 98  DGVIKIWDLMS-------KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVS 150
           D  +K+WDL          T  ++++GHK  V  +        ++SGS+D  ++ WD  S
Sbjct: 523 DRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTAS 582

Query: 151 EVGVFKLRSHKDAITGI 167
              +  L+ H++++  +
Sbjct: 583 GNPLLMLQGHRNSVISV 599

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 131/293 (44%), Gaps = 34/293 (11%)

Query: 406 SNGLLKIWNLKTKS---CIRTF-DCGYALTC-KFLPSGTLCVIGTREGQIQLFDLVTSTL 460
           S   +K+ NL+T +   C+ TF +    +TC +F     L   G ++  I+L+ L  + L
Sbjct: 462 SRDAIKMDNLQTSAPSVCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPL 521

Query: 461 IESID------------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGT 508
              +             + H+  ++S+  + D + LV+ S DK+++ W+      LV   
Sbjct: 522 ESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLV--- 578

Query: 509 TDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGH 568
                        +    N  +  VK SP   Y A    D T +++  D +       GH
Sbjct: 579 -------------SYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGH 625

Query: 569 KLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFS 628
              V  +    +   ++T S+DK  ++W +  GD  +    H  S+++V   P+     +
Sbjct: 626 LNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTT 685

Query: 629 SSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
            S+DG++  WD    + ++++  H +S V++L+   +G+ +VS   D S+RVW
Sbjct: 686 GSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVW 738

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 89/188 (47%), Gaps = 18/188 (9%)

Query: 516 MKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKF-------------F 562
           M   H+T    N ++  ++ S + + +A    D+ +K++ LD                  
Sbjct: 480 MYTFHNT----NREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNT 535

Query: 563 LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPE 622
           ++L GH  PV S+  S D++ ++++S DK +++W LD   C  S   H   + +V F P 
Sbjct: 536 VTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPL 595

Query: 623 SHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWK- 681
            H F + S D   + W  D    ++  A H ++V  +    +G+ V++ S D + R+W  
Sbjct: 596 GHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDI 655

Query: 682 ETDDQVFL 689
           +T D V L
Sbjct: 656 QTGDSVRL 663

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 94/214 (43%), Gaps = 21/214 (9%)

Query: 78  AEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSG 137
             V  + +  +   L +   D  +++W L + T L+S+ GH   V  +KF   G    +G
Sbjct: 543 GPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATG 602

Query: 138 SRDSDIIIWDLVSEVGVFKLRSHKDAITGIWC----EGEDWLVSTAKDGLIKLWDLKTQQ 193
           S D    +W   S   ++ LR     +  + C        ++++ + D   ++WD++T  
Sbjct: 603 SHDQTARLW---SCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGD 659

Query: 194 CVETHIAQTGECWALGVHGDLV-VTTGT-DSQIKIWNLDTSKENGSKIVEKGTYEKQSKQ 251
            V   +  T    ++ V  D   +TTG+ D  I +W++ T    G +I       KQ + 
Sbjct: 660 SVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGT----GKRI-------KQMRG 708

Query: 252 RGLSVNFKTTAD-ETTFLYIQNSDKTVEIFRIRK 284
            G S  +  + + E   L    +D++V ++ ++K
Sbjct: 709 HGKSAVYSLSFNKEGNILVSGGADQSVRVWDLKK 742

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 65/135 (48%), Gaps = 10/135 (7%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTF--DCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +L  +S+   ++W+++T   +R F       ++    P G     G+ +G I ++D+ T 
Sbjct: 641 VLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTG 700

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWN---FSIEQDLVPGTTDKFVPV 515
             I+ +     +A++SL   ++G  LV+G AD+S++ W+   F+ E  L P       P 
Sbjct: 701 KRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLKKFTNEPSLEPEQ-----PY 755

Query: 516 MKLIHDTTLELNDDI 530
              + D    +N D+
Sbjct: 756 SGYLGDMEASVNQDV 770

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 107/240 (44%), Gaps = 24/240 (10%)

Query: 364 PYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASAS-NGLLKIWNLKTKSCIR 422
           P E +LP   +     T+   GH            N+ L SAS +  +++W+L T +C+ 
Sbjct: 520 PLESQLPSK-AKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLV 578

Query: 423 TFDCGYALTC---KFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQ 479
           ++  G+       KF P G     G+ +   +L+       +  I   H   +  +    
Sbjct: 579 SYK-GHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLR-IFAGHLNDVDCVTFHP 636

Query: 480 DGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED 539
           +G  ++TGS+DK+ + W      D+  G + +      L H  +      ++SV +SP+ 
Sbjct: 637 NGTYVLTGSSDKTCRMW------DIQTGDSVRLF----LGHTAS------VVSVAVSPDG 680

Query: 540 KYLAVSLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           ++L     D  + V+ + + K    + GH K  V S+  + +  ++++  AD+++++W L
Sbjct: 681 RWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDL 740

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 71/172 (41%), Gaps = 22/172 (12%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDL---------------MSKTVLLSFSGHKSGVT 123
           E+T L + D++ L+AAG+ D  IK+W L                S TV L   GH   V 
Sbjct: 489 EMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTL--IGHSGPVY 546

Query: 124 ILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDG 182
            + F      L+S S D  + +W L +   +   + H   +  + +     +  + + D 
Sbjct: 547 SVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQ 606

Query: 183 LIKLWD---LKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDT 231
             +LW    +   +    H+    +C     +G  V+T  +D   ++W++ T
Sbjct: 607 TARLWSCDHIYPLRIFAGHLNDV-DCVTFHPNGTYVLTGSSDKTCRMWDIQT 657

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 53/135 (39%), Gaps = 16/135 (11%)

Query: 112 LLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSH-KDAITGIWCE 170
           + +F      +T L+F      + +G +DS I +W L       +L S  KDA   +   
Sbjct: 480 MYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLI 539

Query: 171 GED-------------WLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGVH--GDLV 215
           G               +LVS ++D  ++LW L T  C+ ++       W +     G   
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYF 599

Query: 216 VTTGTDSQIKIWNLD 230
            T   D   ++W+ D
Sbjct: 600 ATGSHDQTARLWSCD 614

 Score = 32.3 bits (72), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 13/72 (18%)

Query: 37  GQVLTGALEN--INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAA 94
           G+ LT   E+  I +WDI TG+ +  +           +    + V  L ++ E N+L +
Sbjct: 680 GRWLTTGSEDGVIIVWDIGTGKRIKQM-----------RGHGKSAVYSLSFNKEGNILVS 728

Query: 95  GYADGVIKIWDL 106
           G AD  +++WDL
Sbjct: 729 GGADQSVRVWDL 740

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 123/281 (43%), Gaps = 47/281 (16%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+    +I  +   H   I+SLD    G++LV+G
Sbjct: 429 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQ-GHEQDIYSLDYFPSGEKLVSG 487

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SPED KY+A   
Sbjct: 488 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPEDGKYIAAGS 530

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 531 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWN 588

Query: 598 LD-----------FGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECV 646
           L+            G C  +   H+D +++V          S SKD  V +WD      +
Sbjct: 589 LNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPL 648

Query: 647 QKLAAHQSEVWALAIT------SDGSTVVSSSHDHSMRVWK 681
             L  H++ V ++A+       ++     + S D   R+WK
Sbjct: 649 LMLQGHRNSVISVAVANGHPLGTEYGVFATGSGDCKARIWK 689

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 116/262 (44%), Gaps = 34/262 (12%)

Query: 455 LVTSTLIESIDVA------HNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQ---DLV 505
           L    L  +IDV       H + +  +  + DGK L TG  +K+ + +N +  +    L 
Sbjct: 332 LYNPALPRNIDVELHKSLDHTSVVCCVRFSNDGKFLATG-CNKTTQVYNVASGELIARLS 390

Query: 506 PGTTDKFVPVMKLIHDTTLELNDD---------------ILSVKISPEDKYLAVSLLDNT 550
             +     P          E N+D               I SV  SP+ K+LA    D  
Sbjct: 391 DDSASHITPGQNSKDSEGGEENNDTTTYSTSATTSSDLYIRSVCFSPDGKFLATGAEDRL 450

Query: 551 VKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAH 610
           ++++ +   K  + L GH+  + S+D     + +++ S D+ ++IW L  G C  +L + 
Sbjct: 451 IRIWDIAQKKIIMVLQGHEQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSLTL-SI 509

Query: 611 QDSIMNVCFLPESHNFFSS-SKDGLVKYWDGDKFECVQKL-------AAHQSEVWALAIT 662
           +D +  V   PE   + ++ S D  V+ WD +    V++L         H+  V+++  T
Sbjct: 510 EDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFT 569

Query: 663 SDGSTVVSSSHDHSMRVWKETD 684
            DG+ VVS S D S+++W   D
Sbjct: 570 RDGNNVVSGSLDRSVKLWNLND 591

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 115/250 (46%), Gaps = 37/250 (14%)

Query: 32  RKSNVGQVL-TGALENINLWDIKTGELLSVLSDG----LPPGSIDVKSSKPAE------- 79
           R SN G+ L TG  +   ++++ +GEL++ LSD     + PG  + K S+  E       
Sbjct: 359 RFSNDGKFLATGCNKTTQVYNVASGELIARLSDDSASHITPGQ-NSKDSEGGEENNDTTT 417

Query: 80  ------------VTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKF 127
                       +  + +  +   LA G  D +I+IWD+  K +++   GH+  +  L +
Sbjct: 418 YSTSATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDY 477

Query: 128 DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIK 185
             +G +L+SGS D  + IWDL +      L S +D +T +    ED  ++ + + D  ++
Sbjct: 478 FPSGEKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPEDGKYIAAGSLDRAVR 536

Query: 186 LWDLKTQQCVETHIAQ----TGE-----CWALGVHGDLVVTTGTDSQIKIWNLDTSKENG 236
           +WD +T   VE   ++    TG             G+ VV+   D  +K+WNL+ +    
Sbjct: 537 VWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNKD 596

Query: 237 SKIVEKGTYE 246
            K    GT E
Sbjct: 597 LKPNVPGTCE 606

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 99/216 (45%), Gaps = 29/216 (13%)

Query: 400 KLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPS--GTLCVIGTREGQIQLFDLVT 457
           KL++ + +  ++IW+L+T  C  T      +T   +    G     G+ +  ++++D  T
Sbjct: 483 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSET 542

Query: 458 STLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNF--SIEQDL---VP 506
             L+E +D        H  +++S+  T+DG  +V+GS D+S+K WN   +  +DL   VP
Sbjct: 543 GFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLKPNVP 602

Query: 507 GTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLY 566
           GT +    V    H       D +LSV  +  D+Y+     D  V  +   S    L L 
Sbjct: 603 GTCE----VTYTGH------KDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPLLMLQ 652

Query: 567 GHKLPVLSIDISFDSKL------IITSSADKNIKIW 596
           GH+  V+S+ ++    L        T S D   +IW
Sbjct: 653 GHRNSVISVAVANGHPLGTEYGVFATGSGDCKARIW 688

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 72/166 (43%), Gaps = 35/166 (21%)

Query: 47  INLWDIKTGELLSVLS--DGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIW 104
           + +WD++TG+    LS  DG+   ++  +  K               +AAG  D  +++W
Sbjct: 493 VRIWDLRTGQCSLTLSIEDGVTTVAVSPEDGK--------------YIAAGSLDRAVRVW 538

Query: 105 DLMSKTVLLSF-------SGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDL--------- 148
           D  +  ++          +GHK  V  + F   G  ++SGS D  + +W+L         
Sbjct: 539 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLK 598

Query: 149 --VSEVGVFKLRSHKDAITGIWC-EGEDWLVSTAKDGLIKLWDLKT 191
             V          HKD +  +   +G+++++S +KD  +  WD K+
Sbjct: 599 PNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKS 644

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/141 (20%), Positives = 65/141 (46%), Gaps = 17/141 (12%)

Query: 39  VLTGALEN-INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYA 97
           +  G+L+  + +WD +TG L+  L         ++ +     V  + +  + N + +G  
Sbjct: 526 IAAGSLDRAVRVWDSETGFLVERLD-----SENELGTGHKDSVYSVVFTRDGNNVVSGSL 580

Query: 98  DGVIKIWDL-----------MSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIW 146
           D  +K+W+L           +  T  ++++GHK  V  +        ++SGS+D  ++ W
Sbjct: 581 DRSVKLWNLNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFW 640

Query: 147 DLVSEVGVFKLRSHKDAITGI 167
           D  S   +  L+ H++++  +
Sbjct: 641 DTKSGNPLLMLQGHRNSVISV 661

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 123/279 (44%), Gaps = 39/279 (13%)

Query: 403 ASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIE 462
           A   +  +K+W+L           G +L    +PS        +  +++  D  TSTLI 
Sbjct: 499 AGFQDSYIKLWSLD----------GSSLISNKIPS-------YKRKEMETTDPATSTLI- 540

Query: 463 SIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDT 522
                H+ +++S   + D + L++GS DK+++ W+      LV                +
Sbjct: 541 ----GHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALV----------------S 580

Query: 523 TLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSK 582
               N  +  VK SP   Y A +  D T +++  D +       GH   V ++    +  
Sbjct: 581 YKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGC 640

Query: 583 LIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDK 642
            + T S+DK  ++W +  GD  +  + H   I++    P+     + S DGL+  WD   
Sbjct: 641 YVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINLWDIGT 700

Query: 643 FECVQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
            + ++++  H ++ V +L +  +G+ ++S   DHS+RVW
Sbjct: 701 GKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVW 739

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 77/169 (45%), Gaps = 10/169 (5%)

Query: 522 TTLELNDDILSVKISPEDKYLAV------SLLDNTVKVFFLDSMK----FFLSLYGHKLP 571
           T+LE +DD        +D Y+ +      SL+ N +  +    M+       +L GH   
Sbjct: 486 TSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIGHSGS 545

Query: 572 VLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSK 631
           V S   S DS+ +++ S DK +++W LD      S   H   + +V F P  H F ++S 
Sbjct: 546 VYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATASH 605

Query: 632 DGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           D   + W  D    ++  A H S+V  ++   +G  V + S D + R+W
Sbjct: 606 DQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMW 654

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 75/192 (39%), Gaps = 48/192 (25%)

Query: 85  YHDETNLLAAGYADGVIKIWDLMSKTVLLS------------------------------ 114
           +  ++  L +G  D  +++W L + T L+S                              
Sbjct: 551 FSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATASHDQTAR 610

Query: 115 ------------FSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKD 162
                       F+GH S V  + F   G  + +GS D    +WD+ +   V     H  
Sbjct: 611 LWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTA 670

Query: 163 AI--TGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVET---HIAQTGECWALGVHGDLVVT 217
            I  T +  +G  WL + + DGLI LWD+ T + ++    H         L   G+++++
Sbjct: 671 PILSTVVTPDGR-WLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLS 729

Query: 218 TGTDSQIKIWNL 229
            G D  +++W+L
Sbjct: 730 GGADHSVRVWDL 741

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 62/132 (46%), Gaps = 4/132 (3%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTF--DCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +   +S+   ++W++ T   +R F       L+    P G     G+ +G I L+D+ T 
Sbjct: 642 VFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINLWDIGTG 701

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKL 518
             I+ +      A+ SL + ++G  L++G AD S++ W+     +  PG   +  P +  
Sbjct: 702 KRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLKKATN-EPGLEPE-QPFIGH 759

Query: 519 IHDTTLELNDDI 530
           I D T  +N D+
Sbjct: 760 IGDVTASINQDV 771

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 67/175 (38%), Gaps = 22/175 (12%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVL-------------------LSFSGHK 119
           ++T LE+ D++ L AAG+ D  IK+W L   +++                    +  GH 
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIGHS 543

Query: 120 SGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVST 178
             V    F      L+SGS D  + +W L +   +   + H   +  + +     +  + 
Sbjct: 544 GSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATA 603

Query: 179 AKDGLIKLWDLKTQQCVETHIAQTGECWALGVH--GDLVVTTGTDSQIKIWNLDT 231
           + D   +LW       +        +   +  H  G  V T  +D   ++W++ T
Sbjct: 604 SHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDIST 658

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 11/64 (17%)

Query: 47  INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDL 106
           INLWDI TG+ +  +           +      V  L  + E N+L +G AD  +++WDL
Sbjct: 693 INLWDIGTGKRIKQM-----------RGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDL 741

Query: 107 MSKT 110
              T
Sbjct: 742 KKAT 745

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 125/283 (44%), Gaps = 49/283 (17%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+    ++  +   H   I+SLD  Q G +LV+G
Sbjct: 375 YIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLR-GHEQDIYSLDYFQSGNKLVSG 433

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++I+ W+    Q  +                 TL + D + +V +SP +  Y+A   
Sbjct: 434 SGDRTIRIWDLHTGQCSL-----------------TLSIEDGVTTVAVSPGNGNYVAAGS 476

Query: 547 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD TV+V+  DS   FL         +  GHK  V S+  + D K I++ S D+++K+W 
Sbjct: 477 LDRTVRVW--DSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWN 534

Query: 598 LDF-------------GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFE 644
           L               G+C  +   H+D +++V          S SKD  V +WD     
Sbjct: 535 LRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGV 594

Query: 645 CVQKLAAHQSEVWALAIT------SDGSTVVSSSHDHSMRVWK 681
            +  L  H++ V ++A+       ++ +   + S D   ++WK
Sbjct: 595 PLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWK 637

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 109/230 (47%), Gaps = 30/230 (13%)

Query: 468 HNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELN 527
           H++ +  +  + +G+ L TG  +K+ K +      ++  G       V +L+ DT     
Sbjct: 317 HDSVVCCVKFSNNGEYLATG-CNKTTKIF------EVATGNL-----VTELVDDTKTGTE 364

Query: 528 DD---------ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDIS 578
           D          I SV  SP+ K+LA    D  ++++ +   K  + L GH+  + S+D  
Sbjct: 365 DANSASSADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYF 424

Query: 579 FDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS-SKDGLVKY 637
                +++ S D+ I+IW L  G C  +L + +D +  V   P + N+ ++ S D  V+ 
Sbjct: 425 QSGNKLVSGSGDRTIRIWDLHTGQCSLTL-SIEDGVTTVAVSPGNGNYVAAGSLDRTVRV 483

Query: 638 WDGDKFECVQKL-------AAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           WD +    V++L         H+  V+++  T DG  +VS S D S+++W
Sbjct: 484 WDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLW 533

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 103/210 (49%), Gaps = 15/210 (7%)

Query: 34  SNVGQVL-TGALENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAE--VTYLEYHDETN 90
           SN G+ L TG  +   ++++ TG L++ L D    G+ D  S+  A+  +  + +  +  
Sbjct: 327 SNNGEYLATGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGK 386

Query: 91  LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVS 150
            LA G  D +I+IWD+  + +++   GH+  +  L +  +G +L+SGS D  I IWDL +
Sbjct: 387 FLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHT 446

Query: 151 EVGVFKLRSHKDAITGIWCE--GEDWLVSTAKDGLIKLWDLKTQQCV-------ETHIAQ 201
                 L S +D +T +       +++ + + D  +++WD  +   V       ET +  
Sbjct: 447 GQCSLTL-SIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGH 505

Query: 202 TGECWAL--GVHGDLVVTTGTDSQIKIWNL 229
               +++     G  +V+   D  +K+WNL
Sbjct: 506 KDSVYSVVFTRDGKNIVSGSLDRSVKLWNL 535

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 98/212 (46%), Gaps = 17/212 (8%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLP--SGTLCVIGTREGQIQLFDLV 456
           NKL++ + +  ++IW+L T  C  T      +T   +   +G     G+ +  ++++D  
Sbjct: 428 NKLVSGSGDRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSN 487

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           +  L+E +D      V H  +++S+  T+DGK +V+GS D+S+K WN    +++   +T 
Sbjct: 488 SGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNL---RNINGASTS 544

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
                      T +   D +LSV  +  D+Y+     D  V  +   S    L L GH+ 
Sbjct: 545 PQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRN 604

Query: 571 PVLSIDISFDSKL------IITSSADKNIKIW 596
            V+S+ ++    L        T S D   KIW
Sbjct: 605 SVISVAVANGKPLGANYNVFATGSGDCKAKIW 636

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 66/147 (44%), Gaps = 19/147 (12%)

Query: 35  NVGQVLTGALEN-INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLA 93
           N   V  G+L+  + +WD  +G L+  L      G   V   K +  + +   D  N+++
Sbjct: 468 NGNYVAAGSLDRTVRVWDSNSGFLVERLDS---EGETGV-GHKDSVYSVVFTRDGKNIVS 523

Query: 94  AGYADGVIKIWDLMS-------------KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRD 140
            G  D  +K+W+L +                 +++ GHK  V  +        ++SGS+D
Sbjct: 524 -GSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKD 582

Query: 141 SDIIIWDLVSEVGVFKLRSHKDAITGI 167
             +I WD VS V +  L+ H++++  +
Sbjct: 583 RGVIFWDKVSGVPLLMLQGHRNSVISV 609

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 126/283 (44%), Gaps = 50/283 (17%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+    ++  I   H   I+SLD    G +LV+G
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIV-MILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP D KY+A   
Sbjct: 504 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 546

Query: 547 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL         S  GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 547 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 598 L------------DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           L            + G C  +   H+D +++V          S SKD  V +WD      
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 664

Query: 646 VQKLAAHQSEVWALAITSDGSTV-------VSSSHDHSMRVWK 681
           +  L  H++ V ++A+ ++GS +        + S D   R+WK
Sbjct: 665 LLMLQGHRNSVISVAV-ANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 97/212 (45%), Gaps = 18/212 (8%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSG--TLCVIGTREGQIQLFDLV 456
           +KL++ + +  ++IW+L+T  C  T      +T   +  G       G+ +  ++++D  
Sbjct: 498 DKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSE 557

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           T  L+E +D        H  +++S+  T+DG+ +V+GS D+S+K WN     +     +D
Sbjct: 558 TGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANN----KSD 613

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
              P       T +   D +LSV  +  D+Y+     D  V  +   S    L L GH+ 
Sbjct: 614 SKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRN 673

Query: 571 PVLSIDISFDSKL------IITSSADKNIKIW 596
            V+S+ ++  S L        T S D   +IW
Sbjct: 674 SVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 93/188 (49%), Gaps = 16/188 (8%)

Query: 74  SSKPAEVTYLE---YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDST 130
           SS P+   Y+    +  +   LA G  D +I+IWD+ ++ +++   GH+  +  L +  +
Sbjct: 437 SSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPS 496

Query: 131 GTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIKLWD 188
           G +L+SGS D  + IWDL +      L S +D +T +     D  ++ + + D  +++WD
Sbjct: 497 GDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 555

Query: 189 LKTQQCVETHIA--QTGECWALGVH-------GDLVVTTGTDSQIKIWNL-DTSKENGSK 238
            +T   VE   +  ++G      V+       G  VV+   D  +K+WNL + + ++ SK
Sbjct: 556 SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSK 615

Query: 239 IVEKGTYE 246
               GT E
Sbjct: 616 TPNSGTCE 623

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 48/111 (43%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS 629
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 630 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           S D  V+ WD    +C   L+             DG  + + S D ++RVW
Sbjct: 504 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 554

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 95/235 (40%), Gaps = 54/235 (22%)

Query: 25  WLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSVLS--DGLPPGSIDVKSSKPAEVTY 82
           + PS D   S  G         + +WD++TG+    LS  DG+   ++      P +  Y
Sbjct: 493 YFPSGDKLVSGSGD------RTVRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKY 541

Query: 83  LEYHDETNLLAAGYADGVIKIWDLMSKTVLL---------SFSGHKSGVTILKFDSTGTR 133
                    +AAG  D  +++WD  S+T  L         S +GHK  V  + F   G  
Sbjct: 542 ---------IAAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQS 590

Query: 134 LMSGSRDSDIIIWDL----------VSEVGVFKLR--SHKDAITGIW-CEGEDWLVSTAK 180
           ++SGS D  + +W+L              G  ++    HKD +  +   + +++++S +K
Sbjct: 591 VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSK 650

Query: 181 DGLIKLWDLKTQQ---CVETH-----IAQTGECWALGVHGDLVVTTGTDSQIKIW 227
           D  +  WD K+      ++ H              LG   ++  T   D + +IW
Sbjct: 651 DRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 126/283 (44%), Gaps = 50/283 (17%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+    ++  I   H   I+SLD    G +LV+G
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIV-MILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP D KY+A   
Sbjct: 504 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 546

Query: 547 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL         S  GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 547 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 598 L------------DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           L            + G C  +   H+D +++V          S SKD  V +WD      
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNP 664

Query: 646 VQKLAAHQSEVWALAITSDGSTV-------VSSSHDHSMRVWK 681
           +  L  H++ V ++A+ ++GS +        + S D   R+WK
Sbjct: 665 LLMLQGHRNSVISVAV-ANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 97/212 (45%), Gaps = 18/212 (8%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSG--TLCVIGTREGQIQLFDLV 456
           +KL++ + +  ++IW+L+T  C  T      +T   +  G       G+ +  ++++D  
Sbjct: 498 DKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSE 557

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           T  L+E +D        H  +++S+  T+DG+ +V+GS D+S+K WN     +     +D
Sbjct: 558 TGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANN----KSD 613

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
              P       T +   D +LSV  +  D+Y+     D  V  +   S    L L GH+ 
Sbjct: 614 SKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNPLLMLQGHRN 673

Query: 571 PVLSIDISFDSKL------IITSSADKNIKIW 596
            V+S+ ++  S L        T S D   +IW
Sbjct: 674 SVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 93/188 (49%), Gaps = 16/188 (8%)

Query: 74  SSKPAEVTYLE---YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDST 130
           SS P+   Y+    +  +   LA G  D +I+IWD+ ++ +++   GH+  +  L +  +
Sbjct: 437 SSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPS 496

Query: 131 GTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIKLWD 188
           G +L+SGS D  + IWDL +      L S +D +T +     D  ++ + + D  +++WD
Sbjct: 497 GDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 555

Query: 189 LKTQQCVETHIA--QTGECWALGVH-------GDLVVTTGTDSQIKIWNL-DTSKENGSK 238
            +T   VE   +  ++G      V+       G  VV+   D  +K+WNL + + ++ SK
Sbjct: 556 SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSK 615

Query: 239 IVEKGTYE 246
               GT E
Sbjct: 616 TPNSGTCE 623

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 48/111 (43%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS 629
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 630 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           S D  V+ WD    +C   L+             DG  + + S D ++RVW
Sbjct: 504 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 554

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 80/188 (42%), Gaps = 46/188 (24%)

Query: 25  WLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSVLS--DGLPPGSIDVKSSKPAEVTY 82
           + PS D   S  G         + +WD++TG+    LS  DG+   ++      P +  Y
Sbjct: 493 YFPSGDKLVSGSGD------RTVRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKY 541

Query: 83  LEYHDETNLLAAGYADGVIKIWDLMSKTVLL---------SFSGHKSGVTILKFDSTGTR 133
                    +AAG  D  +++WD  S+T  L         S +GHK  V  + F   G  
Sbjct: 542 ---------IAAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQS 590

Query: 134 LMSGSRDSDIIIWDL----------VSEVGVFKLR--SHKDAITGIW-CEGEDWLVSTAK 180
           ++SGS D  + +W+L              G  ++    HKD +  +   + +++++S +K
Sbjct: 591 VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSK 650

Query: 181 DGLIKLWD 188
           D  +  WD
Sbjct: 651 DRGVLFWD 658

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 63/142 (44%), Gaps = 18/142 (12%)

Query: 39  VLTGALEN-INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYA 97
           +  G+L+  + +WD +TG L+  L      G+    S     V  + +  +   + +G  
Sbjct: 542 IAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDS-----VYSVVFTRDGQSVVSGSL 596

Query: 98  DGVIKIWDLM------------SKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIII 145
           D  +K+W+L             S T  +++ GHK  V  +        ++SGS+D  ++ 
Sbjct: 597 DRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 656

Query: 146 WDLVSEVGVFKLRSHKDAITGI 167
           WD  S   +  L+ H++++  +
Sbjct: 657 WDKTSGNPLLMLQGHRNSVISV 678

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 131/293 (44%), Gaps = 34/293 (11%)

Query: 406 SNGLLKIWNLKTKS---CIRTF-DCGYALTC-KFLPSGTLCVIGTREGQIQLFDL----- 455
           S   +K+ NL++ +   C+ TF +    +TC +F    TL   G ++  I+L+ L     
Sbjct: 396 SRDAIKLDNLQSAAPSVCMYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPL 455

Query: 456 ---VTSTLIESID----VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGT 508
              + S   E I+    + H+  ++S   + D K L++ S DK+++ W+      LV   
Sbjct: 456 DSKLPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLV--- 512

Query: 509 TDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGH 568
                        +    N  +  V  SP   Y A +  D T +++  D +       GH
Sbjct: 513 -------------SYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGH 559

Query: 569 KLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFS 628
              V  +    +   + T S DK  ++W +  GD  +    H   +++    P+     +
Sbjct: 560 LNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLST 619

Query: 629 SSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
            S+DG++  WD    + ++++  H ++ V++L+ + +G+ +VS   DHS+RVW
Sbjct: 620 GSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVW 672

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 66/146 (45%), Gaps = 6/146 (4%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
            A    D   ++W       L  F+GH + V  + F   GT + +GS D    +WD+ + 
Sbjct: 533 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTG 592

Query: 152 VGVFKLRSHKDAI--TGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVET---HIAQTGECW 206
             V     H   +  T +  +G  WL + ++DG+I +WD+ T + ++    H        
Sbjct: 593 DSVRLFLGHTAPVISTAVSPDGR-WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSL 651

Query: 207 ALGVHGDLVVTTGTDSQIKIWNLDTS 232
           +    G ++V+ G D  +++W+L  S
Sbjct: 652 SYSKEGTVLVSGGADHSVRVWDLKRS 677

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 63/132 (47%), Gaps = 4/132 (3%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTF--DCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +   +++   ++W++ T   +R F       ++    P G     G+ +G I ++D+ T 
Sbjct: 575 VFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTG 634

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKL 518
             ++ +      A++SL  +++G  LV+G AD S++ W+  +++      T+   P    
Sbjct: 635 KRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWD--LKRSTAEPNTEPEQPFTSY 692

Query: 519 IHDTTLELNDDI 530
             D T  +N+DI
Sbjct: 693 FGDATTSVNNDI 704

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 70/173 (40%), Gaps = 24/173 (13%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDL----------------MSKTVLLSFSGHKSGV 122
           ++T LE+ D+  L AAG+ D  IK+W L                ++ T L+   GH   V
Sbjct: 423 DMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLI---GHSGTV 479

Query: 123 TILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKD 181
               F      L+S S D  + +W + +   +   + H   +  + +     +  + + D
Sbjct: 480 YSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHD 539

Query: 182 GLIKLWD---LKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDT 231
              +LW    +   +    H+    +C +   +G  V T  TD   ++W++ T
Sbjct: 540 QTARLWSCDHIYPLRIFAGHLNDV-DCVSFHPNGTYVFTGSTDKTCRMWDIGT 591

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 54/114 (47%), Gaps = 2/114 (1%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           +V  + +H     +  G  D   ++WD+ +   +  F GH + V        G  L +GS
Sbjct: 562 DVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGS 621

Query: 139 RDSDIIIWDLVSEVGVFKLRSH-KDAITGIWCEGEDW-LVSTAKDGLIKLWDLK 190
            D  I +WD+ +   + ++R H K+A+  +    E   LVS   D  +++WDLK
Sbjct: 622 EDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 11/65 (16%)

Query: 47  INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDL 106
           IN+WDI TG+ L  +           +      V  L Y  E  +L +G AD  +++WDL
Sbjct: 626 INVWDIGTGKRLKQM-----------RGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDL 674

Query: 107 MSKTV 111
              T 
Sbjct: 675 KRSTA 679

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 57/150 (38%), Gaps = 19/150 (12%)

Query: 100 VIKIWDLMSKT---VLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFK 156
            IK+ +L S      + +F      +T L+F    T   +G +DS I +W L       K
Sbjct: 399 AIKLDNLQSAAPSVCMYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSK 458

Query: 157 LRS-HKDAITGIWCEGED-------------WLVSTAKDGLIKLWDLKTQQCVETHIAQT 202
           L S  ++ I      G               +L+S ++D  ++LW + T   + ++    
Sbjct: 459 LPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHN 518

Query: 203 GECW--ALGVHGDLVVTTGTDSQIKIWNLD 230
              W  +    G    T   D   ++W+ D
Sbjct: 519 HPVWDVSFSPLGHYFATASHDQTARLWSCD 548

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 94.0 bits (232), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 105/228 (46%), Gaps = 22/228 (9%)

Query: 454 DLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFV 513
           D   +TLI      H+ A++S   + D K L++GS DK+++ W+      LV        
Sbjct: 576 DFTNTTLI-----GHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLV-------- 622

Query: 514 PVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 573
                   +    N  +  VK SP   Y A +  D T +++  D +       GH   V 
Sbjct: 623 --------SYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVD 674

Query: 574 SIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDG 633
            +    +   + T S+DK  ++W +  GD  +    H   +++    P+     + S+DG
Sbjct: 675 CVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDG 734

Query: 634 LVKYWDGDKFECVQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
           ++  WD    + ++ +  H ++ +++L+ + +G+ +VSS  DHS+RVW
Sbjct: 735 IINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVW 782

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 61/127 (48%), Gaps = 1/127 (0%)

Query: 564 SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPES 623
           +L GH   V S   S D+K +I+ S DK +++W LD      S   H   + +V F P  
Sbjct: 581 TLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLG 640

Query: 624 HNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWK-E 682
           H F ++S D   + W  D    ++  A H S+V  ++   +G  V + S D + R+W   
Sbjct: 641 HYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVS 700

Query: 683 TDDQVFL 689
           T D V L
Sbjct: 701 TGDSVRL 707

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 93/218 (42%), Gaps = 24/218 (11%)

Query: 426 CGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLV 485
            G   +  F P     + G+ +  ++L+ L T+T + S    HN  +W +  +  G    
Sbjct: 586 SGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYK-GHNHPVWDVKFSPLGHYFA 644

Query: 486 TGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVS 545
           T S D++ + W           + D   P+       +     D+  V   P   Y+   
Sbjct: 645 TASHDQTARLW-----------SCDHIYPLRIFAGHLS-----DVDCVSFHPNGCYVFTG 688

Query: 546 LLDNTVKVFFL---DSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGD 602
             D T +++ +   DS++ FL   GH  PV+S  +S D + + T S D  I +W +  G 
Sbjct: 689 SSDKTCRMWDVSTGDSVRLFL---GHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGK 745

Query: 603 CHKSLFAH-QDSIMNVCFLPESHNFFSSSKDGLVKYWD 639
             K +  H +++I ++ +  E +   SS  D  V+ WD
Sbjct: 746 RLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWD 783

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 65/143 (45%), Gaps = 6/143 (4%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
            A    D   ++W       L  F+GH S V  + F   G  + +GS D    +WD+ + 
Sbjct: 643 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 702

Query: 152 VGVFKLRSHKDAI--TGIWCEGEDWLVSTAKDGLIKLWDLKTQQ---CVETHIAQTGECW 206
             V     H   +  T +  +G  WL + ++DG+I +WD+ T +    +  H        
Sbjct: 703 DSVRLFLGHTAPVISTAVSPDGR-WLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSL 761

Query: 207 ALGVHGDLVVTTGTDSQIKIWNL 229
           +    G+++V++G D  +++W+L
Sbjct: 762 SYSKEGNVLVSSGADHSVRVWDL 784

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 70/146 (47%), Gaps = 5/146 (3%)

Query: 78  AEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSG 137
           ++V  + +H     +  G +D   ++WD+ +   +  F GH + V        G  L +G
Sbjct: 671 SDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTG 730

Query: 138 SRDSDIIIWDLVSEVGVFKLRSH-KDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCV 195
           S D  I +WD+ +   +  +R H K+AI  + + +  + LVS+  D  +++WDLK  +  
Sbjct: 731 SEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDLK--KAT 788

Query: 196 ETHIAQTGECWALGVHGDLVVTTGTD 221
               A+  E + +G  GD+  +   D
Sbjct: 789 AEPSAEPEEPF-VGYLGDVTASINQD 813

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/185 (18%), Positives = 71/185 (38%), Gaps = 36/185 (19%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDL----------------------------MSKT 110
           ++T L++ +++ L A G+ D  IK+W L                             + T
Sbjct: 521 DMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFTNT 580

Query: 111 VLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WC 169
            L+   GH   V    F      L+SGS D  + +W L +   +   + H   +  + + 
Sbjct: 581 TLI---GHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFS 637

Query: 170 EGEDWLVSTAKDGLIKLWD---LKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKI 226
               +  + + D   +LW    +   +    H++   +C +   +G  V T  +D   ++
Sbjct: 638 PLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDV-DCVSFHPNGCYVFTGSSDKTCRM 696

Query: 227 WNLDT 231
           W++ T
Sbjct: 697 WDVST 701

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 11/65 (16%)

Query: 47  INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDL 106
           IN+WDI TG+ L ++           +      +  L Y  E N+L +  AD  +++WDL
Sbjct: 736 INVWDIGTGKRLKLM-----------RGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDL 784

Query: 107 MSKTV 111
              T 
Sbjct: 785 KKATA 789

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 125/283 (44%), Gaps = 50/283 (17%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+    ++  I   H   I+SLD    G +LV+G
Sbjct: 441 YIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIV-MILQGHEQDIYSLDYFPSGDKLVSG 499

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP D KY+A   
Sbjct: 500 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 542

Query: 547 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL         S  GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 543 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWN 600

Query: 598 L------------DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           L            + G C  +   H+D +++V          S SKD  V +WD      
Sbjct: 601 LQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 660

Query: 646 VQKLAAHQSEVWALAITSDGSTV-------VSSSHDHSMRVWK 681
           +  L  H++ V ++A+ ++GS +        + S D   R+WK
Sbjct: 661 LLMLQGHRNSVISVAV-ANGSPLGPEYNVFATGSGDCKARIWK 702

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 96/212 (45%), Gaps = 18/212 (8%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSG--TLCVIGTREGQIQLFDLV 456
           +KL++ + +  ++IW+L+T  C  T      +T   +  G       G+ +  ++++D  
Sbjct: 494 DKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSE 553

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           T  L+E +D        H  +++S+  T+DG  +V+GS D+S+K WN     +     +D
Sbjct: 554 TGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANN----KSD 609

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
              P       T +   D +LSV  +  D+Y+     D  V  +   S    L L GH+ 
Sbjct: 610 SKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRN 669

Query: 571 PVLSIDISFDSKL------IITSSADKNIKIW 596
            V+S+ ++  S L        T S D   +IW
Sbjct: 670 SVISVAVANGSPLGPEYNVFATGSGDCKARIW 701

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 92/188 (48%), Gaps = 16/188 (8%)

Query: 74  SSKPAEVTYLE---YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDST 130
           SS P+   Y+    +  +   LA G  D +I+IWD+  + +++   GH+  +  L +  +
Sbjct: 433 SSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPS 492

Query: 131 GTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIKLWD 188
           G +L+SGS D  + IWDL +      L S +D +T +     D  ++ + + D  +++WD
Sbjct: 493 GDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 551

Query: 189 LKTQQCVETHIA--QTGECWALGVH-------GDLVVTTGTDSQIKIWNL-DTSKENGSK 238
            +T   VE   +  ++G      V+       G  VV+   D  +K+WNL + + ++ SK
Sbjct: 552 SETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSK 611

Query: 239 IVEKGTYE 246
               GT E
Sbjct: 612 APNSGTCE 619

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 48/111 (43%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS 629
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 440 LYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSG 499

Query: 630 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           S D  V+ WD    +C   L+             DG  + + S D ++RVW
Sbjct: 500 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 550

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 95/235 (40%), Gaps = 54/235 (22%)

Query: 25  WLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSVLS--DGLPPGSIDVKSSKPAEVTY 82
           + PS D   S  G         + +WD++TG+    LS  DG+   ++      P +  Y
Sbjct: 489 YFPSGDKLVSGSGD------RTVRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKY 537

Query: 83  LEYHDETNLLAAGYADGVIKIWDLMSKTVLL---------SFSGHKSGVTILKFDSTGTR 133
                    +AAG  D  +++WD  S+T  L         S +GHK  V  + F   G  
Sbjct: 538 ---------IAAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGHS 586

Query: 134 LMSGSRDSDIIIWDL----------VSEVGVFKLR--SHKDAITGIW-CEGEDWLVSTAK 180
           ++SGS D  + +W+L              G  ++    HKD +  +   + +++++S +K
Sbjct: 587 VVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSK 646

Query: 181 DGLIKLWDLKTQQ---CVETH-----IAQTGECWALGVHGDLVVTTGTDSQIKIW 227
           D  +  WD K+      ++ H              LG   ++  T   D + +IW
Sbjct: 647 DRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 701

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 123/283 (43%), Gaps = 49/283 (17%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++DL T  ++ ++   H   I+SLD    G +LV+G
Sbjct: 380 YIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQ-GHEQDIYSLDYFPSGDKLVSG 438

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISP-EDKYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP E K++A   
Sbjct: 439 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGEGKFIAAGS 481

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD T++V+  DS   FL            GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 482 LDRTLRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWN 539

Query: 598 LD-------------FGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFE 644
           L                 C  +   H+D +++V          S SKD  V +WD     
Sbjct: 540 LHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGN 599

Query: 645 CVQKLAAHQSEVWALAITS------DGSTVVSSSHDHSMRVWK 681
            +  L  H++ V ++A+ +      D     + S D   R+WK
Sbjct: 600 PLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIWK 642

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 96/212 (45%), Gaps = 17/212 (8%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSGT--LCVIGTREGQIQLFDLV 456
           +KL++ + +  ++IW+L+T  C  T      +T   +  G       G+ +  ++++D  
Sbjct: 433 DKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSE 492

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           T  L+E +D        H  +++S+  T+DG+ +V+GS D+S+K WN     +    + +
Sbjct: 493 TGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNL---HNTGSSSKN 549

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
              P       T     D +LSV  +  DKY+     D  V  +   S    L L GH+ 
Sbjct: 550 DSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPLLMLQGHRN 609

Query: 571 PVLSIDIS------FDSKLIITSSADKNIKIW 596
            V+S+ ++       D  +  T S D   +IW
Sbjct: 610 SVISVAVANGFPLGPDYGVFATGSGDCKARIW 641

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 109/243 (44%), Gaps = 37/243 (15%)

Query: 32  RKSNVGQVL-TGALENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAE----------- 79
           R SN G+ L TG  +   ++ + TG L++ LSD     + +   S+ A            
Sbjct: 311 RFSNDGEYLATGCNKTTQVYKVSTGALVARLSDDSASTTANSSISQDANNSGENGENAVS 370

Query: 80  ----------VTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDS 129
                     +  + +  +   LA G  D +I+IWDL +K ++++  GH+  +  L +  
Sbjct: 371 SASTSSSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFP 430

Query: 130 TGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWC-EGEDWLVSTAK-DGLIKLW 187
           +G +L+SGS D  + IWDL +      L S +D +T +    GE   ++    D  +++W
Sbjct: 431 SGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGEGKFIAAGSLDRTLRVW 489

Query: 188 DLKTQQCVETHIAQ----TGE-----CWALGVHGDLVVTTGTDSQIKIWNLD---TSKEN 235
           D +T   VE   ++    TG             G  VV+   D  +K+WNL    +S +N
Sbjct: 490 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNTGSSSKN 549

Query: 236 GSK 238
            SK
Sbjct: 550 DSK 552

 Score = 38.9 bits (89), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 2/72 (2%)

Query: 174 WLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIWNLDT 231
           +L + A+D LI++WDL T++ V T      + ++L     GD +V+   D  ++IW+L T
Sbjct: 392 FLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRT 451

Query: 232 SKENGSKIVEKG 243
            + + +  +E G
Sbjct: 452 GQCSLTLSIEDG 463

 Score = 38.5 bits (88), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 73/193 (37%), Gaps = 56/193 (29%)

Query: 25  WLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSVLS--DGLPPGSIDVKSSK------ 76
           + PS D   S  G         + +WD++TG+    LS  DG+   ++     K      
Sbjct: 428 YFPSGDKLVSGSGD------RTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGS 481

Query: 77  --------PAEVTYL-EYHDETNLLAAGYADGV--------------------IKIWDL- 106
                    +E  +L E  D  N L  G+ D V                    +K+W+L 
Sbjct: 482 LDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLH 541

Query: 107 ------------MSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGV 154
                        + T  ++++GHK  V  +        ++SGS+D  ++ WD  S   +
Sbjct: 542 NTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPL 601

Query: 155 FKLRSHKDAITGI 167
             L+ H++++  +
Sbjct: 602 LMLQGHRNSVISV 614

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 122/283 (43%), Gaps = 47/283 (16%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+    ++  +   H   I+SLD    G +LV+G
Sbjct: 464 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 522

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP D KY+A   
Sbjct: 523 SGDRTVRIWDLRNGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 565

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 566 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWN 623

Query: 598 LD-----------FGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECV 646
           L             G C  +   H+D +++V          S SKD  V +WD      +
Sbjct: 624 LRGDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPL 683

Query: 647 QKLAAHQSEVWALAITSD---GSTV---VSSSHDHSMRVWKET 683
             L  H++ V ++A+ +    G  V    + S D   R+WK T
Sbjct: 684 LMLQGHRNSVISVAVANGFPLGPNVGVFATGSGDCKARIWKYT 726

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 106/251 (42%), Gaps = 38/251 (15%)

Query: 32  RKSNVGQVL-TGALENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETN 90
           R SN GQ L TG  +   ++ +  GEL++ LSD      +  +S   A  T      ETN
Sbjct: 393 RFSNDGQFLATGCNKTTQVFRVSDGELVARLSDDSTSQGVQGQSDA-ANGTADGTSGETN 451

Query: 91  ------------------------LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILK 126
                                    LA G  D +I+IWD+  K +++   GH+  +  L 
Sbjct: 452 SFATSTSASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLD 511

Query: 127 FDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLI 184
           +  +G +L+SGS D  + IWDL +      L S +D +T +     D  ++ + + D  +
Sbjct: 512 YFPSGDKLVSGSGDRTVRIWDLRNGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAV 570

Query: 185 KLWDLKTQQCVETHIAQ----TGE-----CWALGVHGDLVVTTGTDSQIKIWNLDTSKEN 235
           ++WD +T   VE   ++    TG             G+ VV+   D  +K+WNL      
Sbjct: 571 RVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQ 630

Query: 236 GSKIVEKGTYE 246
             K    GT E
Sbjct: 631 DVKPNVPGTCE 641

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 41/76 (53%)

Query: 614 IMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSH 673
           I +VCF P+     + ++D L++ WD  + + V  L  H+ ++++L     G  +VS S 
Sbjct: 465 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 524

Query: 674 DHSMRVWKETDDQVFL 689
           D ++R+W   + Q  L
Sbjct: 525 DRTVRIWDLRNGQCSL 540

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 91/234 (38%), Gaps = 53/234 (22%)

Query: 25  WLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSVLS--DGLPPGSIDVKSSKPAEVTY 82
           + PS D   S  G         + +WD++ G+    LS  DG     +   +  P +  Y
Sbjct: 512 YFPSGDKLVSGSGD------RTVRIWDLRNGQCSLTLSIEDG-----VTTVAVSPGDGKY 560

Query: 83  LEYHDETNLLAAGYADGVIKIWDLMSKTVLLS---------FSGHKSGVTILKFDSTGTR 133
           +         AAG  D  +++WD  S+T  L           +GHK  V  + F   G  
Sbjct: 561 I---------AAGSLDRAVRVWD--SETGFLVERLDSENELGTGHKDSVYSVVFTRDGNN 609

Query: 134 LMSGSRDSDIIIWDL-----------VSEVGVFKLRSHKDAITGIWC-EGEDWLVSTAKD 181
           ++SGS D  + +W+L           V          HKD +  +   + +++++S +KD
Sbjct: 610 VVSGSLDRSVKLWNLRGDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKD 669

Query: 182 GLIKLWDLKTQQ---CVETH-----IAQTGECWALGVHGDLVVTTGTDSQIKIW 227
             +  WD K+      ++ H            + LG +  +  T   D + +IW
Sbjct: 670 RGVLFWDTKSGNPLLMLQGHRNSVISVAVANGFPLGPNVGVFATGSGDCKARIW 723

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 124/274 (45%), Gaps = 38/274 (13%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+ T  ++  I   H   I+SLD    G++LV+G
Sbjct: 459 YIRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIV-MILKGHEQDIYSLDYFPSGEKLVSG 517

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S DK+++ W+    Q  +                 TL + D + +V  SP + K++A   
Sbjct: 518 SGDKTVRIWDLRTGQCSL-----------------TLSIEDGVTTVSSSPNNGKFIAAGS 560

Query: 547 LDNTVKV------FFLDSMKFFLSLY-GHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599
           LD + ++      F L  +     L  GHK  + S+  + D K +++ S D+++K+W LD
Sbjct: 561 LDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLD 620

Query: 600 FGD------CHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQ 653
             +      C  +   H+D +++V          S SKD  V +WD +    +  L  H+
Sbjct: 621 TTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHK 680

Query: 654 SEVWALAITS------DGSTVVSSSHDHSMRVWK 681
           + V ++A+ +      +     + S D + ++W+
Sbjct: 681 NSVISVAVANGQPLGPEFGVFSTGSGDFTAKIWR 714

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 109/235 (46%), Gaps = 33/235 (14%)

Query: 32  RKSNVGQVL-TGALENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAE----------- 79
           R SN GQ L TG  +   ++   TGEL++ L        +D +SS  +            
Sbjct: 405 RFSNDGQFLATGCNKTTRVYKTSTGELIATLL-------VDPQSSNNSNSEQQTNPESSD 457

Query: 80  --VTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSG 137
             +  + +  +   LAAG  D +I+IWD+ +K +++   GH+  +  L +  +G +L+SG
Sbjct: 458 LYIRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSG 517

Query: 138 SRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIKLWDLKTQQCV 195
           S D  + IWDL +      L S +D +T +     +  ++ + + D   ++WD +T   +
Sbjct: 518 SGDKTVRIWDLRTGQCSLTL-SIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLL 576

Query: 196 ETHIAQTG---------ECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIVE 241
           +   +QT             +    G  +V+   D  +K+WNLDT+  N ++  E
Sbjct: 577 KRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNESCE 631

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 117/245 (47%), Gaps = 24/245 (9%)

Query: 455 LVTSTLIESIDV------AHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGT 508
           L    L +S+DV      +H + +  +  + DG+ L TG  +K+ + +  S  + +    
Sbjct: 378 LFNPDLPKSLDVDLHLSLSHPSVVCCVRFSNDGQFLATG-CNKTTRVYKTSTGELIATLL 436

Query: 509 TDKFVPVMKLIHDTTLELNDD-----ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFL 563
            D   P      ++  + N +     I SV  SP+ K+LA    D  ++++ + + +  +
Sbjct: 437 VD---PQSSNNSNSEQQTNPESSDLYIRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVM 493

Query: 564 SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPES 623
            L GH+  + S+D     + +++ S DK ++IW L  G C  +L + +D +  V   P +
Sbjct: 494 ILKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIWDLRTGQCSLTL-SIEDGVTTVSSSPNN 552

Query: 624 HNFFSS-SKDGLVKYWDGDKFECVQKL-------AAHQSEVWALAITSDGSTVVSSSHDH 675
             F ++ S D   + WD +    +++L         H+  +++++ T DG  +VS S D 
Sbjct: 553 GKFIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDR 612

Query: 676 SMRVW 680
           S+++W
Sbjct: 613 SVKLW 617

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 96/211 (45%), Gaps = 24/211 (11%)

Query: 400 KLLASASNGLLKIWNLKTKSCIRTFDC--GYALTCKFLPSGTLCVIGTREGQIQLFDLVT 457
           KL++ + +  ++IW+L+T  C  T     G         +G     G+ +   +++D  T
Sbjct: 513 KLVSGSGDKTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTET 572

Query: 458 STLIESIDV------AHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDK 511
             L++ +D        H  +I+S+  T+DGK+LV+GS D+S+K WN     D     +++
Sbjct: 573 GFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNL----DTTNNNSNE 628

Query: 512 FVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLP 571
              V  + H       D +LSV  S  D+Y+     D  V  +  +S    L L GHK  
Sbjct: 629 SCEVTFIGH------KDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNS 682

Query: 572 VLSIDISFDSKL------IITSSADKNIKIW 596
           V+S+ ++    L        T S D   KIW
Sbjct: 683 VISVAVANGQPLGPEFGVFSTGSGDFTAKIW 713

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 69/145 (47%), Gaps = 13/145 (8%)

Query: 31  SRKSNVGQ-VLTGALE-NINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDE 88
           S   N G+ +  G+L+ +  +WD +TG LL  L         D+++     +  + +  +
Sbjct: 547 SSSPNNGKFIAAGSLDRSARIWDTETGFLLKRLD-----SQTDLQNGHKDSIYSVSFTKD 601

Query: 89  TNLLAAGYADGVIKIWDL------MSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSD 142
              L +G  D  +K+W+L       +++  ++F GHK  V  +        ++SGS+D  
Sbjct: 602 GKKLVSGSLDRSVKLWNLDTTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRG 661

Query: 143 IIIWDLVSEVGVFKLRSHKDAITGI 167
           ++ WD  S   +  L+ HK+++  +
Sbjct: 662 VLFWDTNSGNPLLMLQGHKNSVISV 686

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 91.3 bits (225), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 101/227 (44%), Gaps = 17/227 (7%)

Query: 455 LVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVP 514
           L T     S+ + H+ A++S   + D K L++GS DK+++ W+      LV         
Sbjct: 527 LTTGDETSSLLIGHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLV--------- 577

Query: 515 VMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS 574
                  +    N  +  VK SP   Y A +  D T +++  D +       GH   V +
Sbjct: 578 -------SYKGHNHPVWDVKFSPMGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVET 630

Query: 575 IDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGL 634
           +    +   + T SADK  ++W +  GD  +    H   ++     P+     +  +DG+
Sbjct: 631 VSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGGEDGV 690

Query: 635 VKYWDGDKFECVQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
           +  WD    + ++++  H ++ + + +   +G+ ++S   DHS+RVW
Sbjct: 691 INVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVW 737

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 82/195 (42%), Gaps = 25/195 (12%)

Query: 516 MKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLS----------- 564
           M   H+T    N D+  ++ S + +  A    D+ +K++ LD      +           
Sbjct: 472 MYTFHNT----NKDMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEEIL 527

Query: 565 ---------LYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
                    L GH   V S   S D+K +++ S DK +++W +D      S   H   + 
Sbjct: 528 TTGDETSSLLIGHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVW 587

Query: 616 NVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDH 675
           +V F P  H F ++S D   + W  D    ++  A H ++V  ++   +G  V + S D 
Sbjct: 588 DVKFSPMGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADK 647

Query: 676 SMRVWK-ETDDQVFL 689
           + R+W   T D V L
Sbjct: 648 TCRMWDISTGDSVRL 662

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 65/143 (45%), Gaps = 6/143 (4%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
            A    D   ++W       L  F+GH + V  + F   G  + +GS D    +WD+ + 
Sbjct: 598 FATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTG 657

Query: 152 VGVFKLRSHKDAI--TGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVET---HIAQTGECW 206
             V     H   +  T +  +G  WL +  +DG+I +WD+ T + ++    H       +
Sbjct: 658 DSVRLFLGHTAPVLTTAVTPDGR-WLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSF 716

Query: 207 ALGVHGDLVVTTGTDSQIKIWNL 229
           +    G+++++ G D  +++W+L
Sbjct: 717 SFNKEGNILISGGADHSVRVWDL 739

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 65/155 (41%), Gaps = 7/155 (4%)

Query: 85  YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDII 144
           +  +   L +G  D  +++W + + T L+S+ GH   V  +KF   G    + S D    
Sbjct: 549 FSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHDQTAR 608

Query: 145 IW--DLVSEVGVFKLRSH-KDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQ 201
           +W  D +  + +F    H  D  T  +     ++ + + D   ++WD+ T   V   +  
Sbjct: 609 LWSCDHIYPLRIFA--GHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGH 666

Query: 202 TGECWALGV--HGDLVVTTGTDSQIKIWNLDTSKE 234
           T       V   G  + T G D  I +W++ T K 
Sbjct: 667 TAPVLTTAVTPDGRWLCTGGEDGVINVWDIGTGKR 701

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 66/145 (45%), Gaps = 5/145 (3%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           +V  + +H     +  G AD   ++WD+ +   +  F GH + V        G  L +G 
Sbjct: 627 DVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGG 686

Query: 139 RDSDIIIWDLVSEVGVFKLRSH-KDAITGIWCEGE-DWLVSTAKDGLIKLWDLKTQQCVE 196
            D  I +WD+ +   + ++R H K+AI       E + L+S   D  +++WDLK  +   
Sbjct: 687 EDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDLK--KATP 744

Query: 197 THIAQTGECWALGVHGDLVVTTGTD 221
              A+  + +A G  GD+  +   D
Sbjct: 745 EPSAEPEQPFA-GYVGDVTASVNQD 768

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/176 (18%), Positives = 64/176 (36%), Gaps = 23/176 (13%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLS--------------------FSGH 118
           +++ LE+ D+  L A G+ D  IKIW L   +++ +                      GH
Sbjct: 481 DMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEEILTTGDETSSLLIGH 540

Query: 119 KSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVS 177
              V    F      L+SGS D  + +W + +   +   + H   +  + +     +  +
Sbjct: 541 SGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFAT 600

Query: 178 TAKDGLIKLWDLKTQQCVETHIAQTGECWALGVH--GDLVVTTGTDSQIKIWNLDT 231
            + D   +LW       +        +   +  H  G  V T   D   ++W++ T
Sbjct: 601 ASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDIST 656

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 17/83 (20%)

Query: 47  INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDL 106
           IN+WDI TG+ L  +           +      +    ++ E N+L +G AD  +++WDL
Sbjct: 691 INVWDIGTGKRLKQM-----------RGHGKNAIHSFSFNKEGNILISGGADHSVRVWDL 739

Query: 107 MSKTVLLS------FSGHKSGVT 123
              T   S      F+G+   VT
Sbjct: 740 KKATPEPSAEPEQPFAGYVGDVT 762

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 89.4 bits (220), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 116/262 (44%), Gaps = 29/262 (11%)

Query: 448 GQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPG 507
           G +++    T  +I++ D AH++ I  +D   DG  LVTG+A+  I+ WN + + +   G
Sbjct: 204 GDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGAANGEIRIWNLNNDSESPAG 263

Query: 508 TTD---------KFVPVMKLIHDTTLELN-------------------DDILSVKISPED 539
           T           +F P  K +   + ++                     ++  V    + 
Sbjct: 264 TLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQLQEGHAKEVYCVAFQKDG 323

Query: 540 KYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599
             L  + LD+   V+ L S K  ++L GH  P+  +D S +   I T SAD  I++W + 
Sbjct: 324 SLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVR 383

Query: 600 FGDCHKSLFAHQDSIMNVCF-LPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWA 658
                 +L AH   +  V F     H   SSS D  +  + GD +  +  +  H  ++ +
Sbjct: 384 KVGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIYSGDNWTKLSVIQGHTDKILS 443

Query: 659 LAITSDGSTVVSSSHDHSMRVW 680
           + I++DGS + SS  D S++ W
Sbjct: 444 VDISTDGSHLFSSGWDRSLKQW 465

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 73/170 (42%), Gaps = 7/170 (4%)

Query: 66  PPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTIL 125
           P G++    ++ A V    +H     +A+   D   ++WD+  +  L    GH   V  +
Sbjct: 261 PAGTLTGHENRVARV---RFHPSGKYVASASFDMTWRLWDVEKQIELQLQEGHAKEVYCV 317

Query: 126 KFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLI 184
            F   G+ L S   DS  ++WDL S   +  L  H   I G+ W      + + + DG I
Sbjct: 318 AFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGLDWSPNGYDIATGSADGTI 377

Query: 185 KLWDLKT---QQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDT 231
           +LWD++       +  H +   E      +G  +V++  D  + I++ D 
Sbjct: 378 RLWDVRKVGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIYSGDN 427

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 96/245 (39%), Gaps = 64/245 (26%)

Query: 401 LLASASNGLLKIWNLKTKS----CIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFD-- 454
           L+  A+NG ++IWNL   S       T         +F PSG      + +   +L+D  
Sbjct: 240 LVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVE 299

Query: 455 -------------------------LVTSTLIESIDV--------------AHNAAIWSL 475
                                    L+ ST ++S+ +               H   I+ L
Sbjct: 300 KQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGL 359

Query: 476 DITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILS-VK 534
           D + +G  + TGSAD +I+ W+                 V K+     L  ++ I+S VK
Sbjct: 360 DWSPNGYDIATGSADGTIRLWD-----------------VRKVGILGALPAHNSIVSEVK 402

Query: 535 ISPED-KYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNI 593
               +  YL  S  D T+ ++  D+      + GH   +LS+DIS D   + +S  D+++
Sbjct: 403 FDKANGHYLVSSSYDKTLNIYSGDNWTKLSVIQGHTDKILSVDISTDGSHLFSSGWDRSL 462

Query: 594 KIWGL 598
           K W L
Sbjct: 463 KQWSL 467

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 84/167 (50%), Gaps = 10/167 (5%)

Query: 74  SSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSF-SGHKSGVTILKFDSTGT 132
           SS+P  V+ +    + +++A     G +KI    +  ++ +F + H S +  + ++  GT
Sbjct: 181 SSRP--VSQVAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGT 238

Query: 133 RLMSGSRDSDIIIWDLV--SEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDL 189
            L++G+ + +I IW+L   SE     L  H++ +  + +     ++ S + D   +LWD+
Sbjct: 239 ALVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWDV 298

Query: 190 KTQ---QCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSK 233
           + Q   Q  E H A+   C A    G L+ +TG DS   +W+L + K
Sbjct: 299 EKQIELQLQEGH-AKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGK 344

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 122/284 (42%), Gaps = 48/284 (16%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++DL T  ++ ++   H   I+SLD    G +LV+G
Sbjct: 450 YIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQ-GHEQDIYSLDYFPSGDKLVSG 508

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP D K +A   
Sbjct: 509 SGDRTVRIWDLRAGQCSL-----------------TLSIEDGVTTVAVSPGDGKLIAAGS 551

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD TV+++  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 552 LDRTVRIW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 609

Query: 598 L------------DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           L            +      +   H+D +++V          S SKD  V +WD      
Sbjct: 610 LRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNP 669

Query: 646 VQKLAAHQSEVWALAITSDG------STVVSSSHDHSMRVWKET 683
           +  L  H++ V ++A+ +D           + S D   R+WK T
Sbjct: 670 LLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYT 713

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 110/234 (47%), Gaps = 36/234 (15%)

Query: 32  RKSNVGQVL-TGALENINLWDIKTGELLSVLSD---GLPPG----------------SID 71
           R SN G+ L TG  +   ++ + TGEL++ LS+     P G                ++ 
Sbjct: 383 RFSNDGEYLATGCNKTTQVYKVSTGELVARLSEDAASAPSGNSGDGASGAENAEQTPAVS 442

Query: 72  VKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTG 131
             +S    +  + +  +   LA G  D +I+IWDL ++ ++++  GH+  +  L +  +G
Sbjct: 443 TSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSG 502

Query: 132 TRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCE-GEDWLVSTAK-DGLIKLWDL 189
            +L+SGS D  + IWDL +      L S +D +T +    G+  L++    D  +++WD 
Sbjct: 503 DKLVSGSGDRTVRIWDLRAGQCSLTL-SIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDS 561

Query: 190 KTQQCVETHIAQ----TGE-------CWALGVHGDLVVTTGTDSQIKIWNLDTS 232
           +T   VE   ++    TG         +    HG  VV+   D  +K+WNL ++
Sbjct: 562 ETGFLVERLDSENELGTGHKDSVYSVVFTRDGHG--VVSGSLDRSVKLWNLRSA 613

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 94/212 (44%), Gaps = 18/212 (8%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSG--TLCVIGTREGQIQLFDLV 456
           +KL++ + +  ++IW+L+   C  T      +T   +  G   L   G+ +  ++++D  
Sbjct: 503 DKLVSGSGDRTVRIWDLRAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSE 562

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           T  L+E +D        H  +++S+  T+DG  +V+GS D+S+K WN         G + 
Sbjct: 563 TGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSAN----GGST 618

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
           +          T     D +LSV  +  D+++     D  V  +   S    L L GH+ 
Sbjct: 619 EGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRN 678

Query: 571 PVLSIDISFDSKL------IITSSADKNIKIW 596
            V+S+ ++ D  L        T S D   +IW
Sbjct: 679 SVISVAVANDHPLGPEYGVFATGSGDCKARIW 710

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/142 (19%), Positives = 64/142 (45%), Gaps = 18/142 (12%)

Query: 39  VLTGALEN-INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYA 97
           +  G+L+  + +WD +TG L+  L         ++ +     V  + +  + + + +G  
Sbjct: 547 IAAGSLDRTVRIWDSETGFLVERLDS-----ENELGTGHKDSVYSVVFTRDGHGVVSGSL 601

Query: 98  DGVIKIWDLMSK------------TVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIII 145
           D  +K+W+L S                ++++GHK  V  +        ++SGS+D  ++ 
Sbjct: 602 DRSVKLWNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLF 661

Query: 146 WDLVSEVGVFKLRSHKDAITGI 167
           WD  S   +  L+ H++++  +
Sbjct: 662 WDTPSGNPLLMLQGHRNSVISV 683

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 119/263 (45%), Gaps = 43/263 (16%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+    ++  I   H   I+SLD    G +LV+G
Sbjct: 449 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIV-MILQGHEQDIYSLDYFPSGDKLVSG 507

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP D KY+A   
Sbjct: 508 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 550

Query: 547 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL         S  GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 551 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWN 608

Query: 598 L------------DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           L            + G C  +   H+D +++V          S SKD  V +WD      
Sbjct: 609 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 668

Query: 646 VQKLAAHQSEVWALAITSDGSTV 668
           +  L  H++ V ++A+ ++GS +
Sbjct: 669 LLMLQGHRNSVISVAV-ANGSPL 690

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 83/159 (52%), Gaps = 9/159 (5%)

Query: 530 ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSA 589
           I SV  SP+ K+LA    D  ++++ +++ K  + L GH+  + S+D       +++ S 
Sbjct: 450 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 509

Query: 590 DKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS-SKDGLVKYWDGDKFECVQK 648
           D+ ++IW L  G C  +L + +D +  V   P    + ++ S D  V+ WD +    V++
Sbjct: 510 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVER 568

Query: 649 L-------AAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           L         H+  V+++  T DG +VVS S D S+++W
Sbjct: 569 LDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLW 607

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 94/188 (50%), Gaps = 16/188 (8%)

Query: 74  SSKPAEVTYLE---YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDST 130
           SS P+   Y+    +  +   LA G  D +I+IWD+ ++ +++   GH+  +  L +  +
Sbjct: 441 SSTPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPS 500

Query: 131 GTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIKLWD 188
           G +L+SGS D  + IWDL +      L S +D +T +     D  ++ + + D  +++WD
Sbjct: 501 GDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 559

Query: 189 LKTQQCVETHIA--QTGECWALGVH-------GDLVVTTGTDSQIKIWNL-DTSKENGSK 238
            +T   VE   +  ++G      V+       G+ VV+   D  +K+WNL + + ++ SK
Sbjct: 560 SETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKSDSK 619

Query: 239 IVEKGTYE 246
               GT E
Sbjct: 620 TPNSGTCE 627

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 91/193 (47%), Gaps = 12/193 (6%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSG--TLCVIGTREGQIQLFDLV 456
           +KL++ + +  ++IW+L+T  C  T      +T   +  G       G+ +  ++++D  
Sbjct: 502 DKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSE 561

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           T  L+E +D        H  +++S+  T+DG+ +V+GS D+S+K WN     +     +D
Sbjct: 562 TGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANN----KSD 617

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
              P       T +   D +LSV  +  D+Y+     D  V  +   S    L L GH+ 
Sbjct: 618 SKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRN 677

Query: 571 PVLSIDISFDSKL 583
            V+S+ ++  S L
Sbjct: 678 SVISVAVANGSPL 690

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 48/111 (43%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS 629
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 448 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 507

Query: 630 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           S D  V+ WD    +C   L+             DG  + + S D ++RVW
Sbjct: 508 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 558

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 82/191 (42%), Gaps = 46/191 (24%)

Query: 25  WLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSVLS--DGLPPGSIDVKSSKPAEVTY 82
           + PS D   S  G         + +WD++TG+    LS  DG+   ++      P +  Y
Sbjct: 497 YFPSGDKLVSGSGD------RTVRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKY 545

Query: 83  LEYHDETNLLAAGYADGVIKIWDLMSKTVLL---------SFSGHKSGVTILKFDSTGTR 133
                    +AAG  D  +++WD  S+T  L         S +GHK  V  + F   G  
Sbjct: 546 ---------IAAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGES 594

Query: 134 LMSGSRDSDIIIWDL----------VSEVGVFKLR--SHKDAITGIW-CEGEDWLVSTAK 180
           ++SGS D  + +W+L              G  ++    HKD +  +   + +++++S +K
Sbjct: 595 VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSK 654

Query: 181 DGLIKLWDLKT 191
           D  +  WD K+
Sbjct: 655 DRGVLFWDKKS 665

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 63/142 (44%), Gaps = 18/142 (12%)

Query: 39  VLTGALEN-INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYA 97
           +  G+L+  + +WD +TG L+  L      G+    S     V  + +  +   + +G  
Sbjct: 546 IAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDS-----VYSVVFTRDGESVVSGSL 600

Query: 98  DGVIKIWDLM------------SKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIII 145
           D  +K+W+L             S T  +++ GHK  V  +        ++SGS+D  ++ 
Sbjct: 601 DRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 660

Query: 146 WDLVSEVGVFKLRSHKDAITGI 167
           WD  S   +  L+ H++++  +
Sbjct: 661 WDKKSGNPLLMLQGHRNSVISV 682

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 102/217 (47%), Gaps = 19/217 (8%)

Query: 466 VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLE 525
           V H+ AI+S   + D K LV+ S DK+I+ W+      LV                T   
Sbjct: 550 VGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLV----------------TYKG 593

Query: 526 LNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLY-GHKLPVLSIDISFDSKLI 584
            N  +  V+ SP   Y A +  D T +++  D + F L ++ GH   V  +    +   I
Sbjct: 594 HNHPVWDVQFSPVGHYFATASHDQTARLWSCDHI-FPLRIFSGHISDVDCVTFHPNGCYI 652

Query: 585 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFE 644
            T S+DK  ++W +  G+  +    H   I++V   P+     + S+DG++  WD    +
Sbjct: 653 FTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGK 712

Query: 645 CVQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
            ++KL  H +S V +L+   + + +VS   D+S+R+W
Sbjct: 713 SLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIW 749

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 89/215 (41%), Gaps = 28/215 (13%)

Query: 469 NAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELND 528
           N  + SL  + D +    G  D  IK W+                     +  TTLE   
Sbjct: 475 NNEMLSLSYSNDCRLAAAGFKDSYIKVWS---------------------LDGTTLESK- 512

Query: 529 DILSVKISPEDKYLAVSL-LDNTV--KVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLII 585
              + KI P     A+   LDN +  K    ++    + L GH   + S   S D+KL++
Sbjct: 513 ---ATKIQPSKSQAALRAGLDNKINEKTRSQETPITTVKLVGHSGAIYSTSFSPDNKLLV 569

Query: 586 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           ++S DK I++W +D      +   H   + +V F P  H F ++S D   + W  D    
Sbjct: 570 SASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWSCDHIFP 629

Query: 646 VQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           ++  + H S+V  +    +G  + + S D + R+W
Sbjct: 630 LRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMW 664

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 79/177 (44%), Gaps = 15/177 (8%)

Query: 85  YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDII 144
           +  +  LL +   D  I++W + ++T L+++ GH   V  ++F   G    + S D    
Sbjct: 561 FSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTAR 620

Query: 145 IWDLVSEVGVFKLRSHKDAITGIWC----EGEDWLVSTAKDGLIKLWDLKTQQCVETHIA 200
           +W   S   +F LR     I+ + C        ++ + + D   ++WD+ T + V   I 
Sbjct: 621 LW---SCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIG 677

Query: 201 QTGECWALGVHGD-LVVTTGT-DSQIKIWNLDTSKE------NGSKIVEKGTYEKQS 249
            T    ++ V  D L + TG+ D  I IW++ T K       +G   V   +Y K+S
Sbjct: 678 HTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLSYNKES 734

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 64/142 (45%), Gaps = 4/142 (2%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
            A    D   ++W       L  FSGH S V  + F   G  + +GS D    +WD+ + 
Sbjct: 610 FATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTG 669

Query: 152 VGVFKLRSHKDAITGIWCEGEDWLVST-AKDGLIKLWDLKTQQCVET---HIAQTGECWA 207
             V     H   I  +    +   ++T ++DG+I +WD+ T + ++    H        +
Sbjct: 670 ESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLS 729

Query: 208 LGVHGDLVVTTGTDSQIKIWNL 229
                +++V+ G+D+ ++IW+L
Sbjct: 730 YNKESNILVSGGSDNSVRIWDL 751

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 78  AEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSG 137
           ++V  + +H     +  G +D   ++WD+ +   +  F GH + +  +     G RL +G
Sbjct: 638 SDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATG 697

Query: 138 SRDSDIIIWDLVSEVGVFKLRSH-KDAITGI-WCEGEDWLVSTAKDGLIKLWDL 189
           S D  I IWD+ +   + KL  H K A+  + + +  + LVS   D  +++WDL
Sbjct: 698 SEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 51/102 (50%), Gaps = 2/102 (1%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTFDCGYA--LTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +   +S+   ++W++ T   +R F    A  L+    P G     G+ +G I ++D+ T 
Sbjct: 652 IFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTG 711

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSI 500
             ++ +     +A+ SL   ++   LV+G +D S++ W+ ++
Sbjct: 712 KSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLTV 753

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 65/157 (41%), Gaps = 13/157 (8%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           E+  L Y ++  L AAG+ D  IK+W L   T+       +S  T ++   +   L +G 
Sbjct: 477 EMLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTL-------ESKATKIQPSKSQAALRAG- 528

Query: 139 RDSDIIIWDLVSEVGV--FKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCV 195
            D+ I       E  +   KL  H  AI    +      LVS ++D  I+LW + T+  +
Sbjct: 529 LDNKINEKTRSQETPITTVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTL 588

Query: 196 ETHIAQTGECWALGVH--GDLVVTTGTDSQIKIWNLD 230
            T+       W +     G    T   D   ++W+ D
Sbjct: 589 VTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWSCD 625

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 120/284 (42%), Gaps = 48/284 (16%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+    ++  +   H   I+SLD    G +LV+G
Sbjct: 377 YIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 435

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP D K++A   
Sbjct: 436 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 478

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 479 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWN 536

Query: 598 LDF------------GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           L              G C  +   H+D +++V          S SKD  V +WD      
Sbjct: 537 LRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNP 596

Query: 646 VQKLAAHQSEVWALAITS------DGSTVVSSSHDHSMRVWKET 683
           +  L  H++ V ++A+ +            + S D   R+WK T
Sbjct: 597 LLMLQGHRNSVISVAVANGFPLGPQYGVFATGSGDCKARIWKYT 640

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 83/165 (50%), Gaps = 9/165 (5%)

Query: 530 ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSA 589
           I SV  SP+ K+LA    D  ++++ +   +  + L GH+  + S+D       +++ S 
Sbjct: 378 IRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 437

Query: 590 DKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS-SKDGLVKYWDGDKFECVQK 648
           D+ ++IW L  G C  +L + +D +  V   P    F ++ S D  V+ WD +    V++
Sbjct: 438 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVER 496

Query: 649 L-------AAHQSEVWALAITSDGSTVVSSSHDHSMRVWKETDDQ 686
           L         H+  V+++  T DG+ VVS S D S+++W    D+
Sbjct: 497 LDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDK 541

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 109/239 (45%), Gaps = 34/239 (14%)

Query: 32  RKSNVGQVL-TGALENINLWDIKTGELLSVLSD------GLPPGSI--------DVKS-- 74
           R SN G+ L TG  +   ++ +  G L++ LSD        P GS         DV S  
Sbjct: 308 RFSNDGEYLATGCNKTTQVFRVSDGALIARLSDDAASQVAAPAGSPANADEPNNDVNSFV 367

Query: 75  -SKPAE----VTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDS 129
            +K A     +  + +  +   LA G  D +I+IWD+  K +++   GH+  +  L +  
Sbjct: 368 TAKSASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFP 427

Query: 130 TGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIKLW 187
           +G +L+SGS D  + IWDL +      L S +D +T +     D  ++ + + D  +++W
Sbjct: 428 SGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW 486

Query: 188 DLKTQQCVETHIAQ----TGE-----CWALGVHGDLVVTTGTDSQIKIWNLDTSKENGS 237
           D +T   VE   ++    TG             G+ VV+   D  +K+WNL   K N S
Sbjct: 487 DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSS 545

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 99/224 (44%), Gaps = 25/224 (11%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSG--TLCVIGTREGQIQLFDLV 456
           +KL++ + +  ++IW+L+T  C  T      +T   +  G       G+ +  ++++D  
Sbjct: 430 DKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSE 489

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           T  L+E +D        H  +++S+  T+DG  +V+GS D+S+K WN   +++     + 
Sbjct: 490 TGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKN----NSS 545

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
              P       T     D +LSV  +  D+Y+     D  V  +   S    L L GH+ 
Sbjct: 546 SGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLLMLQGHRN 605

Query: 571 PVLSIDISFDSKL------IITSSADKNIKIW-------GLDFG 601
            V+S+ ++    L        T S D   +IW       G+D G
Sbjct: 606 SVISVAVANGFPLGPQYGVFATGSGDCKARIWKYTKTDAGIDSG 649

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 85/223 (38%), Gaps = 32/223 (14%)

Query: 460 LIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLI 519
           L +S+D  H + +  +  + DG+ L TG  +K+ + +  S                    
Sbjct: 294 LHKSLD--HTSVVCCVRFSNDGEYLATG-CNKTTQVFRVS-------------------- 330

Query: 520 HDTTL--ELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDI 577
            D  L   L+DD  S   +P          +N V  F + +      LY     + S+  
Sbjct: 331 -DGALIARLSDDAASQVAAPAGSPANADEPNNDVNSF-VTAKSASSDLY-----IRSVCF 383

Query: 578 SFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKY 637
           S D K + T + D+ I+IW +        L  H+  I ++ + P      S S D  V+ 
Sbjct: 384 SPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRI 443

Query: 638 WDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           WD    +C   L+             DG  + + S D ++RVW
Sbjct: 444 WDLRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW 486

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 64/142 (45%), Gaps = 18/142 (12%)

Query: 39  VLTGALEN-INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYA 97
           +  G+L+  + +WD +TG L+  L         ++ +     V  + +  + N + +G  
Sbjct: 474 IAAGSLDRAVRVWDSETGFLVERLDS-----ENELGTGHKDSVYSVVFTRDGNGVVSGSL 528

Query: 98  DGVIKIWDL------------MSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIII 145
           D  +K+W+L               T  ++++GHK  V  +        ++SGS+D  ++ 
Sbjct: 529 DRSVKLWNLRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLF 588

Query: 146 WDLVSEVGVFKLRSHKDAITGI 167
           WD  S   +  L+ H++++  +
Sbjct: 589 WDTQSGNPLLMLQGHRNSVISV 610

 Score = 35.4 bits (80), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 174 WLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIWNLDT 231
           +L + A+D LI++WD+  +Q V        + ++L     GD +V+   D  ++IW+L T
Sbjct: 389 FLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRT 448

Query: 232 SKENGSKIVEKG 243
            + + +  +E G
Sbjct: 449 GQCSLTLSIEDG 460

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 100/216 (46%), Gaps = 17/216 (7%)

Query: 466 VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLE 525
           V H+  ++S   + D K L++GS DK+++ W+      LV                +   
Sbjct: 524 VGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKG 567

Query: 526 LNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLII 585
            N  +  V  SP   Y A +  D T +++  D +       GH   V  +    +   + 
Sbjct: 568 HNHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLF 627

Query: 586 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           T S+DK  ++W +  GD  +    H   ++++   P+     + S+DG++  WD    + 
Sbjct: 628 TGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKR 687

Query: 646 VQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
           ++++  H ++ +++L+ + +G+ ++S   DHS+RVW
Sbjct: 688 LKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVW 723

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 78/179 (43%), Gaps = 11/179 (6%)

Query: 522 TTLELNDDILSVKISPEDKYLAVSLLDNTV----------KVFFLDSMKFFLSLYGHKLP 571
           + L+ +DD        +D Y+ +  LD +           +  + D      +L GH   
Sbjct: 470 SCLDFSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETNYKDDDPTCKTLVGHSGT 529

Query: 572 VLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSK 631
           V S   S D+K +++ S DK +++W +D      S   H   + +V F P  H F ++S 
Sbjct: 530 VYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASH 589

Query: 632 DGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWK-ETDDQVFL 689
           D   + W  D    ++  A H ++V  ++   +G  + + S D + R+W   T D V L
Sbjct: 590 DQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRL 648

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 63/142 (44%), Gaps = 4/142 (2%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
            A    D   ++W       L  F+GH + V  + F   G  L +GS D    +W++ + 
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTG 643

Query: 152 VGVFKLRSHKDAITGIWCEGED-WLVSTAKDGLIKLWDLKTQQCVET---HIAQTGECWA 207
             V     H   +  I    +  WL + ++DG+I +WD+ T + ++    H        +
Sbjct: 644 DSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLS 703

Query: 208 LGVHGDLVVTTGTDSQIKIWNL 229
               G+++++ G D  +++W+L
Sbjct: 704 YSKEGNVLISGGADHSVRVWDL 725

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 70/145 (48%), Gaps = 5/145 (3%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           +V  + +H     L  G +D   ++W++ +   +  F GH + V  +     G  L +GS
Sbjct: 613 DVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGS 672

Query: 139 RDSDIIIWDLVSEVGVFKLRSH-KDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVE 196
            D  I +WD+ +   + ++R H K+AI  + + +  + L+S   D  +++WDLK  +   
Sbjct: 673 EDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK--KATT 730

Query: 197 THIAQTGECWALGVHGDLVVTTGTD 221
              A+  E + +G  GD+  +   D
Sbjct: 731 EPSAEPDEPF-IGYLGDVTASINQD 754

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 64/155 (41%), Gaps = 9/155 (5%)

Query: 85  YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDII 144
           +  +   L +G  D  +++W + + T L+S+ GH   V  + F   G    + S D    
Sbjct: 535 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 594

Query: 145 IWDLVSEVGVFKLRSHKDAITGIWC----EGEDWLVSTAKDGLIKLWDLKTQQCVETHIA 200
           +W   S   ++ LR     +  + C        +L + + D   ++W++ T   V   + 
Sbjct: 595 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLG 651

Query: 201 QTGECWALGVH--GDLVVTTGTDSQIKIWNLDTSK 233
            T    ++ V   G  + T   D  I +W++ T K
Sbjct: 652 HTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGK 686

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/176 (19%), Positives = 71/176 (40%), Gaps = 24/176 (13%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIW-----DLMSKTVLL--------------SFSGHK 119
           +++ L++ D+  + AAG+ D  IKIW      L +  ++L              +  GH 
Sbjct: 468 DMSCLDFSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETNYKDDDPTCKTLVGHS 527

Query: 120 SGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVST 178
             V    F      L+SGS D  + +W + +   +   + H   +  + +     +  + 
Sbjct: 528 GTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATA 587

Query: 179 AKDGLIKLWD---LKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDT 231
           + D   +LW    +   +    H+    +C +   +G  + T  +D   ++WN+ T
Sbjct: 588 SHDQTARLWSCDHIYPLRIFAGHLNDV-DCVSFHPNGCYLFTGSSDKTCRMWNVST 642

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 11/65 (16%)

Query: 47  INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDL 106
           IN+WDI TG+ L  +           +      +  L Y  E N+L +G AD  +++WDL
Sbjct: 677 INVWDIGTGKRLKQM-----------RGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

Query: 107 MSKTV 111
              T 
Sbjct: 726 KKATT 730

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
           YCR084C
          Length = 655

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 124/286 (43%), Gaps = 52/286 (18%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++DL    ++  +   H+  ++SLD    G +LV+G
Sbjct: 375 YIRSVCFSPDGKFLATGAEDRLIRIWDLAQQKIVMVLQ-GHDQDVYSLDYFPSGDKLVSG 433

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP D KY+A   
Sbjct: 434 SGDRTVRIWDLKTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 476

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GH+  V S+  + D   +++SS D+++K+W 
Sbjct: 477 LDRAVRVW--DSETGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWN 534

Query: 598 L-------DFGD---------CHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGD 641
           L       +  D         C  +   H+D +++V          S SKD  V +WD +
Sbjct: 535 LRGYNEKENAADNNKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTN 594

Query: 642 KFECVQKLAAHQSEVWALAITS------DGSTVVSSSHDHSMRVWK 681
               +  L  H++ V ++A+ +      +     + S D   R+WK
Sbjct: 595 TGNPLLMLQGHRNSVISVAVANGHPLGPEYQVFATGSGDCRARIWK 640

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 105/223 (47%), Gaps = 20/223 (8%)

Query: 34  SNVGQVL-TGALENINLWDIKTGELLSVLSDGLPP-----GSIDVKSSKPAEVTYLEYHD 87
           SN GQ L TG  +   ++ +  GEL++ LSD   P     G+     S    +  + +  
Sbjct: 324 SNDGQYLATGCNKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLYIRSVCFSP 383

Query: 88  ETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWD 147
           +   LA G  D +I+IWDL  + +++   GH   V  L +  +G +L+SGS D  + IWD
Sbjct: 384 DGKFLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWD 443

Query: 148 LVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIKLWDLKTQQCVETHIAQ---- 201
           L +      L S +D +T +     D  ++ + + D  +++WD +T   VE   ++    
Sbjct: 444 LKTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELG 502

Query: 202 TGE-----CWALGVHGDLVVTTGTDSQIKIWNLD--TSKENGS 237
           TG             G+ VV++  D  +K+WNL     KEN +
Sbjct: 503 TGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENAA 545

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 57/265 (21%), Positives = 111/265 (41%), Gaps = 56/265 (21%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSG--TLCVIGTREGQIQLFDLV 456
           +KL++ + +  ++IW+LKT  C  T      +T   +  G       G+ +  ++++D  
Sbjct: 428 DKLVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSE 487

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           T  L+E +D        H  +++S+  T+DG ++V+ S D+S+K WN         G  +
Sbjct: 488 TGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLR-------GYNE 540

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
           K         +   + N    SV                  +V ++          GHK 
Sbjct: 541 K---------ENAADNNKSQSSV----------------VCEVTYI----------GHKD 565

Query: 571 PVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFL------PESH 624
            VLS+  + + + +++ S D+ +  W  + G+    L  H++S+++V         PE  
Sbjct: 566 FVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQGHRNSVISVAVANGHPLGPEYQ 625

Query: 625 NFFSSSKDGLVKYWDGDKFECVQKL 649
            F + S D   + W   K +   K+
Sbjct: 626 VFATGSGDCRARIWKFSKLDSASKV 650

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 66/175 (37%), Gaps = 18/175 (10%)

Query: 523 TLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLP----------- 571
           +LE    +  VK S + +YLA    + T +VF +   +    L     P           
Sbjct: 311 SLEHTSVVCCVKFSNDGQYLATGC-NKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDS 369

Query: 572 ------VLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN 625
                 + S+  S D K + T + D+ I+IW L        L  H   + ++ + P    
Sbjct: 370 GSTDLYIRSVCFSPDGKFLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDK 429

Query: 626 FFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
             S S D  V+ WD    +C   L+             DG  + + S D ++RVW
Sbjct: 430 LVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW 484

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 174 WLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIWNLDT 231
           +L + A+D LI++WDL  Q+ V        + ++L     GD +V+   D  ++IW+L T
Sbjct: 387 FLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKT 446

Query: 232 SKENGSKIVEKG 243
            + + +  +E G
Sbjct: 447 GQCSLTLSIEDG 458

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 40/196 (20%), Positives = 72/196 (36%), Gaps = 59/196 (30%)

Query: 25  WLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSVLS--DGLPPGSIDVKSSK------ 76
           + PS D   S  G         + +WD+KTG+    LS  DG+   ++     K      
Sbjct: 423 YFPSGDKLVSGSGD------RTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGS 476

Query: 77  --------PAEVTYL-EYHDETNLLAAGYADGV--------------------IKIWDLM 107
                    +E  +L E  D  N L  G+ D V                    +K+W+L 
Sbjct: 477 LDRAVRVWDSETGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLR 536

Query: 108 ----------------SKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
                           S    +++ GHK  V  +   +    ++SGS+D  ++ WD  + 
Sbjct: 537 GYNEKENAADNNKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTG 596

Query: 152 VGVFKLRSHKDAITGI 167
             +  L+ H++++  +
Sbjct: 597 NPLLMLQGHRNSVISV 612

>KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 471

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 108/245 (44%), Gaps = 16/245 (6%)

Query: 436 PSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKF 495
           P+      G+  G +++ D  T  ++ S D  H+  I  LD + D   LVTG AD+ +K 
Sbjct: 192 PNQKSVACGSWHGDVKIIDSETLEILASFDAIHDDKIGGLDWSSDSTLLVTGGADRIVKV 251

Query: 496 WNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFF 555
           W         P + +    V+K  H+        ++ VK  P D+Y+A +  D T +++ 
Sbjct: 252 WK--------PSSPNDSTAVLKG-HEGR------VVKVKFHPSDRYVASASFDMTWRLWD 296

Query: 556 LDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
           ++         GH   V  +D   D  L+ ++  D   +IW +  G     L  H   I 
Sbjct: 297 VERQVELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIY 356

Query: 616 NVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITS-DGSTVVSSSHD 674
            V + P  H+  + S DG VK WD  K      + AH + V  +      G T+VSSS+D
Sbjct: 357 GVSWSPNGHHVATGSADGTVKVWDIRKVGNPFSILAHNNIVSDVKFDKVSGRTLVSSSYD 416

Query: 675 HSMRV 679
            ++ V
Sbjct: 417 KTVSV 421

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 106/243 (43%), Gaps = 44/243 (18%)

Query: 370 PKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLL-KIWNLKTK---------- 418
           P +P+ S   T   KGH            ++ +ASAS  +  ++W+++ +          
Sbjct: 254 PSSPNDS---TAVLKGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVERQVELQLQEGHA 310

Query: 419 ---SCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSL 475
               C+  F C  +L C    S  L  IG      +++D+ +   +  ++  H   I+ +
Sbjct: 311 KEVYCL-DFQCDGSLLC----SAGLDSIG------RIWDMRSGQSLMILE-GHAKPIYGV 358

Query: 476 DITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKI 535
             + +G  + TGSAD ++K W+     +          P   L H+  +    D+   K+
Sbjct: 359 SWSPNGHHVATGSADGTVKVWDIRKVGN----------PFSILAHNNIVS---DVKFDKV 405

Query: 536 SPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKI 595
           S   + L  S  D TV VF  DS     SL GH   V+SIDIS D   + +S  D+++K+
Sbjct: 406 S--GRTLVSSSYDKTVSVFASDSWLRLASLKGHTDKVMSIDISHDFSHLYSSGWDRSVKL 463

Query: 596 WGL 598
           W L
Sbjct: 464 WKL 466

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 54/126 (42%), Gaps = 1/126 (0%)

Query: 66  PPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTIL 125
           P  S  V       V  +++H     +A+   D   ++WD+  +  L    GH   V  L
Sbjct: 257 PNDSTAVLKGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVERQVELQLQEGHAKEVYCL 316

Query: 126 KFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLI 184
            F   G+ L S   DS   IWD+ S   +  L  H   I G+ W      + + + DG +
Sbjct: 317 DFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIYGVSWSPNGHHVATGSADGTV 376

Query: 185 KLWDLK 190
           K+WD++
Sbjct: 377 KVWDIR 382

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 99/245 (40%), Gaps = 27/245 (11%)

Query: 401 LLASASNGLLKIWNLKT---KSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVT 457
           L+   ++ ++K+W   +    + +     G  +  KF PS       + +   +L+D+  
Sbjct: 240 LVTGGADRIVKVWKPSSPNDSTAVLKGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVER 299

Query: 458 STLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMK 517
              ++ +   H   ++ LD   DG  L +   D   + W+    Q L+            
Sbjct: 300 QVELQ-LQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLM------------ 346

Query: 518 LIHDTTLELN-DDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 576
                 LE +   I  V  SP   ++A    D TVKV+ +  +    S+  H   V   D
Sbjct: 347 -----ILEGHAKPIYGVSWSPNGHHVATGSADGTVKVWDIRKVGNPFSILAHNNIV--SD 399

Query: 577 ISFD---SKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDG 633
           + FD    + +++SS DK + ++  D      SL  H D +M++    +  + +SS  D 
Sbjct: 400 VKFDKVSGRTLVSSSYDKTVSVFASDSWLRLASLKGHTDKVMSIDISHDFSHLYSSGWDR 459

Query: 634 LVKYW 638
            VK W
Sbjct: 460 SVKLW 464

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 73/156 (46%), Gaps = 14/156 (8%)

Query: 83  LEYHDETNLLAAGYADGVIKIWDLMS---KTVLLSFSGHKSGVTILKFDSTGTRLMSGSR 139
           L++  ++ LL  G AD ++K+W   S    T +L   GH+  V  +KF  +   + S S 
Sbjct: 231 LDWSSDSTLLVTGGADRIVKVWKPSSPNDSTAVL--KGHEGRVVKVKFHPSDRYVASASF 288

Query: 140 DSDIIIWDLVSEVGVFKLRSHKDAITGI--WCEGEDWLVSTAKDGLIKLWDLKTQQC--- 194
           D    +WD+  +V +     H   +  +   C+G   L S   D + ++WD+++ Q    
Sbjct: 289 DMTWRLWDVERQVELQLQEGHAKEVYCLDFQCDGS-LLCSAGLDSIGRIWDMRSGQSLMI 347

Query: 195 VETHIAQT-GECWALGVHGDLVVTTGTDSQIKIWNL 229
           +E H     G  W+   +G  V T   D  +K+W++
Sbjct: 348 LEGHAKPIYGVSWS--PNGHHVATGSADGTVKVWDI 381

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 73/155 (47%), Gaps = 4/155 (2%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           EV  L++  + +LL +   D + +IWD+ S   L+   GH   +  + +   G  + +GS
Sbjct: 312 EVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIYGVSWSPNGHHVATGS 371

Query: 139 RDSDIIIWDLVSEVGVFKLRSHKDAITGIWCE--GEDWLVSTAKDGLIKLWDLKTQQCVE 196
            D  + +WD+      F + +H + ++ +  +      LVS++ D  + ++   +   + 
Sbjct: 372 ADGTVKVWDIRKVGNPFSILAHNNIVSDVKFDKVSGRTLVSSSYDKTVSVFASDSWLRLA 431

Query: 197 THIAQTGECWALGVHGDL--VVTTGTDSQIKIWNL 229
           +    T +  ++ +  D   + ++G D  +K+W L
Sbjct: 432 SLKGHTDKVMSIDISHDFSHLYSSGWDRSVKLWKL 466

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 100/216 (46%), Gaps = 17/216 (7%)

Query: 466 VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLE 525
           V H+  ++S   + D K L++GS DK+++ W+      LV                +   
Sbjct: 522 VGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKG 565

Query: 526 LNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLII 585
            N  +  V  SP   Y A +  D T +++  D +       GH   V  +    +   + 
Sbjct: 566 HNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVF 625

Query: 586 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           T S+DK  ++W +  GD  +    H   ++++   P+     + S+DG++  WD    + 
Sbjct: 626 TGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKR 685

Query: 646 VQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
           ++++  H ++ +++L+ + +G+ ++S   DH++RVW
Sbjct: 686 LKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVW 721

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 77/181 (42%), Gaps = 18/181 (9%)

Query: 527 NDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFL-----------------SLYGHK 569
           N D+  +  S + +  A    D+ +K++ LD                       +L GH 
Sbjct: 466 NKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHS 525

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS 629
             V S   S D+K +++ S DK +++W +D      S   H   + +V F P  H F ++
Sbjct: 526 GTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATA 585

Query: 630 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWK-ETDDQVF 688
           S D   + W  D    ++  A H ++V  ++   +G  V + S D + R+W   T D V 
Sbjct: 586 SHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVR 645

Query: 689 L 689
           L
Sbjct: 646 L 646

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/191 (18%), Positives = 73/191 (38%), Gaps = 46/191 (24%)

Query: 85  YHDETNLLAAGYADGVIKIWDLMSKTVLLS------------------------------ 114
           +  +   L +G  D  +++W + + T L+S                              
Sbjct: 533 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTAR 592

Query: 115 ------------FSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKD 162
                       F+GH + V  + F   G  + +GS D    +WD+ +   V     H  
Sbjct: 593 LWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTA 652

Query: 163 AITGIW-CEGEDWLVSTAKDGLIKLWDLKTQQCVET---HIAQTGECWALGVHGDLVVTT 218
            +  I  C    WL + ++DG+I +WD+ T + ++    H        +    G+++++ 
Sbjct: 653 PVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISG 712

Query: 219 GTDSQIKIWNL 229
           G D  +++W+L
Sbjct: 713 GADHTVRVWDL 723

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 70/145 (48%), Gaps = 5/145 (3%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           +V  + +H     +  G +D   ++WD+ +   +  F GH + V  +     G  L +GS
Sbjct: 611 DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGS 670

Query: 139 RDSDIIIWDLVSEVGVFKLRSH-KDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVE 196
            D  I +WD+ +   + ++R H K+AI  + + +  + L+S   D  +++WDLK  +   
Sbjct: 671 EDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK--KATT 728

Query: 197 THIAQTGECWALGVHGDLVVTTGTD 221
              A+  E + +G  GD+  +   D
Sbjct: 729 EPSAEPDEPF-IGYLGDVTASINQD 752

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/174 (18%), Positives = 69/174 (39%), Gaps = 22/174 (12%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLL-----------------SFSGHKSG 121
           +++ L++ D+  + AAG+ D  IKIW L   ++                   +  GH   
Sbjct: 468 DMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGT 527

Query: 122 VTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAK 180
           V    F      L+SGS D  + +W + +   +   + H   +  + +     +  + + 
Sbjct: 528 VYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASH 587

Query: 181 DGLIKLWD---LKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDT 231
           D   +LW    +   +    H+    +C +   +G  V T  +D   ++W++ T
Sbjct: 588 DQTARLWSCDHIYPLRIFAGHLNDV-DCVSFHPNGCYVFTGSSDKTCRMWDVST 640

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 11/65 (16%)

Query: 47  INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDL 106
           IN+WDI TG+ L  +           +      +  L Y  E N+L +G AD  +++WDL
Sbjct: 675 INVWDIGTGKRLKQM-----------RGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDL 723

Query: 107 MSKTV 111
              T 
Sbjct: 724 KKATT 728

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/282 (24%), Positives = 121/282 (42%), Gaps = 48/282 (17%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++DL T  ++ ++   H   I+SLD    G +LV+G
Sbjct: 472 YIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQ-GHEQDIYSLDYFPSGDKLVSG 530

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP D K +A   
Sbjct: 531 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKLIAAGS 573

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD TV+++  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 574 LDRTVRIW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 631

Query: 598 L------------DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           L            +      +   H+D +++V          S SKD  V +WD      
Sbjct: 632 LRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNP 691

Query: 646 VQKLAAHQSEVWALAITSDG------STVVSSSHDHSMRVWK 681
           +  L  H++ V ++A+ +D           + S D   R+WK
Sbjct: 692 LLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWK 733

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 122/258 (47%), Gaps = 42/258 (16%)

Query: 32  RKSNVGQVL-TGALENINLWDIKTGELLSVLSD---GLPPGSIDVKSSK-----PAEVT- 81
           R S+ G+ L TG  +   ++ + TGEL++ LS+     P G+    +S+     PA  T 
Sbjct: 407 RFSHDGEFLATGCNKTTQVYKVSTGELIARLSEDASSAPSGADASATSENAKASPAVATS 466

Query: 82  -----YLE---YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTR 133
                Y+    +  +   LA G  D +I+IWDL ++ ++++  GH+  +  L +  +G +
Sbjct: 467 ASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDK 526

Query: 134 LMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWC-EGEDWLVSTAK-DGLIKLWDLKT 191
           L+SGS D  + IWDL +      L S +D +T +    G+  L++    D  +++WD +T
Sbjct: 527 LVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSET 585

Query: 192 QQCVETHIAQ----TGE-------CWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240
              VE   ++    TG         +    HG  VV+   D  +K+WNL ++  NG    
Sbjct: 586 GFLVERLDSENELGTGHKDSVYSVVFTRDGHG--VVSGSLDRSVKLWNLRSA--NG---- 637

Query: 241 EKGTYEKQSKQRGLSVNF 258
             GT E ++      V +
Sbjct: 638 --GTAEGKANTAASEVTY 653

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 95/212 (44%), Gaps = 18/212 (8%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSG--TLCVIGTREGQIQLFDLV 456
           +KL++ + +  ++IW+L+T  C  T      +T   +  G   L   G+ +  ++++D  
Sbjct: 525 DKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSE 584

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           T  L+E +D        H  +++S+  T+DG  +V+GS D+S+K WN         G T 
Sbjct: 585 TGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSAN----GGTA 640

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
           +          T     D +LSV  +  D+++     D  V  +   S    L L GH+ 
Sbjct: 641 EGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRN 700

Query: 571 PVLSIDISFDSKL------IITSSADKNIKIW 596
            V+S+ ++ D  L        T S D   +IW
Sbjct: 701 SVISVAVANDHPLGPEYGVFATGSGDCKARIW 732

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 28/142 (19%), Positives = 64/142 (45%), Gaps = 18/142 (12%)

Query: 39  VLTGALEN-INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYA 97
           +  G+L+  + +WD +TG L+  L         ++ +     V  + +  + + + +G  
Sbjct: 569 IAAGSLDRTVRIWDSETGFLVERLDS-----ENELGTGHKDSVYSVVFTRDGHGVVSGSL 623

Query: 98  DGVIKIWDLMSK------------TVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIII 145
           D  +K+W+L S                ++++GHK  V  +        ++SGS+D  ++ 
Sbjct: 624 DRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLF 683

Query: 146 WDLVSEVGVFKLRSHKDAITGI 167
           WD  S   +  L+ H++++  +
Sbjct: 684 WDTPSGNPLLMLQGHRNSVISV 705

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 113/269 (42%), Gaps = 26/269 (9%)

Query: 438 GTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWN 497
           G     G   G I++    T  + +SID AH   I  LD   DG  L++G  D  +K W+
Sbjct: 184 GQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWD 243

Query: 498 FSIEQ-DLVPGTTD-----KFVPVMKLIHDTTLEL-------------------NDDILS 532
            +    + + G        K  P  +L    + +L                   +  + +
Sbjct: 244 MTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYT 303

Query: 533 VKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKN 592
           +    +   LA + LD    ++ L S +  + L GH   +  +D S +   + T+ AD  
Sbjct: 304 IAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGT 363

Query: 593 IKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFF-SSSKDGLVKYWDGDKFECVQKLAA 651
           +++W +       +L AHQ + ++V F   +  F  S   D LV  ++ D ++ +  L  
Sbjct: 364 VRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEG 423

Query: 652 HQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           H   V+ + IT DGST+ S   D S++ W
Sbjct: 424 HTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 84/201 (41%), Gaps = 22/201 (10%)

Query: 38  QVLTGALEN-INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGY 96
            +L+G  +N + LWD+ +              S +        V+ ++ H    L A+  
Sbjct: 229 HLLSGGGDNLVKLWDMTSN-------------SFEELRGHAGRVSRVKVHPSGRLAASAS 275

Query: 97  ADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFK 156
            D    +WDL  K  L    GH   V  + F S G  L S   D+   IWDL S   + K
Sbjct: 276 FDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMK 335

Query: 157 LRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV----- 210
           L  H  AI+G+ W      L +   DG +++WD++        +A   +  AL V     
Sbjct: 336 LEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAH--QVAALDVKFKKN 393

Query: 211 HGDLVVTTGTDSQIKIWNLDT 231
           +G  +V+ G D  + I+N D 
Sbjct: 394 NGTFLVSCGHDRLVNIFNADN 414

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 99/214 (46%), Gaps = 18/214 (8%)

Query: 72  VKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTG 131
           + ++   ++  L++H + N L +G  D ++K+WD+ S +      GH   V+ +K   +G
Sbjct: 210 IDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNS-FEELRGHAGRVSRVKVHPSG 268

Query: 132 TRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK-DGLIKLWDLK 190
               S S D   I+WDL  +V +     H  A+  I  + +  L+++A  D +  +WDL+
Sbjct: 269 RLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLR 328

Query: 191 TQQCV---ETHI-AQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIVEKGTYE 246
           + + +   E H  A +G  W+   +G  + T G D  +++W+          I   GT  
Sbjct: 329 SGEPIMKLEGHAGAISGVDWS--PNGYQLATAGADGTVRVWD----------IRNVGTES 376

Query: 247 KQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIF 280
                +  +++ K   +  TFL     D+ V IF
Sbjct: 377 ALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIF 410

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 99/216 (45%), Gaps = 17/216 (7%)

Query: 466 VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLE 525
           V H+  ++S   + D K L++GS DK+++ W+      LV                +   
Sbjct: 526 VGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKG 569

Query: 526 LNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLII 585
            N  +  V  SP   Y A +  D T +++  D +       GH   V  +    +   + 
Sbjct: 570 HNHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVF 629

Query: 586 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           T S+DK  ++W +  GD  +    H   ++ +   P+     + S+DG++  WD    + 
Sbjct: 630 TGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKR 689

Query: 646 VQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
           ++++  H ++ +++L+ + +G+ ++S   DHS+RVW
Sbjct: 690 LKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVW 725

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 77/180 (42%), Gaps = 12/180 (6%)

Query: 522 TTLELNDDILSVKISPEDKYLAVSLLD-----------NTVKVFFLDSMKFFLSLYGHKL 570
           + L  +DD        +D Y+ +  LD           N+    + D      +L GH  
Sbjct: 471 SCLNFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMLNSANNNYRDDDPTCKTLVGHSG 530

Query: 571 PVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSS 630
            V S   S D+K +++ S DK +++W +D      S   H   + +V F P  H F ++S
Sbjct: 531 TVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATAS 590

Query: 631 KDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWK-ETDDQVFL 689
            D   + W  D    ++  A H ++V  ++   +G  V + S D + R+W   T D V L
Sbjct: 591 HDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRL 650

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 63/142 (44%), Gaps = 4/142 (2%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
            A    D   ++W       L  F+GH + V  + F   G  + +GS D    +WD+ + 
Sbjct: 586 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 645

Query: 152 VGVFKLRSHKDAITGIWCEGED-WLVSTAKDGLIKLWDLKTQQCVET---HIAQTGECWA 207
             V     H   +  I    +  WL + ++DG+I +WD+ T + ++    H        +
Sbjct: 646 DSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLS 705

Query: 208 LGVHGDLVVTTGTDSQIKIWNL 229
               G+++++ G D  +++W+L
Sbjct: 706 YSKEGNVLISGGADHSVRVWDL 727

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 64/156 (41%), Gaps = 9/156 (5%)

Query: 85  YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDII 144
           +  +   L +G  D  +++W + + T L+S+ GH   V  + F   G    + S D    
Sbjct: 537 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 596

Query: 145 IWDLVSEVGVFKLRSHKDAITGIWC----EGEDWLVSTAKDGLIKLWDLKTQQCVETHIA 200
           +W   S   ++ LR     +  + C        ++ + + D   ++WD+ T   V   + 
Sbjct: 597 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 653

Query: 201 QTGE--CWALGVHGDLVVTTGTDSQIKIWNLDTSKE 234
            T    C A+   G  + T   D  I IW++ T K 
Sbjct: 654 HTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKR 689

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 70/145 (48%), Gaps = 5/145 (3%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           +V  + +H     +  G +D   ++WD+ +   +  F GH + V  +     G  L +GS
Sbjct: 615 DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGS 674

Query: 139 RDSDIIIWDLVSEVGVFKLRSH-KDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVE 196
            D  I IWD+ +   + ++R H K+AI  + + +  + L+S   D  +++WDLK  +   
Sbjct: 675 EDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK--KATT 732

Query: 197 THIAQTGECWALGVHGDLVVTTGTD 221
              A+  E + +G  GD+  +   D
Sbjct: 733 EPSAEPDEPF-IGYLGDVTASINQD 756

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/177 (19%), Positives = 71/177 (40%), Gaps = 25/177 (14%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIW-----DLMSKTVLLSFS---------------GH 118
           +++ L + D+  + AAG+ D  IKIW      L +  ++L+ +               GH
Sbjct: 469 DMSCLNFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMLNSANNNYRDDDPTCKTLVGH 528

Query: 119 KSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVS 177
              V    F      L+SGS D  + +W + +   +   + H   +  + +     +  +
Sbjct: 529 SGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFAT 588

Query: 178 TAKDGLIKLWD---LKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDT 231
            + D   +LW    +   +    H+    +C +   +G  V T  +D   ++W++ T
Sbjct: 589 ASHDQTARLWSCDHIYPLRIFAGHLNDV-DCVSFHPNGCYVFTGSSDKTCRMWDVST 644

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 11/65 (16%)

Query: 47  INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDL 106
           IN+WDI TG+ L  +           +      +  L Y  E N+L +G AD  +++WDL
Sbjct: 679 INIWDIGTGKRLKQM-----------RGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 727

Query: 107 MSKTV 111
              T 
Sbjct: 728 KKATT 732

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 130/293 (44%), Gaps = 34/293 (11%)

Query: 406 SNGLLKIWNLKTKS---CIRTF-DCGYALTC-KFLPSGTLCVIGTREGQIQLFDLVTSTL 460
           S   +K+ NL+T +   C+ TF +    +T  +F     L   G ++  I+++ L  + L
Sbjct: 447 SRDAIKLDNLQTSAPSVCMYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPL 506

Query: 461 IESID------------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGT 508
              +             + H+  ++S+  + D + LV+ S DK+++ W+           
Sbjct: 507 ESKLPSKSKEASNTTTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSL---------- 556

Query: 509 TDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGH 568
            D F  ++          N  +  VK SP   Y A    D T +++  D +       GH
Sbjct: 557 -DTFTCLVSYKGH-----NHPVWDVKFSPLGHYFATVSHDQTARLWSCDHIYPLRIFAGH 610

Query: 569 KLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFS 628
              V  +    +   ++T S+DK  ++W +  GD  +    H  S+++V   P+     +
Sbjct: 611 LNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTT 670

Query: 629 SSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
            S+DG++  WD    + ++++  H +S V +L+   +G+ +VS   D S+RVW
Sbjct: 671 GSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVW 723

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 90/188 (47%), Gaps = 18/188 (9%)

Query: 516 MKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKF-------------F 562
           M   H+T    N D+ S++ S + + +A    D+ +K++ LD                  
Sbjct: 465 MYTFHNT----NRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNT 520

Query: 563 LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPE 622
            +L GH  PV S+  S D++ ++++S DK +++W LD   C  S   H   + +V F P 
Sbjct: 521 TTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPL 580

Query: 623 SHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWK- 681
            H F + S D   + W  D    ++  A H ++V  +A   +G+ V++ S D + R+W  
Sbjct: 581 GHYFATVSHDQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDI 640

Query: 682 ETDDQVFL 689
           +T D V L
Sbjct: 641 QTGDSVRL 648

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           +V  + +H     +  G +D   ++WD+ +   +  F GH + V  +     G  L +GS
Sbjct: 613 DVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGS 672

Query: 139 RDSDIIIWDLVSEVGVFKLRSH-KDAITGIWCEGE-DWLVSTAKDGLIKLWDLK 190
            D  II+WD+ +   + ++R H K A+  +    E + LVS   D  +++WDLK
Sbjct: 673 EDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLK 726

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 93/214 (43%), Gaps = 21/214 (9%)

Query: 78  AEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSG 137
             V  + +  +   L +   D  +++W L + T L+S+ GH   V  +KF   G    + 
Sbjct: 528 GPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATV 587

Query: 138 SRDSDIIIWDLVSEVGVFKLRSHKDAITGIWC----EGEDWLVSTAKDGLIKLWDLKTQQ 193
           S D    +W   S   ++ LR     +  + C        ++++ + D   ++WD++T  
Sbjct: 588 SHDQTARLW---SCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGD 644

Query: 194 CVETHIAQTGECWALGVHGDLV-VTTGT-DSQIKIWNLDTSKENGSKIVEKGTYEKQSKQ 251
            V   +  T    ++ V  D   +TTG+ D  I +W++ T    G +I       KQ + 
Sbjct: 645 SVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGT----GKRI-------KQMRG 693

Query: 252 RGLS-VNFKTTADETTFLYIQNSDKTVEIFRIRK 284
            G S VN  +   E   L    +D++V ++ ++K
Sbjct: 694 HGKSAVNSLSFNKEGNILVSGGADQSVRVWDLKK 727

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 52/112 (46%), Gaps = 14/112 (12%)

Query: 39  VLTGALE-NINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYA 97
           VLTG+ +    +WDI+TG+            S+ +     A V  +    +   L  G  
Sbjct: 626 VLTGSSDKTCRMWDIQTGD------------SVRLFLGHTASVVSVAVSPDGRWLTTGSE 673

Query: 98  DGVIKIWDLMSKTVLLSFSGH-KSGVTILKFDSTGTRLMSGSRDSDIIIWDL 148
           DGVI +WD+ +   +    GH KS V  L F+  G  L+SG  D  + +WDL
Sbjct: 674 DGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDL 725

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 57/111 (51%), Gaps = 5/111 (4%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTF--DCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +L  +S+   ++W+++T   +R F       ++    P G     G+ +G I ++D+ T 
Sbjct: 626 VLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTG 685

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWN---FSIEQDLVP 506
             I+ +     +A+ SL   ++G  LV+G AD+S++ W+   F+ E  L P
Sbjct: 686 KRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLKKFTNEPALEP 736

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 74/170 (43%), Gaps = 18/170 (10%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWD---------LMSKTVLLSFS----GHKSGVTIL 125
           ++T L++ +++ L+AAG+ D  IKIW          L SK+   S +    GH   V  +
Sbjct: 474 DMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLIGHSGPVYSV 533

Query: 126 KFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLI 184
            F      L+S S D  + +W L +   +   + H   +  + +     +  + + D   
Sbjct: 534 SFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQTA 593

Query: 185 KLWD---LKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDT 231
           +LW    +   +    H+    +C A   +G  V+T  +D   ++W++ T
Sbjct: 594 RLWSCDHIYPLRIFAGHLNDV-DCVAFHPNGTYVLTGSSDKTCRMWDIQT 642

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 105/240 (43%), Gaps = 24/240 (10%)

Query: 364 PYEKRLPKNPSPSKLYTIEQKGHRTXXXXXXXXXXNKLLASAS-NGLLKIWNLKTKSCIR 422
           P E +LP   S     T    GH            N+ L SAS +  +++W+L T +C+ 
Sbjct: 505 PLESKLPSK-SKEASNTTTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLV 563

Query: 423 TFDCGYALTC---KFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQ 479
           ++  G+       KF P G      + +   +L+       +  I   H   +  +    
Sbjct: 564 SYK-GHNHPVWDVKFSPLGHYFATVSHDQTARLWSCDHIYPLR-IFAGHLNDVDCVAFHP 621

Query: 480 DGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED 539
           +G  ++TGS+DK+ + W      D+  G + +      L H  +      ++SV +SP+ 
Sbjct: 622 NGTYVLTGSSDKTCRMW------DIQTGDSVRLF----LGHTAS------VVSVAVSPDG 665

Query: 540 KYLAVSLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           ++L     D  + V+ + + K    + GH K  V S+  + +  ++++  AD+++++W L
Sbjct: 666 RWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDL 725

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 52/135 (38%), Gaps = 16/135 (11%)

Query: 112 LLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRS------------ 159
           + +F      +T L+F      + +G +DS I IW L       KL S            
Sbjct: 465 MYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLI 524

Query: 160 -HKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGVH--GDLV 215
            H   +  + +     +LVS ++D  ++LW L T  C+ ++       W +     G   
Sbjct: 525 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYF 584

Query: 216 VTTGTDSQIKIWNLD 230
            T   D   ++W+ D
Sbjct: 585 ATVSHDQTARLWSCD 599

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 13/72 (18%)

Query: 37  GQVLTGALEN--INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAA 94
           G+ LT   E+  I +WDI TG+ +  +           +    + V  L ++ E N+L +
Sbjct: 665 GRWLTTGSEDGVIIVWDIGTGKRIKQM-----------RGHGKSAVNSLSFNKEGNILVS 713

Query: 95  GYADGVIKIWDL 106
           G AD  +++WDL
Sbjct: 714 GGADQSVRVWDL 725

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 87.8 bits (216), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 63/283 (22%), Positives = 123/283 (43%), Gaps = 38/283 (13%)

Query: 420 CIRTFDC--GYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTL-------IESID----- 465
           C+ TF    G   + +F     L   G ++  I+L+ L  S+L        +SI+     
Sbjct: 479 CMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMN 538

Query: 466 -------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKL 518
                  + H+ A++S   + D + L++GS DK+++ W           +TD +  ++  
Sbjct: 539 DNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLW-----------STDTYTSLVSY 587

Query: 519 IHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDIS 578
                   N  +  V+ SP   Y A +  D T +++  D +       GH   V  +   
Sbjct: 588 KGH-----NHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFH 642

Query: 579 FDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYW 638
            +   + T S+DK  ++W +  GD  +    H   ++     P+     + S+DG++  W
Sbjct: 643 PNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLW 702

Query: 639 DGDKFECVQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
           D    + ++ +  H ++ + +L+   +G+ +VS   DHS+RVW
Sbjct: 703 DIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVW 745

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 85/195 (43%), Gaps = 25/195 (12%)

Query: 516 MKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLD--SMKFF----------- 562
           M   H+T    N  + S++ S + + +A    D+ +K++ LD  S+K             
Sbjct: 480 MYTFHNT----NGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTG 535

Query: 563 -------LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
                   +L GH   V S   S D++ +++ S DK +++W  D      S   H   + 
Sbjct: 536 DMNDNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVW 595

Query: 616 NVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDH 675
           +V F P  H F ++S D   + W  D    ++  A H S+V  ++   +G  V + S D 
Sbjct: 596 DVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDK 655

Query: 676 SMRVWK-ETDDQVFL 689
           + R+W   T D V L
Sbjct: 656 TCRMWDISTGDSVRL 670

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 65/146 (44%), Gaps = 6/146 (4%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
            A    D   ++W       L  F+GH S V  + F   G  + +GS D    +WD+ + 
Sbjct: 606 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTG 665

Query: 152 VGVFKLRSHKDAI--TGIWCEGEDWLVSTAKDGLIKLWDLKTQQ---CVETHIAQTGECW 206
             V     H   +  T +  +G  WL + ++DG+I LWD+ T +    +  H        
Sbjct: 666 DSVRLFLGHTAPVLCTAVSPDGR-WLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSL 724

Query: 207 ALGVHGDLVVTTGTDSQIKIWNLDTS 232
           +    G+++V+ G D  +++W+L  S
Sbjct: 725 SYCKEGNVLVSGGADHSVRVWDLKKS 750

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 2/115 (1%)

Query: 78  AEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSG 137
           ++V  + +H     +  G +D   ++WD+ +   +  F GH + V        G  L +G
Sbjct: 634 SDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATG 693

Query: 138 SRDSDIIIWDLVSEVGVFKLRSH-KDAITGI-WCEGEDWLVSTAKDGLIKLWDLK 190
           S D  I +WD+ +   +  +R H K+AI  + +C+  + LVS   D  +++WDLK
Sbjct: 694 SEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 66/155 (42%), Gaps = 9/155 (5%)

Query: 85  YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDII 144
           +  +   L +G  D  +++W   + T L+S+ GH   V  ++F   G    + S D    
Sbjct: 557 FSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTAR 616

Query: 145 IWDLVSEVGVFKLRSHKDAITGIWC----EGEDWLVSTAKDGLIKLWDLKTQQCVETHIA 200
           +W   S   ++ LR     ++ + C        ++ + + D   ++WD+ T   V   + 
Sbjct: 617 LW---SCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLG 673

Query: 201 QTGE--CWALGVHGDLVVTTGTDSQIKIWNLDTSK 233
            T    C A+   G  + T   D  I +W++ T+K
Sbjct: 674 HTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAK 708

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 61/133 (45%), Gaps = 6/133 (4%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTF--DCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +   +S+   ++W++ T   +R F       L     P G     G+ +G I L+D+ T+
Sbjct: 648 VFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTA 707

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIE-QDLVPGTTDKFVPVMK 517
             ++ +      AI SL   ++G  LV+G AD S++ W+      +  P   ++FV    
Sbjct: 708 KRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLKKSTAEPGPEPEEQFV---G 764

Query: 518 LIHDTTLELNDDI 530
            I + T  +N DI
Sbjct: 765 YIGNLTASINQDI 777

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/176 (19%), Positives = 70/176 (39%), Gaps = 25/176 (14%)

Query: 80  VTYLEYHDETNLLAAGYADGVIKIWDL--------------------MSKTVLLSFSGHK 119
           +T L++ +++ L+AAG+ D  IK+W L                    M+     +  GH 
Sbjct: 490 MTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGHS 549

Query: 120 SGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVST 178
             V    F      L+SGS D  + +W   +   +   + H   +  + +     +  + 
Sbjct: 550 GAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATA 609

Query: 179 AKDGLIKLWD---LKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDT 231
           + D   +LW    +   +    H++   +C +   +G  V T  +D   ++W++ T
Sbjct: 610 SHDQTARLWSCDHIYPLRIFAGHLSDV-DCVSFHPNGCYVFTGSSDKTCRMWDIST 664

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 11/65 (16%)

Query: 47  INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDL 106
           INLWDI T + L V+           +      +  L Y  E N+L +G AD  +++WDL
Sbjct: 699 INLWDIGTAKRLKVM-----------RGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDL 747

Query: 107 MSKTV 111
              T 
Sbjct: 748 KKSTA 752

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 101/229 (44%), Gaps = 17/229 (7%)

Query: 453 FDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKF 512
           FD  +     S  V H+  ++S   + D   LV+GS DK++K W+      LV       
Sbjct: 517 FDRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALV------- 569

Query: 513 VPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPV 572
                         N  +  VK SP   Y A +  D T +++  D +       GH   V
Sbjct: 570 ---------NYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDV 620

Query: 573 LSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKD 632
            ++    +   + T S+DK  ++W +  GD  +    H   +++    P+     + S+D
Sbjct: 621 DTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSED 680

Query: 633 GLVKYWDGDKFECVQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
           G++  WD    + ++++  H ++ V +L+   +G+ ++S   DHS+RVW
Sbjct: 681 GVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVW 729

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 81/193 (41%), Gaps = 23/193 (11%)

Query: 516 MKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLY--------- 566
           M   H+T    N D+ S++ S + +  A    D+ +K++ LD        Y         
Sbjct: 466 MYTFHNT----NRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFS 521

Query: 567 ---------GHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV 617
                    GH   V S   S D+  +++ S DK +K+W +D      +   H   + +V
Sbjct: 522 QDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDV 581

Query: 618 CFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSM 677
            F P  H F S+S D   + W  D    ++  A H ++V  ++   +G  V + S D + 
Sbjct: 582 KFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTC 641

Query: 678 RVWK-ETDDQVFL 689
           R+W   T D V L
Sbjct: 642 RMWDVSTGDSVRL 654

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 96/230 (41%), Gaps = 20/230 (8%)

Query: 5   YQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSVLSDG 64
           + RF QD+    +  ++  V+  S+     N+  V     + + LW + T   L V   G
Sbjct: 517 FDRFSQDNTCSTLVGHSGTVY--STSFSPDNMYLVSGSEDKTVKLWSMDTHTAL-VNYKG 573

Query: 65  LPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTI 124
                 DVK S          HD+T            ++W       L  F+GH + V  
Sbjct: 574 HNHPVWDVKFSPLGHYFASASHDQT-----------ARLWACDHIYPLRIFAGHTNDVDT 622

Query: 125 LKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAI--TGIWCEGEDWLVSTAKDG 182
           + F   G  + +GS D    +WD+ +   V     H   +  T +  +G  WL + ++DG
Sbjct: 623 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGR-WLATGSEDG 681

Query: 183 LIKLWDLKTQQCVET---HIAQTGECWALGVHGDLVVTTGTDSQIKIWNL 229
           +I LWD+ T + ++    H        +    G+++++ G D  +++W++
Sbjct: 682 VICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDV 731

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 63/136 (46%), Gaps = 12/136 (8%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTF--DCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +   +S+   ++W++ T   +R F       L+ +  P G     G+ +G I L+D+ T 
Sbjct: 632 VFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTG 691

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFV----P 514
             I+ +      A+ SL   ++G  L++G AD S++ W      D+  GTT++      P
Sbjct: 692 KRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVW------DVKHGTTEQGPEPEQP 745

Query: 515 VMKLIHDTTLELNDDI 530
               + D T  +N DI
Sbjct: 746 FNAHVGDITASINQDI 761

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 67/174 (38%), Gaps = 21/174 (12%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDL---------MSKTVLLSFS---------GHKS 120
           ++T LE+ D+  L AAG+ D  IKIW L          S +    FS         GH  
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSG 534

Query: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTA 179
            V    F      L+SGS D  + +W + +   +   + H   +  + +     +  S +
Sbjct: 535 TVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASAS 594

Query: 180 KDGLIKLWDLKTQQCVETHIAQTGECWALGVH--GDLVVTTGTDSQIKIWNLDT 231
            D   +LW       +      T +   +  H  G  V T  +D   ++W++ T
Sbjct: 595 HDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVST 648

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 64/147 (43%), Gaps = 5/147 (3%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIW--DLV 149
           L +G  D  +K+W + + T L+++ GH   V  +KF   G    S S D    +W  D +
Sbjct: 548 LVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHI 607

Query: 150 SEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALG 209
             + +F   ++ D  T  +     ++ + + D   ++WD+ T   V   +  T    +  
Sbjct: 608 YPLRIFAGHTN-DVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQ 666

Query: 210 VH--GDLVVTTGTDSQIKIWNLDTSKE 234
           V   G  + T   D  I +W++ T K 
Sbjct: 667 VSPDGRWLATGSEDGVICLWDIGTGKR 693

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 61/123 (49%), Gaps = 5/123 (4%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           +V  + +H     +  G +D   ++WD+ +   +  F GH + V   +    G  L +GS
Sbjct: 619 DVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGS 678

Query: 139 RDSDIIIWDLVSEVGVFKLRSH-KDAITGIWCEGE-DWLVSTAKDGLIKLWDLK---TQQ 193
            D  I +WD+ +   + ++R H K+A+  +    E + L+S   D  +++WD+K   T+Q
Sbjct: 679 EDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQ 738

Query: 194 CVE 196
             E
Sbjct: 739 GPE 741

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 92/205 (44%), Gaps = 22/205 (10%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTFDCGYALTC---KFLPSGTLCVIGTREGQIQLFDLVT 457
           L++ + +  +K+W++ T + +  +  G+       KF P G      + +   +L+    
Sbjct: 548 LVSGSEDKTVKLWSMDTHTALVNYK-GHNHPVWDVKFSPLGHYFASASHDQTARLW-ACD 605

Query: 458 STLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMK 517
                 I   H   + ++    +G  + TGS+DK+ + W+ S        T D     ++
Sbjct: 606 HIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVS--------TGDS----VR 653

Query: 518 LIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSID 576
           L    T      +LS ++SP+ ++LA    D  + ++ + + K    + GH K  V S+ 
Sbjct: 654 LFLGHTAP----VLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLS 709

Query: 577 ISFDSKLIITSSADKNIKIWGLDFG 601
            + +  ++I+  AD ++++W +  G
Sbjct: 710 FNKEGNVLISGGADHSVRVWDVKHG 734

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 99/216 (45%), Gaps = 17/216 (7%)

Query: 466 VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLE 525
           V H+  +++   + D K L++GS DK+++ W+      LV                +   
Sbjct: 524 VGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALV----------------SYKG 567

Query: 526 LNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLII 585
            N  +  V  SP   Y A +  D T +++  D +       GH   V  +    +   + 
Sbjct: 568 HNHPVWDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVF 627

Query: 586 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           T S+DK  ++W +  GD  +    H   ++ +   P+     + S+DG++  WD    + 
Sbjct: 628 TGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKR 687

Query: 646 VQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
           ++++  H ++ +++L+ + +G+ ++S   DHS+RVW
Sbjct: 688 LKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVW 723

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 61/127 (48%), Gaps = 1/127 (0%)

Query: 564 SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPES 623
           +L GH   V +   S D+K +++ S DK +++W +D      S   H   + +V F P  
Sbjct: 522 TLVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLG 581

Query: 624 HNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWK-E 682
           H F ++S D   + W  D    ++  A H ++V  ++   +G  V + S D + R+W   
Sbjct: 582 HYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVS 641

Query: 683 TDDQVFL 689
           T D V L
Sbjct: 642 TGDSVRL 648

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 63/142 (44%), Gaps = 4/142 (2%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
            A    D   ++W       L  F+GH + V  + F   G  + +GS D    +WD+ + 
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 643

Query: 152 VGVFKLRSHKDAITGIWCEGED-WLVSTAKDGLIKLWDLKTQQCVET---HIAQTGECWA 207
             V     H   +  I    +  WL + ++DG+I +WD+ T + ++    H        +
Sbjct: 644 DSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLS 703

Query: 208 LGVHGDLVVTTGTDSQIKIWNL 229
               G+++++ G D  +++W+L
Sbjct: 704 YSKEGNVLISGGADHSVRVWDL 725

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 64/155 (41%), Gaps = 9/155 (5%)

Query: 85  YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDII 144
           +  +   L +G  D  +++W + + T L+S+ GH   V  + F   G    + S D    
Sbjct: 535 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 594

Query: 145 IWDLVSEVGVFKLRSHKDAITGIWC----EGEDWLVSTAKDGLIKLWDLKTQQCVETHIA 200
           +W   S   ++ LR     +  + C        ++ + + D   ++WD+ T   V   + 
Sbjct: 595 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 651

Query: 201 QTGE--CWALGVHGDLVVTTGTDSQIKIWNLDTSK 233
            T    C A+   G  + T   D  I IW++ T K
Sbjct: 652 HTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGK 686

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 68/145 (46%), Gaps = 5/145 (3%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           +V  + +H     +  G +D   ++WD+ +   +  F GH + V  +     G  L +GS
Sbjct: 613 DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGS 672

Query: 139 RDSDIIIWDLVSEVGVFKLRSH-KDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVE 196
            D  I IWD+ +   + ++R H K+AI  + + +  + L+S   D  +++WDLK      
Sbjct: 673 EDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLKK---AT 729

Query: 197 THIAQTGECWALGVHGDLVVTTGTD 221
           T  +   E   +G  GD+  +   D
Sbjct: 730 TEPSAEPEEPFIGYLGDVTASINQD 754

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/178 (18%), Positives = 69/178 (38%), Gaps = 26/178 (14%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLL---------------------SFSG 117
           +++ L++ D+  + AAG+ D  IKIW L   ++                       +  G
Sbjct: 466 DMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMPNINNSDHKDADDPTCKTLVG 525

Query: 118 HKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLV 176
           H   V    F      L+SGS D  + +W + +   +   + H   +  + +     +  
Sbjct: 526 HSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFA 585

Query: 177 STAKDGLIKLWD---LKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDT 231
           + + D   +LW    +   +    H+    +C +   +G  V T  +D   ++W++ T
Sbjct: 586 TASHDQTARLWSCDHIYPLRIFAGHLNDV-DCVSFHPNGCYVFTGSSDKTCRMWDVST 642

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 11/65 (16%)

Query: 47  INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDL 106
           IN+WDI TG+ L  +           +      +  L Y  E N+L +G AD  +++WDL
Sbjct: 677 INIWDIGTGKRLKQM-----------RGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

Query: 107 MSKTV 111
              T 
Sbjct: 726 KKATT 730

>TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {ON}
           Anc_8.544 YBR198C
          Length = 831

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 58/261 (22%), Positives = 114/261 (43%), Gaps = 36/261 (13%)

Query: 440 LCVIGTREGQIQLFDL----VTSTLIESID---------------VAHNAAIWSLDITQD 480
           L   G ++ QI++F L    + S L ES                 + H+  ++S   + D
Sbjct: 510 LAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGHSGTVYSTSFSPD 569

Query: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540
            + LV+GS DK+++ W+      LV                +    N  +  V+ SP   
Sbjct: 570 NRYLVSGSEDKTVRLWSMDTHTSLV----------------SYKGHNHPVWDVEFSPLGH 613

Query: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600
           Y A +  D+T +++  D +       GH   V  +    +   + T S+DK  ++W +  
Sbjct: 614 YFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITT 673

Query: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAH-QSEVWAL 659
           GD  +        +M+    P+     + S+DG++  WD    + ++++  H ++ +++L
Sbjct: 674 GDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSL 733

Query: 660 AITSDGSTVVSSSHDHSMRVW 680
           +   +G+ ++S   DHS+RVW
Sbjct: 734 SYNKEGNVLISGGADHSVRVW 754

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 83/195 (42%), Gaps = 25/195 (12%)

Query: 516 MKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKF-------------- 561
           M   H+T    + D+ S++ S + +  A    D+ +K+F LD                  
Sbjct: 489 MYTFHNT----DRDMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKL 544

Query: 562 ------FLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
                   +L GH   V S   S D++ +++ S DK +++W +D      S   H   + 
Sbjct: 545 LNNDESTSTLIGHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVW 604

Query: 616 NVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDH 675
           +V F P  H F ++S D   + W  D    ++  A H ++V  ++   +G  + + S D 
Sbjct: 605 DVEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDK 664

Query: 676 SMRVWK-ETDDQVFL 689
           + R+W   T D V L
Sbjct: 665 TCRMWDITTGDSVRL 679

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 77/165 (46%), Gaps = 7/165 (4%)

Query: 83  LEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSD 142
           +E+    +  A    D   ++W       L  F+GH + V  + F   G  L +GS D  
Sbjct: 606 VEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKT 665

Query: 143 IIIWDLVS--EVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVET--- 197
             +WD+ +   V +F   +     T +  +G  WL + ++DG+I +WD+ T + ++    
Sbjct: 666 CRMWDITTGDSVRLFLGLTAPVMSTSVSPDGR-WLSTGSEDGVINVWDIGTGKRLKQMRG 724

Query: 198 HIAQTGECWALGVHGDLVVTTGTDSQIKIWNL-DTSKENGSKIVE 241
           H        +    G+++++ G D  +++W+L   + E+G++  E
Sbjct: 725 HGKNAIYSLSYNKEGNVLISGGADHSVRVWDLKKATTESGAEPEE 769

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 67/155 (43%), Gaps = 9/155 (5%)

Query: 85  YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDII 144
           +  +   L +G  D  +++W + + T L+S+ GH   V  ++F   G    + S D    
Sbjct: 566 FSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFATASHDHTAR 625

Query: 145 IWDLVSEVGVFKLRSHKDAITGIWC----EGEDWLVSTAKDGLIKLWDLKTQQCVETHIA 200
           +W   S   ++ LR     +  + C        +L + + D   ++WD+ T   V   + 
Sbjct: 626 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLG 682

Query: 201 QTGECWALGVHGDLV-VTTGT-DSQIKIWNLDTSK 233
            T    +  V  D   ++TG+ D  I +W++ T K
Sbjct: 683 LTAPVMSTSVSPDGRWLSTGSEDGVINVWDIGTGK 717

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 68/151 (45%), Gaps = 7/151 (4%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           +V  + +H     L  G +D   ++WD+ +   +  F G  + V        G  L +GS
Sbjct: 644 DVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGS 703

Query: 139 RDSDIIIWDLVSEVGVFKLRSH-KDAITGIWCEGE-DWLVSTAKDGLIKLWDLKTQQCVE 196
            D  I +WD+ +   + ++R H K+AI  +    E + L+S   D  +++WDLK      
Sbjct: 704 EDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLKK---AT 760

Query: 197 THIAQTGECWALGVHGDLVVTTGTDSQIKIW 227
           T      E   +G  GD  VTT  +  IK +
Sbjct: 761 TESGAEPEEPFVGYLGD--VTTSINQDIKEY 789

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/177 (20%), Positives = 71/177 (40%), Gaps = 25/177 (14%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTV-------------LL-------SFSGH 118
           ++T LE+ D+  L AAG+ D  IKI+ L   ++             LL       +  GH
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGH 557

Query: 119 KSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVS 177
              V    F      L+SGS D  + +W + +   +   + H   +  + +     +  +
Sbjct: 558 SGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFAT 617

Query: 178 TAKDGLIKLWD---LKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDT 231
            + D   +LW    +   +    H+    +C +   +G  + T  +D   ++W++ T
Sbjct: 618 ASHDHTARLWSCDHIYPLRIFAGHLNDV-DCVSFHPNGCYLFTGSSDKTCRMWDITT 673

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 11/65 (16%)

Query: 47  INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDL 106
           IN+WDI TG+ L  +           +      +  L Y+ E N+L +G AD  +++WDL
Sbjct: 708 INVWDIGTGKRLKQM-----------RGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDL 756

Query: 107 MSKTV 111
              T 
Sbjct: 757 KKATT 761

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 101/217 (46%), Gaps = 19/217 (8%)

Query: 466 VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLE 525
           + H+  ++S   + D + L++GS DK+++ W+      LV                +   
Sbjct: 522 IGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALV----------------SYKG 565

Query: 526 LNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLY-GHKLPVLSIDISFDSKLI 584
            N  I  V+ SP   Y A +  D T +++  D + F L ++ GH   V  +    +   +
Sbjct: 566 HNHPIWDVQFSPLGHYFATASHDQTARLWSCDHI-FPLRIFAGHLNDVDCVSFHPNGYYV 624

Query: 585 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFE 644
            T S+DK  ++W +  GD  +    H  ++++    P+     + S DG +  WD    +
Sbjct: 625 FTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGTINVWDIGSGK 684

Query: 645 CVQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
            ++ L  H ++ V++L  + +G+ +VSS  D S+RVW
Sbjct: 685 RLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVW 721

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 80/188 (42%), Gaps = 20/188 (10%)

Query: 522 TTLELNDDILSVKISPEDKYLAVSLLDNT-VKVFFLDSMK------------------FF 562
           T+LE +DD        +D Y+ +  LD T +   F  + K                    
Sbjct: 459 TSLEFSDDCRLASTGFQDSYIKIWSLDGTSLNTKFTQANKDRNRITITDRSLTHMDNELS 518

Query: 563 LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPE 622
            +L GH   V S   S D++ +I+ S DK +++W LD      S   H   I +V F P 
Sbjct: 519 ATLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFSPL 578

Query: 623 SHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWK- 681
            H F ++S D   + W  D    ++  A H ++V  ++   +G  V + S D + R+W  
Sbjct: 579 GHYFATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDI 638

Query: 682 ETDDQVFL 689
            T D V L
Sbjct: 639 STGDSVRL 646

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 67/158 (42%), Gaps = 6/158 (3%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
            A    D   ++W       L  F+GH + V  + F   G  + +GS D    +WD+ + 
Sbjct: 582 FATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTG 641

Query: 152 VGVFKLRSHKDAI--TGIWCEGEDWLVSTAKDGLIKLWDL---KTQQCVETHIAQTGECW 206
             V     H  A+  T +  +G  WL + + DG I +WD+   K  + +  H        
Sbjct: 642 DSVRLFLGHTSAVVSTAVSPDGR-WLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSL 700

Query: 207 ALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIVEKGT 244
                G+L+V++G D  +++W+L     N +     GT
Sbjct: 701 TYSKEGNLLVSSGADQSVRVWDLFKPSANANNNPSSGT 738

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 89/200 (44%), Gaps = 28/200 (14%)

Query: 426 CGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLV 485
            G   +  F P     + G+ +  ++L+ L T T + S    HN  IW +  +  G    
Sbjct: 525 SGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYK-GHNHPIWDVQFSPLGHYFA 583

Query: 486 TGSADKSIKFWN----FSI--------EQDLVP----------GTTDKFVPVMKLIHDTT 523
           T S D++ + W+    F +        + D V           G++DK   +  +    +
Sbjct: 584 TASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDS 643

Query: 524 LEL----NDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSIDIS 578
           + L       ++S  +SP+ ++L     D T+ V+ + S K   SL GH K  V S+  S
Sbjct: 644 VRLFLGHTSAVVSTAVSPDGRWLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSLTYS 703

Query: 579 FDSKLIITSSADKNIKIWGL 598
            +  L+++S AD+++++W L
Sbjct: 704 KEGNLLVSSGADQSVRVWDL 723

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 55/113 (48%), Gaps = 2/113 (1%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           +V  + +H     +  G +D   ++WD+ +   +  F GH S V        G  L +GS
Sbjct: 611 DVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGS 670

Query: 139 RDSDIIIWDLVSEVGVFKLRSH-KDAITGIWCEGE-DWLVSTAKDGLIKLWDL 189
            D  I +WD+ S   +  LR H K+A+  +    E + LVS+  D  +++WDL
Sbjct: 671 DDGTINVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 51/100 (51%), Gaps = 2/100 (2%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTF--DCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +   +S+   ++W++ T   +R F       ++    P G     G+ +G I ++D+ + 
Sbjct: 624 VFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGTINVWDIGSG 683

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNF 498
             ++S+      A++SL  +++G  LV+  AD+S++ W+ 
Sbjct: 684 KRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 68/185 (36%), Gaps = 33/185 (17%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFS---------------------- 116
           ++T LE+ D+  L + G+ D  IKIW L   ++   F+                      
Sbjct: 457 DMTSLEFSDDCRLASTGFQDSYIKIWSLDGTSLNTKFTQANKDRNRITITDRSLTHMDNE 516

Query: 117 ------GHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WC 169
                 GH   V    F      L+SGS D  + +W L +   +   + H   I  + + 
Sbjct: 517 LSATLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFS 576

Query: 170 EGEDWLVSTAKDGLIKLWDLK---TQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKI 226
               +  + + D   +LW        +    H+    +C +   +G  V T  +D   ++
Sbjct: 577 PLGHYFATASHDQTARLWSCDHIFPLRIFAGHLNDV-DCVSFHPNGYYVFTGSSDKTCRM 635

Query: 227 WNLDT 231
           W++ T
Sbjct: 636 WDIST 640

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 11/61 (18%)

Query: 47  INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDL 106
           IN+WDI +G+ L  L           +      V  L Y  E NLL +  AD  +++WDL
Sbjct: 675 INVWDIGSGKRLKSL-----------RGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

Query: 107 M 107
            
Sbjct: 724 F 724

>NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {ON}
           Anc_6.363
          Length = 793

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 117/229 (51%), Gaps = 17/229 (7%)

Query: 460 LIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLI 519
           L +S+D  H++ +  +  + DG+ L TG  +K+ + +  S  + L+   +D  V   KL 
Sbjct: 436 LHKSLD--HSSVVCCVKFSYDGEFLATG-CNKTTQVYRVSTGE-LIAKLSDDNV---KLD 488

Query: 520 HDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISF 579
            ++T   +  I SV  SP+ K+LA    D  ++++ +   K  + L GH+  V S+D   
Sbjct: 489 SNST-STDLYIRSVCFSPDGKFLATGAEDKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFP 547

Query: 580 DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS-SKDGLVKYW 638
           D + +++ S D+ ++IW L  G C  +L + +D +  V   P    F ++ S D  V+ W
Sbjct: 548 DGQKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPHDGRFIAAGSLDRAVRVW 606

Query: 639 DGDKFECVQKL-------AAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           D      V++L         HQ  V+++  T DG+ VVS S D S+++W
Sbjct: 607 DSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLW 655

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 123/301 (40%), Gaps = 68/301 (22%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+    ++  +   H   ++SLD   DG++LV+G
Sbjct: 497 YIRSVCFSPDGKFLATGAEDKLIRIWDIQEGKIVMVLK-GHEQDVYSLDYFPDGQKLVSG 555

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP D +++A   
Sbjct: 556 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPHDGRFIAAGS 598

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GH+  V S+  + D   +++ S DK++K+W 
Sbjct: 599 LDRAVRVW--DSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLWN 656

Query: 598 LDF------------------------------GDCHKSLFAHQDSIMNVCFLPESHNFF 627
           L                                  C  +   H+D +++V          
Sbjct: 657 LGNDVNSNNNGNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSVTTSQNDEYIL 716

Query: 628 SSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDG-------STVVSSSHDHSMRVW 680
           S SKD  V +WD      +  L  H++ V ++A+ ++G       +   + S D   R+W
Sbjct: 717 SGSKDRGVLFWDKKSGNPLLMLQGHKNSVISVAV-ANGYPLGPKYNVFATGSGDCKARIW 775

Query: 681 K 681
           K
Sbjct: 776 K 776

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 96/203 (47%), Gaps = 19/203 (9%)

Query: 41  TGALENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLE---YHDETNLLAAGYA 97
           TG  +   ++ + TGEL++ LSD     ++ + S+  +   Y+    +  +   LA G  
Sbjct: 460 TGCNKTTQVYRVSTGELIAKLSDD----NVKLDSNSTSTDLYIRSVCFSPDGKFLATGAE 515

Query: 98  DGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKL 157
           D +I+IWD+    +++   GH+  V  L +   G +L+SGS D  + IWDL +      L
Sbjct: 516 DKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQCSLTL 575

Query: 158 RSHKDAITGIWCEGED--WLVSTAKDGLIKLWDLKTQQCVETHIAQ----TGE-----CW 206
            S +D +T +     D  ++ + + D  +++WD  T   VE   ++    TG        
Sbjct: 576 -SIEDGVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSVYSV 634

Query: 207 ALGVHGDLVVTTGTDSQIKIWNL 229
                G+ VV+   D  +K+WNL
Sbjct: 635 VFTRDGNEVVSGSLDKSVKLWNL 657

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 60/142 (42%), Gaps = 8/142 (5%)

Query: 542 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFG 601
           L   L D+ VK   LDS      LY     + S+  S D K + T + DK I+IW +  G
Sbjct: 476 LIAKLSDDNVK---LDSNSTSTDLY-----IRSVCFSPDGKFLATGAEDKLIRIWDIQEG 527

Query: 602 DCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAI 661
                L  H+  + ++ + P+     S S D  V+ WD    +C   L+           
Sbjct: 528 KIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS 587

Query: 662 TSDGSTVVSSSHDHSMRVWKET 683
             DG  + + S D ++RVW  T
Sbjct: 588 PHDGRFIAAGSLDRAVRVWDST 609

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 31/60 (51%)

Query: 108 SKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI 167
           S T  +++ GHK  V  +        ++SGS+D  ++ WD  S   +  L+ HK+++  +
Sbjct: 689 SATCEVTYVGHKDFVLSVTTSQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHKNSVISV 748

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 118/274 (43%), Gaps = 30/274 (10%)

Query: 436 PSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKF 495
           P GT    G+  G I +F+  T   + +    H+  I  +D + D + LV+G  D  +K 
Sbjct: 191 PEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKL 250

Query: 496 WNFSIEQDLVPG---------TTDKFVPVMKLI----HDTTLELND-------------- 528
           +NF      V           T  KF P  K I     DTT  L D              
Sbjct: 251 YNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHS 310

Query: 529 -DILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITS 587
            +I S+    +   +A +  D    ++ L S K  LSL GH  P+   D S  +      
Sbjct: 311 KEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWS-QNGYQXXX 369

Query: 588 SADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFF-SSSKDGLVKYWDGDKFECV 646
           S D  IKIW L   D  +++ AH++ + ++ F  E+  F  SSS D  +  +  D +  +
Sbjct: 370 SGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKI 429

Query: 647 QKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
             L  H  ++ ++ I+SD  T+VS   D S+++W
Sbjct: 430 HTLQGHNDKILSIDISSDYQTIVSGGWDRSVKLW 463

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 78/175 (44%), Gaps = 20/175 (11%)

Query: 41  TGALENINLWDIKTGELLSVLSDGL------PPGSIDVKSS---KPAEVTYLEYHDETNL 91
           +G +  I+ W   +  L+S   DG+         SI V +S     A VT +++H     
Sbjct: 224 SGKISGID-WSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKY 282

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
           + +   D   ++WD+++ + LL   GH   +  L F + G+ + +   D   IIWDL S 
Sbjct: 283 IGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWDLRSG 342

Query: 152 VGVFKLRSHKDAITGIWCEGEDW-----LVSTAKDGLIKLWDLKTQQCVETHIAQ 201
             +  L  H      I+C   DW         + DG IK+WDL+    VET +A 
Sbjct: 343 KNILSLVGHAKP---IYC--SDWSQNGYQXXXSGDGTIKIWDLRKVDDVETILAH 392

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 102/229 (44%), Gaps = 31/229 (13%)

Query: 401 LLASASNGLLKIWNLKTKSC-IRTFDCGY---ALTCKFLPSGTLCVIGTREGQIQLFDLV 456
           L++   +G++K++N  + S  + T   G+       KF PS       + +   +L+D+V
Sbjct: 239 LVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIV 298

Query: 457 TSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVP---------- 506
           T++ +  +   H+  I+SL    DG  + T  ADK    W+    ++++           
Sbjct: 299 TNSEL-LLQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYC 357

Query: 507 -----------GTTDKFVPVMKLIH----DTTLELNDDILSVKISPED-KYLAVSLLDNT 550
                       + D  + +  L      +T L   + +  +K   E+ K+L  S  D  
Sbjct: 358 SDWSQNGYQXXXSGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKD 417

Query: 551 VKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599
           + VF  DS     +L GH   +LSIDIS D + I++   D+++K+W ++
Sbjct: 418 INVFSSDSWVKIHTLQGHNDKILSIDISSDYQTIVSGGWDRSVKLWSME 466

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 82/165 (49%), Gaps = 6/165 (3%)

Query: 70  IDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKT--VLLSFSGHKSGVTILKF 127
           I  + +   +++ +++  ++  L +G  DG++K+++  S +  V  SF GH + VT +KF
Sbjct: 217 ITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKF 276

Query: 128 DSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTA-KDGLIKL 186
             +   + S S D+   +WD+V+   +     H   I  +  + +  L++TA  D +  +
Sbjct: 277 HPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATAGADKVGII 336

Query: 187 WDLKTQQCVETHIAQTGE--CWALGVHGDLVVTTGTDSQIKIWNL 229
           WDL++ + + + +       C     +G     +G D  IKIW+L
Sbjct: 337 WDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXSG-DGTIKIWDL 380

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 66/146 (45%), Gaps = 17/146 (11%)

Query: 49  LWDIKTGE-LLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLM 107
           +WD+++G+ +LS++    P               Y     +         DG IKIWDL 
Sbjct: 336 IWDLRSGKNILSLVGHAKP--------------IYCSDWSQNGYQXXXSGDGTIKIWDLR 381

Query: 108 SKTVLLSFSGHKSGVTILKFDSTGTR-LMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITG 166
               + +   HK+ VT LKF+   ++ L+S S D DI ++   S V +  L+ H D I  
Sbjct: 382 KVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQGHNDKILS 441

Query: 167 IWCEGE-DWLVSTAKDGLIKLWDLKT 191
           I    +   +VS   D  +KLW ++ 
Sbjct: 442 IDISSDYQTIVSGGWDRSVKLWSMEA 467

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 82/181 (45%), Gaps = 22/181 (12%)

Query: 383 QKGHRTXXXXXXXXXXNKLLASA-SNGLLKIWNLKTKSCIRTFDCGYA--LTCKFLPSGT 439
           Q+GH              L+A+A ++ +  IW+L++   I +   G+A  + C       
Sbjct: 306 QEGHSKEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSL-VGHAKPIYCSDWSQNG 364

Query: 440 LCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDIT-QDGKRLVTGSADKSIKFWNF 498
                + +G I+++DL     +E+I +AH   +  L    ++ K L++ S DK I  +  
Sbjct: 365 YQXXXSGDGTIKIWDLRKVDDVETI-LAHKNVVTDLKFEKENSKFLISSSYDKDINVF-- 421

Query: 499 SIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDS 558
                    ++D +V +  L        ND ILS+ IS + + +     D +VK++ +++
Sbjct: 422 ---------SSDSWVKIHTLQGH-----NDKILSIDISSDYQTIVSGGWDRSVKLWSMEA 467

Query: 559 M 559
           +
Sbjct: 468 I 468

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 98/216 (45%), Gaps = 17/216 (7%)

Query: 466 VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLE 525
           V H+  ++S   + D + L++ S DK+++ W           +TD +  ++         
Sbjct: 479 VGHSGTVYSTAFSPDNRYLLSASEDKTVRLW-----------STDTYTSLVSYKGH---- 523

Query: 526 LNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLII 585
            N  I  V  SP   Y A +  D T +++  D +       GH   V ++    +   + 
Sbjct: 524 -NHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVF 582

Query: 586 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           T S+DK  ++W +  GD  +    H   +      P+     + S+DG++  WD    + 
Sbjct: 583 TGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKR 642

Query: 646 VQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
           ++++  H ++ V++L+ + +G  +VS   DHS+RVW
Sbjct: 643 LKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVW 678

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 84/188 (44%), Gaps = 18/188 (9%)

Query: 516 MKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFF------------- 562
           M   H+T    N ++ S++ S + +  +    D+ VK++ LD                  
Sbjct: 420 MYTFHNT----NSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNN 475

Query: 563 LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPE 622
            +L GH   V S   S D++ ++++S DK +++W  D      S   H   I +V F P 
Sbjct: 476 ATLVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPL 535

Query: 623 SHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWK- 681
            H F ++S D   + W  D    ++  A H ++V  ++   +G+ V + S D + R+W  
Sbjct: 536 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDM 595

Query: 682 ETDDQVFL 689
            T D V L
Sbjct: 596 STGDSVRL 603

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 69/154 (44%), Gaps = 5/154 (3%)

Query: 90  NLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLV 149
           +  A    D   ++W       L  F+GH + V  + F   GT + +GS D    +WD+ 
Sbjct: 537 HYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMS 596

Query: 150 SEVGVFKLRSHKDAITGIWCEGED-WLVSTAKDGLIKLWDLKTQQCVET---HIAQTGEC 205
           +   V     H   +T      +  WL + ++DG+I +WD+ T + ++    H       
Sbjct: 597 TGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYS 656

Query: 206 WALGVHGDLVVTTGTDSQIKIWNLDTS-KENGSK 238
            +    G ++V+ G D  +++W++  S  E GS+
Sbjct: 657 LSYSKEGHVLVSGGADHSLRVWDVKKSTAEPGSE 690

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           +V  + +H     +  G +D   ++WD+ +   +  F GH + VT       G  L +GS
Sbjct: 568 DVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGS 627

Query: 139 RDSDIIIWDLVSEVGVFKLRSH-KDAITGIWCEGEDW-LVSTAKDGLIKLWDLK 190
            D  I +WD+ +   + ++R H K+A+  +    E   LVS   D  +++WD+K
Sbjct: 628 EDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDVK 681

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 60/132 (45%), Gaps = 4/132 (3%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTF--DCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +   +S+   ++W++ T   +R F             P G     G+ +G I ++D+ T 
Sbjct: 581 VFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTG 640

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKL 518
             ++ +      A++SL  +++G  LV+G AD S++ W+  +++      ++   P    
Sbjct: 641 KRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWD--VKKSTAEPGSEPEQPFTSF 698

Query: 519 IHDTTLELNDDI 530
             D T  +N DI
Sbjct: 699 SGDVTTSVNQDI 710

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/170 (20%), Positives = 65/170 (38%), Gaps = 16/170 (9%)

Query: 78  AEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVL-------------LSFSGHKSGVTI 124
           +E+T LE+ D+  L +AG+ D ++KIW L  + +               +  GH   V  
Sbjct: 428 SEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGTVYS 487

Query: 125 LKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGL 183
             F      L+S S D  + +W   +   +   + H   I  + +     +  + + D  
Sbjct: 488 TAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYFATASHDQT 547

Query: 184 IKLWDLKTQQCVETHIAQTGECWALGVH--GDLVVTTGTDSQIKIWNLDT 231
            +LW       +        +   +  H  G  V T  +D   ++W++ T
Sbjct: 548 ARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMST 597

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 14/112 (12%)

Query: 39  VLTGALENI-NLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYA 97
           V TG+ +    +WD+ TG+            S+ +     A VT      +   L+ G  
Sbjct: 581 VFTGSSDKTCRMWDMSTGD------------SVRLFLGHTAPVTATAVSPDGRWLSTGSE 628

Query: 98  DGVIKIWDLMSKTVLLSFSGH-KSGVTILKFDSTGTRLMSGSRDSDIIIWDL 148
           DG+I +WD+ +   L    GH K+ V  L +   G  L+SG  D  + +WD+
Sbjct: 629 DGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDV 680

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 54/136 (39%), Gaps = 18/136 (13%)

Query: 112 LLSFSGHKSGVTILKFDSTGTRLMS-GSRDSDIIIWDLVSEVGVFKLRSHKD-------- 162
           + +F    S +T L+F S   RL S G +DS + IW L  E    KL S +D        
Sbjct: 420 MYTFHNTNSEMTSLEF-SDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATL 478

Query: 163 ------AITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECW--ALGVHGDL 214
                   +  +     +L+S ++D  ++LW   T   + ++       W  A    G  
Sbjct: 479 VGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHY 538

Query: 215 VVTTGTDSQIKIWNLD 230
             T   D   ++W+ D
Sbjct: 539 FATASHDQTARLWSCD 554

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 34/80 (42%), Gaps = 20/80 (25%)

Query: 47  INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDL 106
           IN+WDI TG+ L  +           +      V  L Y  E ++L +G AD  +++WD+
Sbjct: 632 INVWDIGTGKRLKQM-----------RGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDV 680

Query: 107 MSKTV---------LLSFSG 117
              T            SFSG
Sbjct: 681 KKSTAEPGSEPEQPFTSFSG 700

>TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {ON}
           Anc_6.363 YCR084C
          Length = 663

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 123/297 (41%), Gaps = 61/297 (20%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+    ++  ++  H   I+SLD    G ++V+G
Sbjct: 368 YIRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILN-GHEQDIYSLDYFPSGDKIVSG 426

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLL 547
           S D++++ W+ +  Q L+                 TL + D + +V +SP+ K++A   L
Sbjct: 427 SGDRTVRIWDLNTGQCLL-----------------TLSIEDGVTTVAVSPDGKFIAAGSL 469

Query: 548 DNTVKV------FFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL--- 598
           D  V+V      F ++ +       GH+  V S+  + D K +++ S DK +K+W L   
Sbjct: 470 DRAVRVWDAETGFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQ 529

Query: 599 ----------------------------DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSS 630
                                       +   C  +   H+D +++V    +     S S
Sbjct: 530 TTSSNDASKINQNSNSHLDSKINKSNNNNSSTCEVTYMGHKDFVLSVATTNDDQMILSGS 589

Query: 631 KDGLVKYWDGDKFECVQKLAAHQSEVWALAITS------DGSTVVSSSHDHSMRVWK 681
           KD  V +WD      +  L  H++ V ++A+ +      +     + S D   R+WK
Sbjct: 590 KDRSVLFWDTKSGNPLLMLQGHRNSVISVAVANGIPLGPNYGIFATGSGDCKARIWK 646

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 115/252 (45%), Gaps = 39/252 (15%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFL-PSGTLCVIGTREGQIQLFDLVT 457
           +K+++ + +  ++IW+L T  C+ T      +T   + P G     G+ +  ++++D  T
Sbjct: 421 DKIVSGSGDRTVRIWDLNTGQCLLTLSIEDGVTTVAVSPDGKFIAAGSLDRAVRVWDAET 480

Query: 458 STLIESID-----VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKF 512
             L+E +D       H  +++S+  T+DGK +V+GS DK++K WN   +       T   
Sbjct: 481 GFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQ-------TTSS 533

Query: 513 VPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPV 572
               K+  ++   L+               + +   +T +V ++          GHK  V
Sbjct: 534 NDASKINQNSNSHLD----------SKINKSNNNNSSTCEVTYM----------GHKDFV 573

Query: 573 LSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCF---LPESHN---F 626
           LS+  + D ++I++ S D+++  W    G+    L  H++S+++V     +P   N   F
Sbjct: 574 LSVATTNDDQMILSGSKDRSVLFWDTKSGNPLLMLQGHRNSVISVAVANGIPLGPNYGIF 633

Query: 627 FSSSKDGLVKYW 638
            + S D   + W
Sbjct: 634 ATGSGDCKARIW 645

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 78/161 (48%), Gaps = 13/161 (8%)

Query: 91  LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVS 150
            LA G  D +I+IWD+  K +++  +GH+  +  L +  +G +++SGS D  + IWDL +
Sbjct: 380 FLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSGSGDRTVRIWDLNT 439

Query: 151 EVGVFKLRSHKDAITGIWCEGEDWLVSTAK-DGLIKLWDLKTQQCVE----THIAQTGEC 205
              +  L S +D +T +    +   ++    D  +++WD +T   VE      +    E 
Sbjct: 440 GQCLLTL-SIEDGVTTVAVSPDGKFIAAGSLDRAVRVWDAETGFLVERLDSNELGTGHED 498

Query: 206 WALGV----HGDLVVTTGTDSQIKIWNLD---TSKENGSKI 239
               V     G  VV+   D  +K+WNL    TS  + SKI
Sbjct: 499 SVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQTTSSNDASKI 539

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 55/111 (49%), Gaps = 1/111 (0%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS 629
           L + S+  S D K + T + D+ I+IW +        L  H+  I ++ + P      S 
Sbjct: 367 LYIRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSG 426

Query: 630 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           S D  V+ WD +  +C+  L+  +  V  +A++ DG  + + S D ++RVW
Sbjct: 427 SGDRTVRIWDLNTGQCLLTLSI-EDGVTTVAVSPDGKFIAAGSLDRAVRVW 476

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 78/160 (48%), Gaps = 21/160 (13%)

Query: 41  TGALEN-INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADG 99
           TGA +  I +WDI   +++ +L+                ++  L+Y    + + +G  D 
Sbjct: 383 TGAEDRLIRIWDITLKKIVMILN------------GHEQDIYSLDYFPSGDKIVSGSGDR 430

Query: 100 VIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRS 159
            ++IWDL +   LL+ S  + GVT +     G  + +GS D  + +WD  +   V +L S
Sbjct: 431 TVRIWDLNTGQCLLTLS-IEDGVTTVAVSPDGKFIAAGSLDRAVRVWDAETGFLVERLDS 489

Query: 160 ------HKDAI-TGIWCEGEDWLVSTAKDGLIKLWDLKTQ 192
                 H+D++ + ++ +    +VS + D  +KLW+LK Q
Sbjct: 490 NELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQ 529

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%)

Query: 614 IMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSH 673
           I +VCF P+     + ++D L++ WD    + V  L  H+ ++++L     G  +VS S 
Sbjct: 369 IRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSGSG 428

Query: 674 DHSMRVWKETDDQVFL 689
           D ++R+W     Q  L
Sbjct: 429 DRTVRIWDLNTGQCLL 444

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 42/209 (20%), Positives = 73/209 (34%), Gaps = 72/209 (34%)

Query: 25  WLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSVLS--DGL------PPGSIDVKSSK 76
           + PS D   S  G         + +WD+ TG+ L  LS  DG+      P G      S 
Sbjct: 416 YFPSGDKIVSGSGD------RTVRIWDLNTGQCLLTLSIEDGVTTVAVSPDGKFIAAGSL 469

Query: 77  P-------AEVTYLEYHDETNLLAAGYADGV--------------------IKIWDLMSK 109
                   AE  +L    ++N L  G+ D V                    +K+W+L  +
Sbjct: 470 DRAVRVWDAETGFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQ 529

Query: 110 TVL-------------------------------LSFSGHKSGVTILKFDSTGTRLMSGS 138
           T                                 +++ GHK  V  +   +    ++SGS
Sbjct: 530 TTSSNDASKINQNSNSHLDSKINKSNNNNSSTCEVTYMGHKDFVLSVATTNDDQMILSGS 589

Query: 139 RDSDIIIWDLVSEVGVFKLRSHKDAITGI 167
           +D  ++ WD  S   +  L+ H++++  +
Sbjct: 590 KDRSVLFWDTKSGNPLLMLQGHRNSVISV 618

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 99/216 (45%), Gaps = 17/216 (7%)

Query: 466 VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLE 525
           V H+  ++S   + D + L++ S DK+++ W           +TD +  ++         
Sbjct: 479 VGHSGTVYSTSFSPDNRYLLSASEDKTVRLW-----------STDTYTSLVNYKGH---- 523

Query: 526 LNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLII 585
            N  I  V  SP   Y A +  D T +++  D +       GH   V ++    +   + 
Sbjct: 524 -NHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVF 582

Query: 586 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           T S+DK  ++W +  GD  +    H   + +    P+     + S+DG++  WD    + 
Sbjct: 583 TGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKR 642

Query: 646 VQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
           ++++  H ++ V++L+ + +G  ++S   DHS+RVW
Sbjct: 643 LKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVW 678

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 83/178 (46%), Gaps = 17/178 (9%)

Query: 516 MKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDS--MKFFL---------- 563
           M   H+T    N ++ S++ S + +  A    D+ +K++ LD   +K  L          
Sbjct: 420 MYTFHNT----NSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNN 475

Query: 564 -SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPE 622
            +L GH   V S   S D++ ++++S DK +++W  D      +   H   I +V F P 
Sbjct: 476 ETLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPL 535

Query: 623 SHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
            H F ++S D   + W  D    ++  A H ++V  ++   +G+ V + S D + R+W
Sbjct: 536 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMW 593

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 69/154 (44%), Gaps = 5/154 (3%)

Query: 90  NLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLV 149
           +  A    D   ++W       L  F+GH + V  + F   GT + +GS D    +WD+ 
Sbjct: 537 HYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDIT 596

Query: 150 SEVGVFKLRSHKDAITGIWCEGED-WLVSTAKDGLIKLWDLKTQQCVET---HIAQTGEC 205
           S   V     H   +T      +  WL + ++DG+I +WD+ T + ++    H       
Sbjct: 597 SGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYS 656

Query: 206 WALGVHGDLVVTTGTDSQIKIWNLDTS-KENGSK 238
            +    G ++++ G D  +++W++  S  E GS+
Sbjct: 657 LSYSKEGHVLISGGADHSVRVWDVKKSTAEPGSE 690

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           +V  + +H     +  G +D   ++WD+ S   +  F GH + VT       G  L +GS
Sbjct: 568 DVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGS 627

Query: 139 RDSDIIIWDLVSEVGVFKLRSH-KDAITGIWCEGEDW-LVSTAKDGLIKLWDLK 190
            D  I +WD+ +   + ++R H K+A+  +    E   L+S   D  +++WD+K
Sbjct: 628 EDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 64/168 (38%), Gaps = 16/168 (9%)

Query: 78  AEVTYLEYHDETNLLAAGYADGVIKIWDL-------------MSKTVLLSFSGHKSGVTI 124
           +E+T LE+ D+  L AAG+ D +IKIW L               +T   +  GH   V  
Sbjct: 428 SEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYS 487

Query: 125 LKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGL 183
             F      L+S S D  + +W   +   +   + H   I  + +     +  + + D  
Sbjct: 488 TSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQT 547

Query: 184 IKLWDLKTQQCVETHIAQTGECWALGVH--GDLVVTTGTDSQIKIWNL 229
            +LW       +        +   +  H  G  V T  +D   ++W++
Sbjct: 548 ARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDI 595

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 50/112 (44%), Gaps = 14/112 (12%)

Query: 39  VLTGALENI-NLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYA 97
           V TG+ +    +WDI +G+            S+ +     A VT      +   L+ G  
Sbjct: 581 VFTGSSDKTCRMWDITSGD------------SVRLFLGHTAPVTSTAVSPDGRWLSTGSE 628

Query: 98  DGVIKIWDLMSKTVLLSFSGH-KSGVTILKFDSTGTRLMSGSRDSDIIIWDL 148
           DGVI +WD+ +   L    GH K+ V  L +   G  L+SG  D  + +WD+
Sbjct: 629 DGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDV 680

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 58/150 (38%), Gaps = 19/150 (12%)

Query: 100 VIKIWDLMSKT---VLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFK 156
            I++ +L S      + +F    S +T L+F        +G +DS I IW L  E    K
Sbjct: 405 AIRLENLQSSAPSVCMYTFHNTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNK 464

Query: 157 L------RSHKDAITG--------IWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQT 202
           L      R++ + + G         +     +L+S ++D  ++LW   T   +  +    
Sbjct: 465 LPSKQGERTNNETLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHN 524

Query: 203 GECW--ALGVHGDLVVTTGTDSQIKIWNLD 230
              W  A    G    T   D   ++W+ D
Sbjct: 525 HPIWDVAFSPLGHYFATASHDQTARLWSCD 554

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 17/83 (20%)

Query: 47  INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDL 106
           IN+WDI TG+ L  +           +      V  L Y  E ++L +G AD  +++WD+
Sbjct: 632 INVWDIGTGKRLKQM-----------RGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDV 680

Query: 107 MSKTVLLS------FSGHKSGVT 123
              T          F+G+   VT
Sbjct: 681 KKSTAEPGSEPEQPFTGYSGDVT 703

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 119/280 (42%), Gaps = 44/280 (15%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+    ++  +   H   I+SLD    G +LV+G
Sbjct: 557 YIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLK-GHEQDIYSLDYFPSGDKLVSG 615

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP D K++A   
Sbjct: 616 SGDRTVRIWDLKTGQCTL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 658

Query: 547 LDNTVKVFFLDSMKFFLSL-------YGHKLPVLSIDISFDSKLIITSSADKNIKIWGL- 598
           LD  V+V+  D+      L        GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 659 LDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 718

Query: 599 -----------DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQ 647
                        G C  +   H+D +++V    +     S SKD  V +WD      + 
Sbjct: 719 NVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLL 778

Query: 648 KLAAHQSEVWALAIT------SDGSTVVSSSHDHSMRVWK 681
            L  H++ V ++A+        +     + S D   R+WK
Sbjct: 779 MLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIWK 818

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 116/250 (46%), Gaps = 25/250 (10%)

Query: 453 FDLVTSTLIESIDV------AHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVP 506
           + L    L  SID+       H + +  +  + DG+ L TG  +K+ + +  S + +LV 
Sbjct: 469 YVLFNPALPRSIDLDLHKTLEHTSVVCCVKFSNDGEFLATG-CNKTTQIYRVS-DGELVA 526

Query: 507 GTTDKFVPVMKLIHDTTLELNDD--------ILSVKISPEDKYLAVSLLDNTVKVFFLDS 558
             +D+     K   +   E            I SV  SP+ K+LA    D  ++++ ++ 
Sbjct: 527 RFSDENAHTDKADGNDNAEAETSAGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQ 586

Query: 559 MKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVC 618
            K  + L GH+  + S+D       +++ S D+ ++IW L  G C  +L + +D +  V 
Sbjct: 587 KKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTL-SIEDGVTTVA 645

Query: 619 FLPESHNFFSS-SKDGLVKYWDGDKFECVQKL-------AAHQSEVWALAITSDGSTVVS 670
             P    F ++ S D  V+ WD D    V++L         H+  V+++  T DG+ VVS
Sbjct: 646 VSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVS 705

Query: 671 SSHDHSMRVW 680
            S D S+++W
Sbjct: 706 GSLDRSVKLW 715

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 96/214 (44%), Gaps = 20/214 (9%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSG--TLCVIGTREGQIQLFDLV 456
           +KL++ + +  ++IW+LKT  C  T      +T   +  G       G+ +  ++++D  
Sbjct: 610 DKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSD 669

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNF-SIEQDLVPGTT 509
           T  L+E +D        H  +++S+  T+DG  +V+GS D+S+K WN  ++  +   G  
Sbjct: 670 TGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGK- 728

Query: 510 DKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHK 569
               P       T     D +LSV  + +D+Y+     D  V  +   S    L L GH+
Sbjct: 729 ----PTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHR 784

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDC 603
             V+S+ ++    L        N  I+    GDC
Sbjct: 785 NSVISVAVNHGHPL------GPNYHIFATGSGDC 812

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 105/227 (46%), Gaps = 24/227 (10%)

Query: 34  SNVGQVL-TGALENINLWDIKTGELLSVLSD-----GLPPGSIDVKSSKPAEVT---YLE 84
           SN G+ L TG  +   ++ +  GEL++  SD         G+ + ++   A  T   Y+ 
Sbjct: 500 SNDGEFLATGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETSAGATTDLYIR 559

Query: 85  ---YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDS 141
              +  +   LA G  D +I+IWD+  K +++   GH+  +  L +  +G +L+SGS D 
Sbjct: 560 SVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDR 619

Query: 142 DIIIWDLVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIKLWDLKTQQCVETHI 199
            + IWDL +      L S +D +T +     D  ++ + + D  +++WD  T   VE   
Sbjct: 620 TVRIWDLKTGQCTLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLD 678

Query: 200 AQT--GECWALGVH-------GDLVVTTGTDSQIKIWNLDTSKENGS 237
           ++   G      V+       G+ VV+   D  +K+WNL     N +
Sbjct: 679 SENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNA 725

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 65/142 (45%), Gaps = 18/142 (12%)

Query: 39  VLTGALEN-INLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYA 97
           +  G+L+  + +WD  TG L+  L         ++ +     V  + +  + N + +G  
Sbjct: 654 IAAGSLDRAVRVWDSDTGFLVERLD-----SENELGTGHKDSVYSVVFTRDGNGVVSGSL 708

Query: 98  DGVIKIWDL------------MSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIII 145
           D  +K+W+L             S T  ++++GHK  V  +        ++SGS+D  ++ 
Sbjct: 709 DRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLF 768

Query: 146 WDLVSEVGVFKLRSHKDAITGI 167
           WD VS   +  L+ H++++  +
Sbjct: 769 WDKVSGNPLLMLQGHRNSVISV 790

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/216 (23%), Positives = 99/216 (45%), Gaps = 17/216 (7%)

Query: 466 VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLE 525
           V H+ A++S   + D K L++GS DK+++ W    +  LV                +   
Sbjct: 560 VGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLV----------------SYKG 603

Query: 526 LNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLII 585
            N  +  V  SP   Y A +  D T +++  D +       GH   V  +    +   + 
Sbjct: 604 HNHPVWDVAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVF 663

Query: 586 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFEC 645
           T S+DK  ++W +  G+  +    H   ++++   P+     S S+DGL+  WD    + 
Sbjct: 664 TGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKR 723

Query: 646 VQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
           ++++  H ++ V ++  + +G+ ++S   D+S+RVW
Sbjct: 724 LKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVW 759

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 56/116 (48%)

Query: 565 LYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESH 624
           L GH   V S   S D+KL+I+ S DK +++W +D      S   H   + +V F P  H
Sbjct: 559 LVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDVAFSPMGH 618

Query: 625 NFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
            F ++S D   + W  D    ++  A H S+V  +    +G  V + S D + R+W
Sbjct: 619 YFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMW 674

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 89/229 (38%), Gaps = 17/229 (7%)

Query: 469 NAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTL---- 524
           N  + SLD + D +    G  D  IK W+          +T+      K   D  L    
Sbjct: 488 NREMLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTNNTHFTKKNTADNNLHSKK 547

Query: 525 ----ELNDD---------ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLP 571
                +N +         + S   SP++K L     D TV+++ +D+    +S  GH  P
Sbjct: 548 KHQEHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHP 607

Query: 572 VLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSK 631
           V  +  S       T+S D+  ++W  D     +    H   +  V F P     F+ S 
Sbjct: 608 VWDVAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSS 667

Query: 632 DGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           D   + WD    E V+    H + V +L ++ DG  + S S D  + VW
Sbjct: 668 DKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVW 716

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 66/151 (43%), Gaps = 6/151 (3%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSE 151
            A    D   ++W       L  F+GH S V  + F   G  + +GS D    +WD+ + 
Sbjct: 620 FATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTG 679

Query: 152 VGVFKLRSHKDAIT--GIWCEGEDWLVSTAKDGLIKLWDL---KTQQCVETHIAQTGECW 206
             V     H   +   G+  +G  WL S ++DGLI +WD+   K  + +  H        
Sbjct: 680 ETVRLFLGHTAPVVSLGVSPDGR-WLASGSEDGLINVWDIGSGKRLKQMRGHGRNAVNSI 738

Query: 207 ALGVHGDLVVTTGTDSQIKIWNLDTSKENGS 237
                G ++++ GTD+ +++W++  S    S
Sbjct: 739 VFSQEGTVIISGGTDNSVRVWDMYKSNNESS 769

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 78  AEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSG 137
           ++V  + +H     +  G +D   ++WD+ +   +  F GH + V  L     G  L SG
Sbjct: 648 SDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASG 707

Query: 138 SRDSDIIIWDLVSEVGVFKLRSH-KDAITGIWCEGEDW-LVSTAKDGLIKLWDL 189
           S D  I +WD+ S   + ++R H ++A+  I    E   ++S   D  +++WD+
Sbjct: 708 SEDGLINVWDIGSGKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 94/231 (40%), Gaps = 14/231 (6%)

Query: 3   KSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSVLS 62
           KS ++F+ DS+  V   N + +  P  DS        L   LE   + + +    LS L 
Sbjct: 416 KSGKKFDDDSL--VSKVNKSILEPPLVDSLPLPPKNALNLKLEIQKVKETRECVDLSNLR 473

Query: 63  DGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGV 122
             LP   +    +   E+  L++ D+  L AAG+ D  IKIW L   ++    S + +  
Sbjct: 474 SELPSVCMYTFHNTNREMLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTNNTHF 533

Query: 123 TILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKD 181
           T  K ++    L S  +  + +  +        KL  H  A+    +      L+S ++D
Sbjct: 534 T--KKNTADNNLHSKKKHQEHVNTNT-------KLVGHSGAVYSTSFSPDNKLLISGSED 584

Query: 182 GLIKLWDLKTQQCVETHIAQTGECW--ALGVHGDLVVTTGTDSQIKIWNLD 230
             ++LW + TQ  + ++       W  A    G    T   D   ++W+ D
Sbjct: 585 KTVRLWAMDTQSTLVSYKGHNHPVWDVAFSPMGHYFATASHDQTARLWSCD 635

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/100 (19%), Positives = 48/100 (48%), Gaps = 2/100 (2%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTF--DCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +   +S+   ++W++ T   +R F       ++    P G     G+ +G I ++D+ + 
Sbjct: 662 VFTGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSG 721

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNF 498
             ++ +      A+ S+  +Q+G  +++G  D S++ W+ 
Sbjct: 722 KRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 126/286 (44%), Gaps = 53/286 (18%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+    ++  +   H   ++SLD   +G++LV+G
Sbjct: 389 YIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLK-GHEQDVYSLDYFPNGEKLVSG 447

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL +   + +V +SP D K++A   
Sbjct: 448 SGDRTVRIWDLRTGQCSL-----------------TLSIEYGVTTVAVSPNDGKFIAAGS 490

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GH+  V S+  + D   +++ S DK +K+W 
Sbjct: 491 LDRAVRVW--DSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWN 548

Query: 598 L-----------DFGD----CHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDK 642
           +           D G     C  +   H+D +++V    +     S SKD  + +WD + 
Sbjct: 549 MRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKES 608

Query: 643 FECVQKLAAHQSEVWALAITSDGSTV-------VSSSHDHSMRVWK 681
              +  L  H++ V ++A+ ++GS +        + S D   R+WK
Sbjct: 609 GNPLLMLQGHRNSVISVAV-ANGSALGPKYNVFATGSGDCKARIWK 653

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 109/224 (48%), Gaps = 14/224 (6%)

Query: 468 HNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVP---VMKLIHDTTL 524
           H++ +  +  + DG+ L TG  +K+ + +  S + +L+   +D  V           +T 
Sbjct: 327 HSSVVCCVKFSNDGQFLATG-CNKTTQIYRVS-DGELIAKLSDDSVTSPDTSSATSGSTP 384

Query: 525 ELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLI 584
             +  I SV  SP+ ++LA    D  ++++ +   K  + L GH+  V S+D   + + +
Sbjct: 385 STDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKL 444

Query: 585 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS-SKDGLVKYWDGDKF 643
           ++ S D+ ++IW L  G C  +L + +  +  V   P    F ++ S D  V+ WD    
Sbjct: 445 VSGSGDRTVRIWDLRTGQCSLTL-SIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTG 503

Query: 644 ECVQKL-------AAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
             V++L         H+  V+++  T DG+ VVS S D ++++W
Sbjct: 504 FLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLW 547

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 98/211 (46%), Gaps = 15/211 (7%)

Query: 400 KLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPS--GTLCVIGTREGQIQLFDLVT 457
           KL++ + +  ++IW+L+T  C  T    Y +T   +    G     G+ +  ++++D  T
Sbjct: 443 KLVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTT 502

Query: 458 STLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDK 511
             L+E +D        H  +++S+  T+DG  +V+GS DK++K WN     +    + DK
Sbjct: 503 GFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDK 562

Query: 512 FVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLP 571
                     T +   D +LSV  S +DKY+     D  +  +  +S    L L GH+  
Sbjct: 563 GS-ASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHRNS 621

Query: 572 VLSIDISFDSKL------IITSSADKNIKIW 596
           V+S+ ++  S L        T S D   +IW
Sbjct: 622 VISVAVANGSALGPKYNVFATGSGDCKARIW 652

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 107/229 (46%), Gaps = 19/229 (8%)

Query: 34  SNVGQVL-TGALENINLWDIKTGELLSVLSDGL---PPGSIDVKSSKPAEVTYLE---YH 86
           SN GQ L TG  +   ++ +  GEL++ LSD     P  S     S P+   Y+    + 
Sbjct: 337 SNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVCFS 396

Query: 87  DETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIW 146
            +   LA G  D +I+IWD+  + +++   GH+  V  L +   G +L+SGS D  + IW
Sbjct: 397 PDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIW 456

Query: 147 DLVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIKLWDLKTQQCVETHIAQ--- 201
           DL +      L S +  +T +     D  ++ + + D  +++WD  T   VE   ++   
Sbjct: 457 DLRTGQCSLTL-SIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENEL 515

Query: 202 -TGE-----CWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIVEKGT 244
            TG             G+ VV+   D  +K+WN+  S  + ++  +KG+
Sbjct: 516 GTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGS 564

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 48/112 (42%)

Query: 572 VLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSK 631
           + S+  S D + + T + DK I+IW +        L  H+  + ++ + P      S S 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSG 449

Query: 632 DGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWKET 683
           D  V+ WD    +C   L+            +DG  + + S D ++RVW  T
Sbjct: 450 DRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDST 501

 Score = 39.3 bits (90), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 64/147 (43%), Gaps = 25/147 (17%)

Query: 39  VLTGALEN-INLWDIKTGELLSVL--SDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAG 95
           +  G+L+  + +WD  TG L+  L   + L  G  D        V  + +  + N + +G
Sbjct: 486 IAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRD-------SVYSVVFTRDGNEVVSG 538

Query: 96  YADGVIKIWDL---------------MSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRD 140
             D  +K+W++                S T  +++ GHK  V  +        ++SGS+D
Sbjct: 539 SLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKD 598

Query: 141 SDIIIWDLVSEVGVFKLRSHKDAITGI 167
             I+ WD  S   +  L+ H++++  +
Sbjct: 599 RGILFWDKESGNPLLMLQGHRNSVISV 625

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 119/283 (42%), Gaps = 45/283 (15%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+    ++  +   H   I+SLD    G +LV+G
Sbjct: 438 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 496

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +S  D KY+A   
Sbjct: 497 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSLGDGKYIAAGS 539

Query: 547 LDNTVKV------FFLDSMKFFLSL-YGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 540 LDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLS 599

Query: 600 FGD-------------CHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECV 646
            G              C  +   H+D +++V          S SKD  V +WD      +
Sbjct: 600 SGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGNPL 659

Query: 647 QKLAAHQSEVWALAITSDGS------TVVSSSHDHSMRVWKET 683
             L  H++ V ++A+ +            + S D   R+WK T
Sbjct: 660 LMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIWKYT 702

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 95/212 (44%), Gaps = 17/212 (8%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDC--GYALTCKFLPSGTLCVIGTREGQIQLFDLV 456
           +KL++ + +  ++IW+L+T  C  T     G       L  G     G+ +  ++++D  
Sbjct: 491 DKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAE 550

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           T  L+E +D        H  +++S+  T+DG  +V+GS D+S+K WN S  Q+    T  
Sbjct: 551 TGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQN---NTNA 607

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 570
           +  P       T     D +LSV  +  D+Y+     D  V  +   S    L L GH+ 
Sbjct: 608 ETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRN 667

Query: 571 PVLSIDISFDSKL------IITSSADKNIKIW 596
            V+S+ ++    L        T S D   +IW
Sbjct: 668 SVISVAVANGYPLGPQYCVFATGSGDCKARIW 699

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 81/165 (49%), Gaps = 9/165 (5%)

Query: 530 ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSA 589
           I SV  SP+ K+LA    D  ++++ +   K  + L GH+  + S+D       +++ S 
Sbjct: 439 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 498

Query: 590 DKNIKIWGLDFGDCHKSLFAHQDSIMNVCF-LPESHNFFSSSKDGLVKYWDGDKFECVQK 648
           D+ ++IW L  G C  +L + +D +  V   L +     + S D  V+ WD +    V++
Sbjct: 499 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVER 557

Query: 649 L-------AAHQSEVWALAITSDGSTVVSSSHDHSMRVWKETDDQ 686
           L         H+  V+++  T DG  VVS S D S+++W  +  Q
Sbjct: 558 LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQ 602

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 78/158 (49%), Gaps = 16/158 (10%)

Query: 91  LLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVS 150
            LA G  D +I+IWD+  K +++   GH+  +  L +  +G +L+SGS D  + IWDL +
Sbjct: 450 FLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRT 509

Query: 151 EVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIKLWDLKTQQCVETHIAQ----TGE 204
                 L S +D +T +     D  ++ + + D  +++WD +T   VE   ++    TG 
Sbjct: 510 GQCSLTL-SIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVERLDSENELGTGH 568

Query: 205 -------CWALGVHGDLVVTTGTDSQIKIWNLDTSKEN 235
                   +    HG  VV+   D  +K+WNL + + N
Sbjct: 569 KDSVYSVVFTRDGHG--VVSGSLDRSVKLWNLSSGQNN 604

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 47/111 (42%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS 629
           L + S+  S D K + T + D+ I+IW +        L  H+  I ++ + P      S 
Sbjct: 437 LYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSG 496

Query: 630 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           S D  V+ WD    +C   L+             DG  + + S D ++RVW
Sbjct: 497 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVW 547

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 85/233 (36%), Gaps = 72/233 (30%)

Query: 25  WLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSVLS--DGLPPGSIDVKSSK------ 76
           + PS D   S  G         + +WD++TG+    LS  DG+   ++ +   K      
Sbjct: 486 YFPSGDKLVSGSGD------RTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGS 539

Query: 77  --------PAEVTYL-EYHDETNLLAAGYADGV--------------------IKIWDLM 107
                    AE  +L E  D  N L  G+ D V                    +K+W+L 
Sbjct: 540 LDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLS 599

Query: 108 SK-------------TVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGV 154
           S              T  ++++GHK  V  +        ++SGS+D  ++ WD  S   +
Sbjct: 600 SGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGNPL 659

Query: 155 FKLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWA 207
             L+ H++++  +               +   + L  Q CV      +G+C A
Sbjct: 660 LMLQGHRNSVISV--------------AVANGYPLGPQYCV--FATGSGDCKA 696

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 174 WLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIWNLDT 231
           +L + A+D LI++WD+  ++ V        + ++L     GD +V+   D  ++IW+L T
Sbjct: 450 FLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRT 509

Query: 232 SKENGSKIVEKG 243
            + + +  +E G
Sbjct: 510 GQCSLTLSIEDG 521

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 101/226 (44%), Gaps = 21/226 (9%)

Query: 467 AHNAAIWSLDITQDGKR--LVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTL 524
            HN  + SL  T  G+   LV+ S DK++  W  + +   V      F     ++ D TL
Sbjct: 15  GHNGWVTSL-ATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTL 73

Query: 525 ELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLI 584
                      +P+  Y   +  D T++++ + + + F    GHK  V+S+ I   + +I
Sbjct: 74  -----------TPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMI 122

Query: 585 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLP------ESHNFFSSSKDGLVKYW 638
           I+ S DK+IK+W +  G C  +L  H D +  V   P      E+    S+  D +VK W
Sbjct: 123 ISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAW 181

Query: 639 DGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWKETD 684
           + ++F+       H   V  +  + DGS + S+  D  + +W   D
Sbjct: 182 NLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLAD 227

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/304 (22%), Positives = 125/304 (41%), Gaps = 41/304 (13%)

Query: 399 NKLLASASNGLLKIWNL-----KTKSCIRTFDCGYALT--CKFLPSGTLCVIGTREGQIQ 451
           N L++++ +  L  W L     K    +R+F     +       P G   +  + +  ++
Sbjct: 31  NLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKTLR 90

Query: 452 LFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDK 511
           L+++ T    +   V H + + S+ I +    +++GS DKSIK W     Q L       
Sbjct: 91  LWEVATGETFQRF-VGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIK-GQCLA------ 142

Query: 512 FVPVMKLIHDTTLELNDDILSVKISPEDK------YLAVSLLDNTVKVFFLDSMKFFLSL 565
                     T L  ND +  V+++P DK       +  +  D  VK + L+  +     
Sbjct: 143 ----------TLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADF 192

Query: 566 YGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN 625
            GH   V +I  S D  LI ++  D  I +W L       +L A QD +  + F P  + 
Sbjct: 193 VGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTLNA-QDEVFALAFSPNRYW 251

Query: 626 FFSSSKDGLVKYWDGDKFECVQKL--------AAHQSEVWALAITSDGSTVVSSSHDHSM 677
             +++  G +K +  D    +  L         A +    +L  ++DG T+ +   D+ +
Sbjct: 252 LAAATASG-IKVFSLDPQALIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVI 310

Query: 678 RVWK 681
           RVW+
Sbjct: 311 RVWQ 314

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 63/141 (44%), Gaps = 10/141 (7%)

Query: 98  DGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKL 157
           D  +++W++ +      F GHKS V  +  D   + ++SGSRD  I +W +  +  +  L
Sbjct: 86  DKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKGQC-LATL 144

Query: 158 RSHKDAITGIWCEGED-------WLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV 210
             H D ++ +     D        ++S   D ++K W+L   Q     +   G    +  
Sbjct: 145 LGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITA 204

Query: 211 H--GDLVVTTGTDSQIKIWNL 229
              G L+ + G D +I +WNL
Sbjct: 205 SPDGSLIASAGKDGEIMLWNL 225

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 8/124 (6%)

Query: 564 SLYGHKLPVLSIDISF-DSKLIITSSADKNIKIWGLDFGDCHK------SLFAHQDSIMN 616
           +L GH   V S+  S     L++++S DK +  W L  GD  K      S   H   + +
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLT-GDDQKVGVPVRSFKGHSHIVQD 70

Query: 617 VCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHS 676
           V   P+     S+S D  ++ W+    E  Q+   H+S+V ++AI    S ++S S D S
Sbjct: 71  VTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKS 130

Query: 677 MRVW 680
           ++VW
Sbjct: 131 IKVW 134

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 51/110 (46%), Gaps = 1/110 (0%)

Query: 87  DETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIW 146
           DET  + +   D ++K W+L    +   F GH   V  +     G+ + S  +D +I++W
Sbjct: 164 DETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLW 223

Query: 147 DLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVE 196
           +L  +V ++ L +  +     +     WL +    G IK++ L  Q  ++
Sbjct: 224 NLADKVPMYTLNAQDEVFALAFSPNRYWLAAATASG-IKVFSLDPQALID 272

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 57/126 (45%), Gaps = 11/126 (8%)

Query: 114 SFSGHKSGVTILKFDSTGTRLM-SGSRDSDIIIWDLVSE---VGV----FKLRSHKDAIT 165
           +  GH   VT L   +    L+ S SRD  +I W L  +   VGV    FK  SH     
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDV 71

Query: 166 GIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQ 223
            +  +G  + +S + D  ++LW++ T +  +  +    +  ++ +     ++++   D  
Sbjct: 72  TLTPDGA-YALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKS 130

Query: 224 IKIWNL 229
           IK+W +
Sbjct: 131 IKVWTI 136

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 119/284 (41%), Gaps = 50/284 (17%)

Query: 428 YALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTG 487
           Y  +  F P G     G  +  I+++D+    ++  +   H+  ++SLD    G +LV+G
Sbjct: 385 YIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQ-GHDQDVYSLDYFPSGDKLVSG 443

Query: 488 SADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSL 546
           S D++++ W+    Q  +                 TL + D + +V +SP D K++A   
Sbjct: 444 SGDRTVRIWDLKTGQCSL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 486

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSIDISFDSKLIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 487 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWN 544

Query: 598 L--------------DFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKF 643
           L                  C  +   H+D +++V          S SKD  V +WD    
Sbjct: 545 LRDNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSG 604

Query: 644 ECVQKLAAHQSEVWALAITSDG------STVVSSSHDHSMRVWK 681
             +  L  H++ V ++A+ +            + S D   R+WK
Sbjct: 605 NPLLMLQGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIWK 648

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 81/163 (49%), Gaps = 9/163 (5%)

Query: 530 ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSA 589
           I SV  SP+ K+LA    D  ++++ +   K  + L GH   V S+D       +++ S 
Sbjct: 386 IRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSGSG 445

Query: 590 DKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS-SKDGLVKYWDGDKFECVQK 648
           D+ ++IW L  G C  +L + +D +  V   P    F ++ S D  V+ WD +    V++
Sbjct: 446 DRTVRIWDLKTGQCSLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVER 504

Query: 649 L-------AAHQSEVWALAITSDGSTVVSSSHDHSMRVWKETD 684
           L         H+  V+++  T DG+ VVS S D S+++W   D
Sbjct: 505 LDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLRD 547

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 98/213 (46%), Gaps = 18/213 (8%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFDCGYALTCKFLPSG--TLCVIGTREGQIQLFDLV 456
           +KL++ + +  ++IW+LKT  C  T      +T   +  G       G+ +  ++++D  
Sbjct: 438 DKLVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSE 497

Query: 457 TSTLIESID------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
           T  L+E +D        H  +++S+  T+DG ++V+GS D+S+K WN    +D    ++ 
Sbjct: 498 TGFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNL---RDNNANSSS 554

Query: 511 KFVPVMKLIHDTTLELNDD-ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHK 569
                     D T   + D +LSV  +  D+Y+     D  V  +   S    L L GH+
Sbjct: 555 NNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSGNPLLMLQGHR 614

Query: 570 LPVLSIDISFDSKL------IITSSADKNIKIW 596
             V+S+ ++  + L        T S D   +IW
Sbjct: 615 NSVISVAVANRTPLGPKYQVFATGSGDCRARIW 647

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 105/229 (45%), Gaps = 34/229 (14%)

Query: 34  SNVGQVL-TGALENINLWDIKTGELLSVLSDGLPPGSIDVKSS---KPAEVT-------- 81
           SN G+ L TG  +   ++ + TGEL++ LSD     ++   ++    PA V         
Sbjct: 318 SNDGEYLATGCNKTSQIYKVSTGELIAKLSDDNANSAVSSNNNDQNAPANVNGANANSGN 377

Query: 82  -------YLE---YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTG 131
                  Y+    +  +   LA G  D +I+IWD+  + +++   GH   V  L +  +G
Sbjct: 378 NTNSNDLYIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSG 437

Query: 132 TRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIKLWDL 189
            +L+SGS D  + IWDL +      L S +D +T +     D  ++ + + D  +++WD 
Sbjct: 438 DKLVSGSGDRTVRIWDLKTGQCSLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDS 496

Query: 190 KTQQCVETHIAQT--GECWALGVH-------GDLVVTTGTDSQIKIWNL 229
           +T   VE   ++   G      V+       G+ VV+   D  +K+WNL
Sbjct: 497 ETGFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNL 545

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 46/111 (41%)

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS 629
           L + S+  S D K + T + DK I+IW +        L  H   + ++ + P      S 
Sbjct: 384 LYIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSG 443

Query: 630 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           S D  V+ WD    +C   L+             DG  + + S D ++RVW
Sbjct: 444 SGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW 494

 Score = 39.3 bits (90), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 66/146 (45%), Gaps = 24/146 (16%)

Query: 39  VLTGALEN-INLWDIKTGELLSVL--SDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAG 95
           +  G+L+  + +WD +TG L+  L   + L  G  D        V  + +  + N + +G
Sbjct: 482 IAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKD-------SVYSVVFTKDGNKVVSG 534

Query: 96  YADGVIKIWDL--------------MSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDS 141
             D  +K+W+L               + T  +++ GHK  V  +   +    ++SGS+D 
Sbjct: 535 SLDRSVKLWNLRDNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDR 594

Query: 142 DIIIWDLVSEVGVFKLRSHKDAITGI 167
            ++ WD  S   +  L+ H++++  +
Sbjct: 595 GVLFWDTKSGNPLLMLQGHRNSVISV 620

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 174 WLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIWNLDT 231
           +L + A+D LI++WD++ ++ V        + ++L     GD +V+   D  ++IW+L T
Sbjct: 397 FLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKT 456

Query: 232 SKENGSKIVEKG 243
            + + +  +E G
Sbjct: 457 GQCSLTLSIEDG 468

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 93/211 (44%), Gaps = 18/211 (8%)

Query: 484 LVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLA 543
           L++GS DKS+  W  + +          F     ++ D T           ++P+ +Y  
Sbjct: 33  LLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCT-----------VTPDGEYAL 81

Query: 544 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDC 603
            +  D TV+++ L S K      GHK  VLS+ I   +  I+++S DK +K+W    G+C
Sbjct: 82  SASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNT-LGEC 140

Query: 604 HKSLFAHQDSIMNVCFLP------ESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVW 657
             +L  H D +  V   P      E+    S+  D +VK W+   F+       H + V 
Sbjct: 141 MVTLLGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVN 200

Query: 658 ALAITSDGSTVVSSSHDHSMRVWKETDDQVF 688
            +  + DG+ V S+  D  + +W  T+ +  
Sbjct: 201 TVTASPDGTLVASAGKDGQIMLWNLTEKEAL 231

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 120/263 (45%), Gaps = 32/263 (12%)

Query: 432 CKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADK 491
           C   P G   +  + +  ++L++L +   I+   V H + + S+ I +   ++V+ S DK
Sbjct: 71  CTVTPDGEYALSASWDKTVRLWELASGKCIQRF-VGHKSDVLSVTIDRRASQIVSASRDK 129

Query: 492 SIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKIS----PEDKYLAV--S 545
           ++K WN ++ + +V                T L  ND +  V+++    PED+ + V  +
Sbjct: 130 TVKVWN-TLGECMV----------------TLLGHNDWVSQVRVAPNETPEDETVTVISA 172

Query: 546 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHK 605
            +D  VKV+ L S +      GH   V ++  S D  L+ ++  D  I +W L   +   
Sbjct: 173 GMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALY 232

Query: 606 SLFAHQDSIMNVCFLPESHNFFSSSKDGL-------VKYWDGDKFECVQKLAAHQSEVWA 658
           +L A QD +  V F P  +   +++  G+        K  D  K E      A +    +
Sbjct: 233 TLNA-QDEVFAVAFSPNRYWLTAATSSGIKIFNLEERKVVDELKPEFAGYTKAAEPHAIS 291

Query: 659 LAITSDGSTVVSSSHDHSMRVWK 681
           LA ++DG T+ +   D+ +RVW+
Sbjct: 292 LAWSADGQTLFAGYTDNVIRVWQ 314

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 69/146 (47%), Gaps = 11/146 (7%)

Query: 98  DGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKL 157
           D  +++W+L S   +  F GHKS V  +  D   ++++S SRD  + +W+ + E  V  L
Sbjct: 86  DKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGECMV-TL 144

Query: 158 RSHKDAITGIWCEGED-------WLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGV 210
             H D ++ +     +        ++S   D ++K+W+L + Q     I        +  
Sbjct: 145 LGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTA 204

Query: 211 H--GDLVVTTGTDSQIKIWNLDTSKE 234
              G LV + G D QI +WNL T KE
Sbjct: 205 SPDGTLVASAGKDGQIMLWNL-TEKE 229

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 61/123 (49%), Gaps = 6/123 (4%)

Query: 564 SLYGHKLPVLSIDIS-FDSKLIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMNV 617
           +L GH   V S+  S     L+++ S DK++  W L      +G   +S   H   + + 
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDC 71

Query: 618 CFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSM 677
              P+     S+S D  V+ W+    +C+Q+   H+S+V ++ I    S +VS+S D ++
Sbjct: 72  TVTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTV 131

Query: 678 RVW 680
           +VW
Sbjct: 132 KVW 134

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 55/110 (50%), Gaps = 1/110 (0%)

Query: 87  DETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIW 146
           DET  + +   D V+K+W+L S  +   F GH + V  +     GT + S  +D  I++W
Sbjct: 164 DETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLW 223

Query: 147 DLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVE 196
           +L  +  ++ L +  +     +     WL +    G IK+++L+ ++ V+
Sbjct: 224 NLTEKEALYTLNAQDEVFAVAFSPNRYWLTAATSSG-IKIFNLEERKVVD 272

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 90/204 (44%), Gaps = 24/204 (11%)

Query: 467 AHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLEL 526
            H+  +    +T DG+  ++ S DK+++ W  +  + +      +FV      H +    
Sbjct: 63  GHSHIVQDCTVTPDGEYALSASWDKTVRLWELASGKCI-----QRFVG-----HKS---- 108

Query: 527 NDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISF------D 580
             D+LSV I      +  +  D TVKV+     +  ++L GH   V  + ++       +
Sbjct: 109 --DVLSVTIDRRASQIVSASRDKTVKVWNTLG-ECMVTLLGHNDWVSQVRVAPNETPEDE 165

Query: 581 SKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDG 640
           +  +I++  DK +K+W L           H + +  V   P+     S+ KDG +  W+ 
Sbjct: 166 TVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNL 225

Query: 641 DKFECVQKLAAHQSEVWALAITSD 664
            + E +  L A Q EV+A+A + +
Sbjct: 226 TEKEALYTLNA-QDEVFAVAFSPN 248

 Score = 38.5 bits (88), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 64/156 (41%), Gaps = 15/156 (9%)

Query: 88  ETNLLAAGYADGVIKIWDLMS-----KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSD 142
           + NLL +G  D  +  W L          + SF GH   V        G   +S S D  
Sbjct: 29  QPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKT 88

Query: 143 IIIWDLVSEVGVFKLRSHKDAITGIWCEGE-DWLVSTAKDGLIKLWDLKTQQCVETHIAQ 201
           + +W+L S   + +   HK  +  +  +     +VS ++D  +K+W+    +C+ T +  
Sbjct: 89  VRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWN-TLGECMVTLLGH 147

Query: 202 TGECWALGVHGD--------LVVTTGTDSQIKIWNL 229
                 + V  +         V++ G D  +K+WNL
Sbjct: 148 NDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNL 183

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 113/280 (40%), Gaps = 31/280 (11%)

Query: 434 FLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSI 493
            +    LC  G+  G I++ D  T  +I  I+  H+  I  L        LV+G+ D  +
Sbjct: 194 LMSDNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLV 253

Query: 494 KFWNFSIEQDLVP------GTTDK-----FVPVMKLIHDTTLEL---------------- 526
           K  +F  +  ++       G T +     F P  + +   + ++                
Sbjct: 254 KIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQ 313

Query: 527 ---NDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKL 583
                ++ S+    +   L    LDN   V+ + + K  ++L GH  P+ S+D S D   
Sbjct: 314 EGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYH 373

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPES-HNFFSSSKDGLVKYWDGDK 642
           I T   D  I IW +        L AH + +  V F   + H   S   D  ++ +  D 
Sbjct: 374 IATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDN 433

Query: 643 FECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWKE 682
           +  V+ L  H  ++  + I+ D   +VSS  D S+++WK+
Sbjct: 434 WIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWKQ 473

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 72/159 (45%), Gaps = 8/159 (5%)

Query: 78  AEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSG 137
             V  +++H     +A+   D   ++WD+ S+T L    GH   V  L F + G  L SG
Sbjct: 276 GRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSG 335

Query: 138 SRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVE 196
             D+  I+WD+ +   +  L+ H   I  + W      + +   DG+I +WD++  +  E
Sbjct: 336 GLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIR--KTTE 393

Query: 197 THIAQTGECWALGVH-----GDLVVTTGTDSQIKIWNLD 230
           T           GV      G  +V+ G D QI+I++ D
Sbjct: 394 TTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSD 432

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 98/218 (44%), Gaps = 23/218 (10%)

Query: 384 KGHRTXXXXXXXXXXNKLLASASNGLL-KIWNLKTKSCIRTFDCGYA---LTCKFLPSGT 439
           +GH             + +ASAS  +  ++W++++++ ++ F  G+     +  F   G 
Sbjct: 272 QGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQ-FQEGHGKEVYSLSFQNDGA 330

Query: 440 LCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFS 499
           L   G  +    ++D+ T   I ++   H   I+S+D + DG  + TG  D  I  W+  
Sbjct: 331 LLCSGGLDNAAIVWDVRTGKSIMNLQ-GHAKPIYSVDWSPDGYHIATGGGDGVINIWDIR 389

Query: 500 IEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSL-LDNTVKVFFLDS 558
                      K     +L     L  N+ +  V+      +  VS   D  ++++  D+
Sbjct: 390 -----------KTTETTRL-----LAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDN 433

Query: 559 MKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
                +L GH   +L +DIS D++LI++S  D+++K+W
Sbjct: 434 WIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 71/153 (46%), Gaps = 4/153 (2%)

Query: 79  EVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGS 138
           EV  L + ++  LL +G  D    +WD+ +   +++  GH   +  + +   G  + +G 
Sbjct: 319 EVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGG 378

Query: 139 RDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGE--DWLVSTAKDGLIKLWDLKTQQCVE 196
            D  I IWD+       +L +H + +TG+  +      LVS   D  I+++       V+
Sbjct: 379 GDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVK 438

Query: 197 THIAQTGECWALGVHGD--LVVTTGTDSQIKIW 227
           T    T +   + +  D  L+V++G D  +K+W
Sbjct: 439 TLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 36.2 bits (82), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 83/199 (41%), Gaps = 24/199 (12%)

Query: 46  NINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKI-- 103
           +I + D KT +++S + +G              ++  L ++     L +G  D ++KI  
Sbjct: 209 DIKILDTKTLDVISGIENG-----------HDGKIGGLAWNSTNTHLVSGADDCLVKIHS 257

Query: 104 WDLMSKTV--LLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHK 161
           +D   K +  L +  GH   V  + F  +G  + S S D    +WD+ SE  +     H 
Sbjct: 258 FDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHG 317

Query: 162 DAITGIWCEGEDWLV-STAKDGLIKLWDLKTQQCVETHIAQTGECWAL-----GVHGDLV 215
             +  +  + +  L+ S   D    +WD++T + +          +++     G H   +
Sbjct: 318 KEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYH---I 374

Query: 216 VTTGTDSQIKIWNLDTSKE 234
            T G D  I IW++  + E
Sbjct: 375 ATGGGDGVINIWDIRKTTE 393

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 79.7 bits (195), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 106/245 (43%), Gaps = 13/245 (5%)

Query: 436 PSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKF 495
           P G     G+  G +++    +  ++ S+D AH+  I  +  + D + L TG AD  +K 
Sbjct: 192 PDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKI 251

Query: 496 WNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFF 555
           WN   +      +  +   V+   H+        +  VK  P D+++A +  D T +++ 
Sbjct: 252 WNPQAQ------SHSEASRVVLRGHEAR------VSKVKFHPSDRFVASASFDMTWRLWD 299

Query: 556 LDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
           ++         GH   V  +D   D  L+ ++  D    +W +  G     L  H   I 
Sbjct: 300 VERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIY 359

Query: 616 NVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAIT-SDGSTVVSSSHD 674
            V + P  H+  + S DG V+ WD  K      + AH S V  +     +G+ +VSSS+D
Sbjct: 360 GVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYD 419

Query: 675 HSMRV 679
            ++ V
Sbjct: 420 RTIGV 424

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 72/167 (43%), Gaps = 5/167 (2%)

Query: 519 IHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYG-HKLPVLSIDI 577
           +H + +  +  +  V  SP+   LA    +  VK+    S++   SL G H   +  +  
Sbjct: 174 LHGSQVVFSRPVSQVARSPDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAW 233

Query: 578 SFDSKLIITSSADKNIKIWGLDFGDCHKS----LFAHQDSIMNVCFLPESHNFFSSSKDG 633
           S DS+L+ T  AD  +KIW        ++    L  H+  +  V F P      S+S D 
Sbjct: 234 SSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDM 293

Query: 634 LVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
             + WD ++   +Q    H  EV+ L    DGS + S+  D    VW
Sbjct: 294 TWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVW 340

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/289 (21%), Positives = 127/289 (43%), Gaps = 38/289 (13%)

Query: 320 LMLQPFQIIKS-----TYKIKAVSWTVAANSKIELVVTTSSNTIEYYSIPYEKRLPKNPS 374
           L  Q  ++++S       KI  V+W+  ++S++ L    + N ++ ++       P+  S
Sbjct: 209 LHPQSLEVVRSLDGAHDDKIGGVAWS--SDSQL-LATGGADNLVKIWN-------PQAQS 258

Query: 375 PSKLYTIEQKGHRTXXXXXXXXXXNKLLASASNGLL-KIWNLKTKSCIRTFDCGYA--LT 431
            S+   +  +GH            ++ +ASAS  +  ++W+++ ++ ++    G+A  + 
Sbjct: 259 HSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQ-LQEGHAKEVY 317

Query: 432 C-KFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSAD 490
           C  F   G+L      +    ++D+ T   +  ++  H   I+ +  + +G  + TGS D
Sbjct: 318 CLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLE-GHAKPIYGVSWSPNGHHVATGSGD 376

Query: 491 KSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPED-KYLAVSLLDN 549
            +++ W+                P   L H++       +  V    E+  +L  S  D 
Sbjct: 377 GTVQVWDIRKANK----------PSSILAHNSI------VSEVNFEKENGNFLVSSSYDR 420

Query: 550 TVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGL 598
           T+ VF   S     SL GH   +LS+DIS     + +S  D+++KIW L
Sbjct: 421 TIGVFATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 54/114 (47%), Gaps = 1/114 (0%)

Query: 78  AEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSG 137
           A V+ +++H     +A+   D   ++WD+  +T L    GH   V  L F   G+ L S 
Sbjct: 272 ARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSA 331

Query: 138 SRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLK 190
             DS   +WD+ +   +  L  H   I G+ W      + + + DG +++WD++
Sbjct: 332 GLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIR 385

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 101/230 (43%), Gaps = 27/230 (11%)

Query: 65  LPPGSIDVKSSKPA----EVTYLEYHDETNLLAAGYADGVIKIWDLM----SKTVLLSFS 116
           L P S++V  S       ++  + +  ++ LLA G AD ++KIW+      S+   +   
Sbjct: 209 LHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLR 268

Query: 117 GHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI--WCEGEDW 174
           GH++ V+ +KF  +   + S S D    +WD+  E  +     H   +  +   C+G   
Sbjct: 269 GHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGS-L 327

Query: 175 LVSTAKDGLIKLWDLKTQQ---CVETHIAQT-GECWALGVHGDLVVTTGTDSQIKIWNLD 230
           L S   D +  +WD++T +    +E H     G  W+   +G  V T   D  +++W++ 
Sbjct: 328 LCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWS--PNGHHVATGSGDGTVQVWDIR 385

Query: 231 TSKENGSKIVEKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIF 280
            + +  S +       +        VNF+   +   FL   + D+T+ +F
Sbjct: 386 KANKPSSILAHNSIVSE--------VNFEK--ENGNFLVSSSYDRTIGVF 425

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 63/144 (43%), Gaps = 14/144 (9%)

Query: 48  NLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLM 107
           ++WD++TG  L VL     P            +  + +    + +A G  DG +++WD+ 
Sbjct: 338 HVWDMRTGRSLMVLEGHAKP------------IYGVSWSPNGHHVATGSGDGTVQVWDIR 385

Query: 108 SKTVLLSFSGHKSGVTILKFD-STGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITG 166
                 S   H S V+ + F+   G  L+S S D  I ++   S + +  L+ H D I  
Sbjct: 386 KANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLASLQGHTDKILS 445

Query: 167 I-WCEGEDWLVSTAKDGLIKLWDL 189
           +    G   L S+  D  +K+W L
Sbjct: 446 VDISRGGANLWSSGWDRSVKIWAL 469

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 76/164 (46%), Gaps = 4/164 (2%)

Query: 70  IDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDS 129
           + ++     EV  L++  + +LL +   D V  +WD+ +   L+   GH   +  + +  
Sbjct: 306 LQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSP 365

Query: 130 TGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGE--DWLVSTAKDGLIKLW 187
            G  + +GS D  + +WD+        + +H   ++ +  E E  ++LVS++ D  I ++
Sbjct: 366 NGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVF 425

Query: 188 DLKTQQCVETHIAQTGECWALGVH--GDLVVTTGTDSQIKIWNL 229
              +   + +    T +  ++ +   G  + ++G D  +KIW L
Sbjct: 426 ATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 101/235 (42%), Gaps = 9/235 (3%)

Query: 450 IQLFDLVTSTLIESIDVAHN--AAIWSLDITQDGKRLVTGSADKSIKFW--NFSIEQDLV 505
           IQL +L TS     +   HN    +  ++ + D +    G  D +IK W  + S  Q ++
Sbjct: 477 IQLKNLQTSAPSVCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSIL 536

Query: 506 PGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSL 565
           P           L+  +       + SV  SP+++YL  +  D TV+++ LD+    +  
Sbjct: 537 PSKAKDQSNSATLVGHS-----GPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCY 591

Query: 566 YGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN 625
            GH  PV  +  S      IT+S D+  ++W  D     +    H + +    F P    
Sbjct: 592 KGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCY 651

Query: 626 FFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
            F+ S D   + WD    + V+    H S V AL ++ DG  + + S D ++ VW
Sbjct: 652 VFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVW 706

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 85/188 (45%), Gaps = 18/188 (9%)

Query: 516 MKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKF-------------F 562
           M   H+T    N ++  V+ S + +  A    D+T+KV++LD                  
Sbjct: 491 MYTFHNT----NGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNS 546

Query: 563 LSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPE 622
            +L GH  PV S+  S D++ ++++S DK +++W LD   C      H   +  V F P 
Sbjct: 547 ATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPL 606

Query: 623 SHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWK- 681
            H F ++S D   + W  D    ++  + H ++V       +G  V + S D + R+W  
Sbjct: 607 GHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDI 666

Query: 682 ETDDQVFL 689
           +T D V L
Sbjct: 667 QTGDSVRL 674

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 60/289 (20%), Positives = 124/289 (42%), Gaps = 34/289 (11%)

Query: 410 LKIWNLKTKS---CIRTF-DCGYALTC-KFLPSGTLCVIGTREGQIQLFDLVTSTLIESI 464
           +++ NL+T +   C+ TF +    +TC +F     L   G ++  I+++ L  S L   +
Sbjct: 477 IQLKNLQTSAPSVCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSIL 536

Query: 465 D------------VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKF 512
                        V H+  ++S+  + D + L++ S DK+++ W+            D F
Sbjct: 537 PSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSL-----------DTF 585

Query: 513 VPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPV 572
             ++          N  +  VK SP   Y   +  D T +++  D +       GH   V
Sbjct: 586 TCLVCYKGH-----NHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDV 640

Query: 573 LSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKD 632
                  +   + T S+DK  ++W +  GD  +    H   +  +   P+     + S+D
Sbjct: 641 DCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSED 700

Query: 633 GLVKYWDGDKFECVQKLAAH-QSEVWALAITSDGSTVVSSSHDHSMRVW 680
           G +  WD    + ++++  H ++ ++++    +G+ +V+   D S+RVW
Sbjct: 701 GTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVW 749

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 56/108 (51%), Gaps = 2/108 (1%)

Query: 85  YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDII 144
           +H     +  G +D   ++WD+ +   +  F GH S VT L+    G  L +GS D  II
Sbjct: 645 FHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTII 704

Query: 145 IWDLVSEVGVFKLRSH-KDAITGIWCEGE-DWLVSTAKDGLIKLWDLK 190
           +WD+ +   + +++ H K+ I  I    E + LV+   D  +++WD+K
Sbjct: 705 VWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 92/214 (42%), Gaps = 21/214 (9%)

Query: 78  AEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSG 137
             V  + +  +   L +   D  +++W L + T L+ + GH   V  +KF   G   ++ 
Sbjct: 554 GPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITA 613

Query: 138 SRDSDIIIWDLVSEVGVFKLRSHKDAITGIWC----EGEDWLVSTAKDGLIKLWDLKTQQ 193
           S D    +W   S   ++ LR     +  + C        ++ + + D   ++WD++T  
Sbjct: 614 SHDQTARLW---SCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGD 670

Query: 194 CVETHIAQTGECWALGVHGDLV-VTTGT-DSQIKIWNLDTSKENGSKIVEKGTYEKQSKQ 251
            V   +  T    AL V  D   +TTG+ D  I +W++ T    G +I       KQ K 
Sbjct: 671 SVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGT----GKRI-------KQMKG 719

Query: 252 RGLSVNFKTTAD-ETTFLYIQNSDKTVEIFRIRK 284
            G +  +  T + E   L    +D++V ++ I++
Sbjct: 720 HGKNPIYSITFNKEGNCLVTGGADQSVRVWDIKR 753

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 97/221 (43%), Gaps = 27/221 (12%)

Query: 385 GHRTXXXXXXXXXXNKLLASAS-NGLLKIWNLKTKSCIRTFDCGYALTC---KFLPSGTL 440
           GH            N+ L SAS +  +++W+L T +C+  +  G+       KF P G  
Sbjct: 551 GHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYK-GHNHPVWYVKFSPLGHY 609

Query: 441 CVIGTREGQIQLF--DLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNF 498
            +  + +   +L+  D +    I S    H   +       +G  + TGS+DK+ + W  
Sbjct: 610 FITASHDQTARLWSCDHIYPLRIFS---GHLNDVDCSTFHPNGCYVFTGSSDKTCRMW-- 664

Query: 499 SIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDS 558
               D+  G + +            L     + ++++SP+ ++L     D T+ V+ + +
Sbjct: 665 ----DIQTGDSVRLF----------LGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGT 710

Query: 559 MKFFLSLYGH-KLPVLSIDISFDSKLIITSSADKNIKIWGL 598
            K    + GH K P+ SI  + +   ++T  AD+++++W +
Sbjct: 711 GKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 35.8 bits (81), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 26/135 (19%), Positives = 53/135 (39%), Gaps = 16/135 (11%)

Query: 112 LLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDL----VSEVGVFKLRSHKDAITGI 167
           + +F      +T ++F        +G +DS I +W L    +  +   K +   ++ T +
Sbjct: 491 MYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLV 550

Query: 168 WCEG----------EDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGVH--GDLV 215
              G            +L+S ++D  ++LW L T  C+  +       W +     G   
Sbjct: 551 GHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYF 610

Query: 216 VTTGTDSQIKIWNLD 230
           +T   D   ++W+ D
Sbjct: 611 ITASHDQTARLWSCD 625

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 95/208 (45%), Gaps = 4/208 (1%)

Query: 474 SLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSV 533
           SLD + D     TG  D  IK W  S+E   +      +  +   I  T +  +D + SV
Sbjct: 710 SLDFSSDYTLAATGFQDSYIKIW--SLEGTSINENEQNYSQINS-IFKTLVGHSDAVYSV 766

Query: 534 KISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDIS-FDSKLIITSSADKN 592
             SP +++L     D T +++  D+ K  +S  GH+ P+  ++ S   + L  T+S+D  
Sbjct: 767 NFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATASSDNT 826

Query: 593 IKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAH 652
            ++W  D     + L  H   +  V F P     F+ S D   + WD    + V+    H
Sbjct: 827 ARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGH 886

Query: 653 QSEVWALAITSDGSTVVSSSHDHSMRVW 680
            S V A A++ DG  + +++ D ++ VW
Sbjct: 887 SSAVTATAVSPDGRWLSTANEDGTITVW 914

 Score = 78.6 bits (192), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 117/256 (45%), Gaps = 30/256 (11%)

Query: 439 TLCVIGTREGQIQLFDLVTSTLIESID------------VAHNAAIWSLDITQDGKRLVT 486
           TL   G ++  I+++ L  +++ E+              V H+ A++S++ +   + L++
Sbjct: 718 TLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHSDAVYSVNFSPCNRFLLS 777

Query: 487 GSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYL-AVS 545
           GS DK+ + W+    + LV      +    K I D           V  SP    L A +
Sbjct: 778 GSGDKTARLWSTDTYKGLV-----SYKGHEKPIWD-----------VNFSPTGNNLFATA 821

Query: 546 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHK 605
             DNT +V+  D +     L GH   V  +    + + + T S+DK  ++W L  GD  +
Sbjct: 822 SSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVR 881

Query: 606 SLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAH-QSEVWALAITSD 664
               H  ++      P+     ++++DG +  WD    + ++ +  H ++ +++L+    
Sbjct: 882 LFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKKLKSMRGHGKNSIYSLSYNKT 941

Query: 665 GSTVVSSSHDHSMRVW 680
           G+ +VSS  D+S+RVW
Sbjct: 942 GNILVSSGADNSVRVW 957

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 66/145 (45%), Gaps = 4/145 (2%)

Query: 89  TNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDL 148
            NL A   +D   ++W       +   +GH S V  + F   G  + +GS D    +WDL
Sbjct: 815 NNLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDL 874

Query: 149 VSEVGVFKLRSHKDAITGIWCEGED-WLVSTAKDGLIKLWDL---KTQQCVETHIAQTGE 204
            S   V     H  A+T      +  WL +  +DG I +WD+   K  + +  H   +  
Sbjct: 875 SSGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKKLKSMRGHGKNSIY 934

Query: 205 CWALGVHGDLVVTTGTDSQIKIWNL 229
             +    G+++V++G D+ +++W++
Sbjct: 935 SLSYNKTGNILVSSGADNSVRVWDI 959

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 2/115 (1%)

Query: 78  AEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSG 137
           ++V  + +H     +  G +D   ++WDL S   +  F GH S VT       G  L + 
Sbjct: 846 SDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLSTA 905

Query: 138 SRDSDIIIWDLVSEVGVFKLRSH-KDAITGI-WCEGEDWLVSTAKDGLIKLWDLK 190
           + D  I +WD+ S   +  +R H K++I  + + +  + LVS+  D  +++WD+K
Sbjct: 906 NEDGTITVWDIGSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWDIK 960

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 74/185 (40%), Gaps = 19/185 (10%)

Query: 65  LPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMS-------------KTV 111
           LP  S+   ++    ++ L++  +  L A G+ D  IKIW L                ++
Sbjct: 693 LPSVSMYTYTNTEKNMSSLDFSSDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSI 752

Query: 112 LLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAI--TGIWC 169
             +  GH   V  + F      L+SGS D    +W   +  G+   + H+  I       
Sbjct: 753 FKTLVGHSDAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSP 812

Query: 170 EGEDWLVSTAKDGLIKLWD---LKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKI 226
            G +   + + D   ++W    +   + +  H++   +C +   +G  V T  +D   ++
Sbjct: 813 TGNNLFATASSDNTARVWSCDRVYPVRILAGHLSDV-DCVSFHPNGQYVFTGSSDKTSRM 871

Query: 227 WNLDT 231
           W+L +
Sbjct: 872 WDLSS 876

>SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 aa]
           {ON} similar to uniprot|P41811 Saccharomyces cerevisiae
           YGL137W SEC27 Involved in beta'-subunit of yeast
           coatomer
          Length = 878

 Score = 78.6 bits (192), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 131/294 (44%), Gaps = 25/294 (8%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTFDCG--YALTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +L++  +G ++IWN +T++ +R+ +         +F+      V+G+ + +I++F+  T 
Sbjct: 28  VLSTLYSGRVEIWNYETQTEVRSIEVTDTPVRAGRFIARKNWIVVGSDDFKIRVFNYNTG 87

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKL 518
             +   +  H   I S+ +      +++ S D +IK WN+     L              
Sbjct: 88  EKVTDFE-GHPDYIRSIAVHPTRPYVLSASDDMTIKLWNWEKNWAL-------------- 132

Query: 519 IHDTTLELNDD-ILSVKISPED-KYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 576
             + T E ++  ++ V  +P+D    A + LD+TVK++ L       ++  H+   ++  
Sbjct: 133 --EQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFV 190

Query: 577 ISF---DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDG 633
             +   D   +ITSS D+++KIW      C  +L  H  ++    F P      S S+DG
Sbjct: 191 DYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPSLPIIISGSEDG 250

Query: 634 LVKYWDGDKFECVQKLAAHQSEVWALAITSDG-STVVSSSHDHSMRVWKETDDQ 686
            VK W+ + ++  + L       W +A    G    V+S  D+   V    +D+
Sbjct: 251 TVKIWNANTYKLEKTLNLGLERSWCVAAHPTGKRNYVASGFDNGFNVLSMGNDE 304

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 76/168 (45%), Gaps = 14/168 (8%)

Query: 77  PAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVL-LSFSGHKSGVTILKFDSTGTR-L 134
           P  +  +  H     + +   D  IK+W+      L  +F GH+  V  + F+       
Sbjct: 97  PDYIRSIAVHPTRPYVLSASDDMTIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTF 156

Query: 135 MSGSRDSDIIIWDLVSEVGVFKLRSHK----DAITGIWCEGEDWLVSTAKDGLIKLWDLK 190
            S   D  + IW L  +   F + +H+    + +     + + +L++++ D  +K+WD +
Sbjct: 157 ASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQ 216

Query: 191 TQQCV---ETHIAQTGECWALGVHGDL--VVTTGTDSQIKIWNLDTSK 233
           T+ CV   E H+A     +A+  H  L  +++   D  +KIWN +T K
Sbjct: 217 TKSCVATLEGHMANV--SYAI-FHPSLPIIISGSEDGTVKIWNANTYK 261

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 68/156 (43%), Gaps = 2/156 (1%)

Query: 527 NDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIIT 586
           +D +  + + P + ++  +L    V+++  ++     S+     PV +         I+ 
Sbjct: 13  SDRVKGIDLHPTEPWVLSTLYSGRVEIWNYETQTEVRSIEVTDTPVRAGRFIARKNWIVV 72

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDK-FEC 645
            S D  I+++  + G+       H D I ++   P      S+S D  +K W+ +K +  
Sbjct: 73  GSDDFKIRVFNYNTGEKVTDFEGHPDYIRSIAVHPTRPYVLSASDDMTIKLWNWEKNWAL 132

Query: 646 VQKLAAHQSEVWALAITS-DGSTVVSSSHDHSMRVW 680
            Q    H+  V  +A    D +T  S+  DH++++W
Sbjct: 133 EQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIW 168

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 4/128 (3%)

Query: 88  ETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS-GVTILKFDSTGTR--LMSGSRDSDII 144
           + N  A+   D  +KIW L  ++   + + H++ GV  + +     +  L++ S D  + 
Sbjct: 152 DPNTFASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVK 211

Query: 145 IWDLVSEVGVFKLRSHKDAIT-GIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTG 203
           IWD  ++  V  L  H   ++  I+      ++S ++DG +K+W+  T +  +T      
Sbjct: 212 IWDYQTKSCVATLEGHMANVSYAIFHPSLPIIISGSEDGTVKIWNANTYKLEKTLNLGLE 271

Query: 204 ECWALGVH 211
             W +  H
Sbjct: 272 RSWCVAAH 279

>KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 aa]
           {ON} similar to uniprot|P41811 Saccharomyces cerevisiae
           YGL137W SEC27 Involved in beta'-subunit of yeast
           coatomer
          Length = 875

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 67/287 (23%), Positives = 128/287 (44%), Gaps = 25/287 (8%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTFDCGYA--LTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +L +  +G ++IWN +T++ +++           KF+      V+G+ + +I++F+  T 
Sbjct: 28  VLTTLYSGRVEIWNFETQTEVKSITVTETPVRAGKFIARKNWIVVGSDDFKIRVFNYNTG 87

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKL 518
             I   + AH   I S+ +      +++ S D ++KFWN+     L              
Sbjct: 88  EKIADFE-AHPDYIRSIAVHPTRPYVLSASDDLTMKFWNWEKNWSL-------------- 132

Query: 519 IHDTTLELNDD-ILSVKISPEDK-YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 576
             + T E ++  ++ V  +P+D    A + LD+TVK++ L       +L+ H+   ++  
Sbjct: 133 --EQTFEGHEHFVMGVAFNPKDPSTFASACLDHTVKIWSLGQPTANFTLHAHETRGVNYV 190

Query: 577 ISF---DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDG 633
             +   D   +ITSS D+ +KIW      C  +L  H  ++    F P      S S+DG
Sbjct: 191 DYYPLQDKPYLITSSDDRTVKIWDYQTKSCVATLEGHMANVSFAVFHPALPIIISGSEDG 250

Query: 634 LVKYWDGDKFECVQKLAAHQSEVWALAITSDGS-TVVSSSHDHSMRV 679
            +K W+ + ++  + L       W +A    G    V+S  D+   V
Sbjct: 251 TLKVWNSNTYKLEKTLNLGLERSWCIATHPTGKRNYVASGFDNGFTV 297

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 70/156 (44%), Gaps = 2/156 (1%)

Query: 527 NDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIIT 586
           +D +  +   P + ++  +L    V+++  ++     S+   + PV +         I+ 
Sbjct: 13  SDRVKGIDFHPTEPWVLTTLYSGRVEIWNFETQTEVKSITVTETPVRAGKFIARKNWIVV 72

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDK-FEC 645
            S D  I+++  + G+      AH D I ++   P      S+S D  +K+W+ +K +  
Sbjct: 73  GSDDFKIRVFNYNTGEKIADFEAHPDYIRSIAVHPTRPYVLSASDDLTMKFWNWEKNWSL 132

Query: 646 VQKLAAHQSEVWALAITS-DGSTVVSSSHDHSMRVW 680
            Q    H+  V  +A    D ST  S+  DH++++W
Sbjct: 133 EQTFEGHEHFVMGVAFNPKDPSTFASACLDHTVKIW 168

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 70/167 (41%), Gaps = 8/167 (4%)

Query: 75  SKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVL-LSFSGHKSGVTILKFDSTG-T 132
           + P  +  +  H     + +   D  +K W+      L  +F GH+  V  + F+    +
Sbjct: 95  AHPDYIRSIAVHPTRPYVLSASDDLTMKFWNWEKNWSLEQTFEGHEHFVMGVAFNPKDPS 154

Query: 133 RLMSGSRDSDIIIWDLVSEVGVFKLRSHK----DAITGIWCEGEDWLVSTAKDGLIKLWD 188
              S   D  + IW L      F L +H+    + +     + + +L++++ D  +K+WD
Sbjct: 155 TFASACLDHTVKIWSLGQPTANFTLHAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWD 214

Query: 189 LKTQQCVETHIAQTGECWALGVHGDL--VVTTGTDSQIKIWNLDTSK 233
            +T+ CV T             H  L  +++   D  +K+WN +T K
Sbjct: 215 YQTKSCVATLEGHMANVSFAVFHPALPIIISGSEDGTLKVWNSNTYK 261

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 58  LSVLSDGLPPGSIDVKSSKPAEVTYLEYH--DETNLLAAGYADGVIKIWDLMSKTVLLSF 115
           + + S G P  +  + + +   V Y++Y+   +   L     D  +KIWD  +K+ + + 
Sbjct: 165 VKIWSLGQPTANFTLHAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTKSCVATL 224

Query: 116 SGHKSGVTILKFDSTGTRLMSGSRDSDIIIWD 147
            GH + V+   F      ++SGS D  + +W+
Sbjct: 225 EGHMANVSFAVFHPALPIIISGSEDGTLKVWN 256

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 55/124 (44%), Gaps = 4/124 (3%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFSGHKS-GVTILKFDSTGTR--LMSGSRDSDIIIWDL 148
            A+   D  +KIW L   T   +   H++ GV  + +     +  L++ S D  + IWD 
Sbjct: 156 FASACLDHTVKIWSLGQPTANFTLHAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDY 215

Query: 149 VSEVGVFKLRSHKDAIT-GIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWA 207
            ++  V  L  H   ++  ++      ++S ++DG +K+W+  T +  +T        W 
Sbjct: 216 QTKSCVATLEGHMANVSFAVFHPALPIIISGSEDGTLKVWNSNTYKLEKTLNLGLERSWC 275

Query: 208 LGVH 211
           +  H
Sbjct: 276 IATH 279

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 46/224 (20%), Positives = 93/224 (41%), Gaps = 26/224 (11%)

Query: 70  IDVK---SSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILK 126
           +D+K   S++   V  +++H     +      G ++IW+  ++T + S +  ++ V   K
Sbjct: 3   LDIKKAFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNFETQTEVKSITVTETPVRAGK 62

Query: 127 FDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGL-IK 185
           F +    ++ GS D  I +++  +   +    +H D I  I        V +A D L +K
Sbjct: 63  FIARKNWIVVGSDDFKIRVFNYNTGEKIADFEAHPDYIRSIAVHPTRPYVLSASDDLTMK 122

Query: 186 LWDLKT----QQCVETHIAQTGECWALGVHGD-----LVVTTGTDSQIKIWNLDTSKENG 236
            W+ +     +Q  E H     E + +GV  +        +   D  +KIW+L     N 
Sbjct: 123 FWNWEKNWSLEQTFEGH-----EHFVMGVAFNPKDPSTFASACLDHTVKIWSLGQPTANF 177

Query: 237 SKIVEKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIF 280
           +            + RG++        +  +L   + D+TV+I+
Sbjct: 178 TL--------HAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIW 213

>Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar to
           Ashbya gossypii AEL269C
          Length = 465

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 106/244 (43%), Gaps = 23/244 (9%)

Query: 399 NKLLASASNGLLKIWNLKTKSCIRTFD-CGYALTCKFLPSGTLCVIGTREGQIQLFDLVT 457
           N LL+  ++ L+KI NL   SC    D  G     KF PSG      + +    L+DL  
Sbjct: 237 NSLLSGGADNLVKITNLDQGSCAELKDHVGRVCKVKFHPSGKFAASASFDMTWILWDLEK 296

Query: 458 STLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMK 517
           +  I+ +   H+  +++L    DG  L +G  D     W      DL  G      P+M 
Sbjct: 297 ALAIQ-LQEGHSREVFTLGFQTDGSLLASGGLDSIGLIW------DLRSGE-----PIMN 344

Query: 518 LIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDI 577
           L+          I  +  SP    +A +  D ++K++ L       +L  H+   ++ DI
Sbjct: 345 LVGHQK-----PIYGLDWSPNGYQVATASGDGSIKIWDLRKQSIVSTLLAHR--NVAFDI 397

Query: 578 SFD---SKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGL 634
            FD      +++   D+ +KI+  D  +  K+L  H D I++V  + +   FFS+  D  
Sbjct: 398 KFDKANGHFLVSGGYDRELKIFNADNWELIKTLEGHTDKILSVDLVSDGSKFFSTGWDRT 457

Query: 635 VKYW 638
           VK W
Sbjct: 458 VKQW 461

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 127/303 (41%), Gaps = 40/303 (13%)

Query: 414 NLKTKSCIRTFDCGYALTCKFLPSGTLCVI--------GTREGQIQLFDLVTSTLIESID 465
           NL  K  +RT +   +      P   +CV         G   G I++ +  T  +++S D
Sbjct: 163 NLNKK--LRTLELAGSQLVAEKPVSEVCVSKDDVYVASGNWGGHIKVLNSDTLDIVKSFD 220

Query: 466 VAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD--------KFVPVMK 517
             H+  +  LD       L++G AD  +K  N  ++Q       D        KF P  K
Sbjct: 221 NVHSGKVCGLDWHPTANSLLSGGADNLVKITN--LDQGSCAELKDHVGRVCKVKFHPSGK 278

Query: 518 LIHDTTLEL-------------------NDDILSVKISPEDKYLAVSLLDNTVKVFFLDS 558
                + ++                   + ++ ++    +   LA   LD+   ++ L S
Sbjct: 279 FAASASFDMTWILWDLEKALAIQLQEGHSREVFTLGFQTDGSLLASGGLDSIGLIWDLRS 338

Query: 559 MKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVC 618
            +  ++L GH+ P+  +D S +   + T+S D +IKIW L       +L AH++   ++ 
Sbjct: 339 GEPIMNLVGHQKPIYGLDWSPNGYQVATASGDGSIKIWDLRKQSIVSTLLAHRNVAFDIK 398

Query: 619 F-LPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSM 677
           F     H   S   D  +K ++ D +E ++ L  H  ++ ++ + SDGS   S+  D ++
Sbjct: 399 FDKANGHFLVSGGYDRELKIFNADNWELIKTLEGHTDKILSVDLVSDGSKFFSTGWDRTV 458

Query: 678 RVW 680
           + W
Sbjct: 459 KQW 461

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 98/235 (41%), Gaps = 30/235 (12%)

Query: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60
           +VKS+       V G+        W P+++S       +L+G  +N+            V
Sbjct: 215 IVKSFDNVHSGKVCGLD-------WHPTANS-------LLSGGADNL------------V 248

Query: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120
               L  GS          V  +++H      A+   D    +WDL     +    GH  
Sbjct: 249 KITNLDQGSCAELKDHVGRVCKVKFHPSGKFAASASFDMTWILWDLEKALAIQLQEGHSR 308

Query: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTA 179
            V  L F + G+ L SG  DS  +IWDL S   +  L  H+  I G+ W      + + +
Sbjct: 309 EVFTLGFQTDGSLLASGGLDSIGLIWDLRSGEPIMNLVGHQKPIYGLDWSPNGYQVATAS 368

Query: 180 KDGLIKLWDLKTQQCVETHIAQTGECWAL---GVHGDLVVTTGTDSQIKIWNLDT 231
            DG IK+WDL+ Q  V T +A     + +     +G  +V+ G D ++KI+N D 
Sbjct: 369 GDGSIKIWDLRKQSIVSTLLAHRNVAFDIKFDKANGHFLVSGGYDRELKIFNADN 423

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 81/167 (48%), Gaps = 4/167 (2%)

Query: 69  SIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFD 128
           +I ++     EV  L +  + +LLA+G  D +  IWDL S   +++  GH+  +  L + 
Sbjct: 299 AIQLQEGHSREVFTLGFQTDGSLLASGGLDSIGLIWDLRSGEPIMNLVGHQKPIYGLDWS 358

Query: 129 STGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGED--WLVSTAKDGLIKL 186
             G ++ + S D  I IWDL  +  V  L +H++    I  +  +  +LVS   D  +K+
Sbjct: 359 PNGYQVATASGDGSIKIWDLRKQSIVSTLLAHRNVAFDIKFDKANGHFLVSGGYDRELKI 418

Query: 187 WDLKTQQCVETHIAQTGECWALGV--HGDLVVTTGTDSQIKIWNLDT 231
           ++    + ++T    T +  ++ +   G    +TG D  +K W L +
Sbjct: 419 FNADNWELIKTLEGHTDKILSVDLVSDGSKFFSTGWDRTVKQWTLSS 465

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 89/209 (42%), Gaps = 33/209 (15%)

Query: 400 KLLASASNGLLKI-WNLKTKSCIR--------TFDCGYALTCKFLPSGTLCVIGTREGQI 450
           K  ASAS  +  I W+L+    I+         F  G+      L SG L  IG      
Sbjct: 278 KFAASASFDMTWILWDLEKALAIQLQEGHSREVFTLGFQTDGSLLASGGLDSIGL----- 332

Query: 451 QLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTD 510
            ++DL +   I ++ V H   I+ LD + +G ++ T S D SIK W+   +Q +V     
Sbjct: 333 -IWDLRSGEPIMNL-VGHQKPIYGLDWSPNGYQVATASGDGSIKIWDLR-KQSIVS---- 385

Query: 511 KFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSL-LDNTVKVFFLDSMKFFLSLYGHK 569
                      T L   +    +K    + +  VS   D  +K+F  D+ +   +L GH 
Sbjct: 386 -----------TLLAHRNVAFDIKFDKANGHFLVSGGYDRELKIFNADNWELIKTLEGHT 434

Query: 570 LPVLSIDISFDSKLIITSSADKNIKIWGL 598
             +LS+D+  D     ++  D+ +K W L
Sbjct: 435 DKILSVDLVSDGSKFFSTGWDRTVKQWTL 463

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 54/103 (52%), Gaps = 4/103 (3%)

Query: 400 KLLASASNGLLKIWNLKTKSCIRTF--DCGYALTCKF-LPSGTLCVIGTREGQIQLFDLV 456
           ++  ++ +G +KIW+L+ +S + T       A   KF   +G   V G  + ++++F+  
Sbjct: 363 QVATASGDGSIKIWDLRKQSIVSTLLAHRNVAFDIKFDKANGHFLVSGGYDRELKIFNAD 422

Query: 457 TSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFS 499
              LI++++  H   I S+D+  DG +  +   D+++K W  S
Sbjct: 423 NWELIKTLE-GHTDKILSVDLVSDGSKFFSTGWDRTVKQWTLS 464

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 109/246 (44%), Gaps = 17/246 (6%)

Query: 436 PSGTLCVIGTREGQIQLFDLVTSTLIESIDV-AHNAAIWSLDITQDGKRLVTGSADKSIK 494
           P+G L   G  EG ++LF   ++TL E   +  H   +        G+ + + S D + +
Sbjct: 233 PTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRFIASASFDMTWR 292

Query: 495 FWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVF 554
            W+   +++L+          ++  H        ++ S+    +   +    +D    V+
Sbjct: 293 LWDVETQEELL----------LQEGH------GKELYSLGFQCDGSLVCSGGIDCKGLVW 336

Query: 555 FLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSI 614
            + S K  +SL GH  P+ S+D S +   + T S D  I+IW L   + ++++ AH+  +
Sbjct: 337 DIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAHKSIV 396

Query: 615 MNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHD 674
             V F    +   SS  D  +  +    +  +  L  H  ++  + I+ + S+VVS   D
Sbjct: 397 TKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDISENASSVVSCGWD 456

Query: 675 HSMRVW 680
            S+++W
Sbjct: 457 RSVKLW 462

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/245 (21%), Positives = 106/245 (43%), Gaps = 14/245 (5%)

Query: 436 PSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKF 495
           P+G+L    +  G + + +  T  ++++    H   I  +  +  G  +  G  + S+K 
Sbjct: 190 PNGSLVAAASWAGDLTILNSQTLEILQNKPQIHMGKIGGIHWSPTGDLITAGGEEGSVKL 249

Query: 496 WNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFF 555
           +          G     +  M  ++     + D     K  P  +++A +  D T +++ 
Sbjct: 250 F----------GYKSNTLEEMATLNGHENRVTDS----KFHPSGRFIASASFDMTWRLWD 295

Query: 556 LDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
           +++ +  L   GH   + S+    D  L+ +   D    +W +  G    SL  H   I 
Sbjct: 296 VETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKGLVWDIRSGKRAMSLSGHTKPIY 355

Query: 616 NVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDH 675
           ++ + P  +   + S DG ++ WD  K E  Q + AH+S V  +A   +G+ +VSS +D 
Sbjct: 356 SLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAHKSIVTKVAFEKNGNCLVSSGYDK 415

Query: 676 SMRVW 680
           S+ ++
Sbjct: 416 SINLY 420

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 70/152 (46%), Gaps = 3/152 (1%)

Query: 80  VTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSR 139
           VT  ++H     +A+   D   ++WD+ ++  LL   GH   +  L F   G+ + SG  
Sbjct: 270 VTDSKFHPSGRFIASASFDMTWRLWDVETQEELLLQEGHGKELYSLGFQCDGSLVCSGGI 329

Query: 140 DSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVETH 198
           D   ++WD+ S      L  H   I  + W      + + + DG I++WDL+  +  +T 
Sbjct: 330 DCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTI 389

Query: 199 IAQTGECW--ALGVHGDLVVTTGTDSQIKIWN 228
           +A        A   +G+ +V++G D  I ++ 
Sbjct: 390 LAHKSIVTKVAFEKNGNCLVSSGYDKSINLYG 421

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 81/184 (44%), Gaps = 15/184 (8%)

Query: 49  LWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMS 108
           LWD++T E L +L +G              E+  L +  + +L+ +G  D    +WD+ S
Sbjct: 293 LWDVETQEEL-LLQEG-----------HGKELYSLGFQCDGSLVCSGGIDCKGLVWDIRS 340

Query: 109 KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIW 168
               +S SGH   +  L +   G ++ +GS D  I IWDL        + +HK  +T + 
Sbjct: 341 GKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAHKSIVTKVA 400

Query: 169 CE-GEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGE--CWALGVHGDLVVTTGTDSQIK 225
            E   + LVS+  D  I L+       + T      +  C  +  +   VV+ G D  +K
Sbjct: 401 FEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDISENASSVVSCGWDRSVK 460

Query: 226 IWNL 229
           +W +
Sbjct: 461 LWTM 464

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 97/211 (45%), Gaps = 11/211 (5%)

Query: 69  SIDVKSSKP----AEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTV--LLSFSGHKSGV 122
           ++++  +KP     ++  + +    +L+ AG  +G +K++   S T+  + + +GH++ V
Sbjct: 211 TLEILQNKPQIHMGKIGGIHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRV 270

Query: 123 TILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAI--TGIWCEGEDWLVSTAK 180
           T  KF  +G  + S S D    +WD+ ++  +     H   +   G  C+G   + S   
Sbjct: 271 TDSKFHPSGRFIASASFDMTWRLWDVETQEELLLQEGHGKELYSLGFQCDG-SLVCSGGI 329

Query: 181 DGLIKLWDLKTQQCVETHIAQTGECWAL--GVHGDLVVTTGTDSQIKIWNLDTSKENGSK 238
           D    +WD+++ +   +    T   ++L    +G  V T   D  I+IW+L   +E  + 
Sbjct: 330 DCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTI 389

Query: 239 IVEKGTYEKQSKQRGLSVNFKTTADETTFLY 269
           +  K    K + ++  +    +  D++  LY
Sbjct: 390 LAHKSIVTKVAFEKNGNCLVSSGYDKSINLY 420

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 101/222 (45%), Gaps = 22/222 (9%)

Query: 467 AHNAAIWSLDITQDGKR--LVTGSADKSIKFWNFSIEQDLVPGTTDKF-VPVMKLIHDTT 523
            HN  + SL  T  G+   L++GS DK++  W  +       G   KF VPV      + 
Sbjct: 15  GHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKLT-------GDDQKFGVPVRSFKGHSH 66

Query: 524 LELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKL 583
           +     +    ++ +  Y   +  D T++++ + + + +    GHK  V+S+ I   + +
Sbjct: 67  I-----VQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASM 121

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN-----FFSSSKDGLVKYW 638
           II+ S DK IK+W +  G C  +L  H D +  V   P   N       S+  D +VK W
Sbjct: 122 IISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAW 180

Query: 639 DGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           + ++F+       H   V A+  + DG+ + S+  D  + +W
Sbjct: 181 NLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLW 222

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 71/164 (43%), Gaps = 26/164 (15%)

Query: 86  HDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIII 145
            D    L+A + D  +++WD+ +      F GHKS V  +  D   + ++SGSRD  I +
Sbjct: 75  QDGAYALSASW-DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKV 133

Query: 146 W--------------DLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKT 191
           W              D VS+V +     + DA+T         ++S   D ++K W+L  
Sbjct: 134 WTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVT---------VISAGNDKMVKAWNLNQ 184

Query: 192 QQCVETHIAQTGECWALGVH--GDLVVTTGTDSQIKIWNLDTSK 233
            Q     +   G   A+     G L+ + G D +I +WNL   K
Sbjct: 185 FQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKK 228

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 114/262 (43%), Gaps = 31/262 (11%)

Query: 432 CKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADK 491
           C     G   +  + +  ++L+D+ T    +   V H + + S+ I +    +++GS DK
Sbjct: 71  CTLTQDGAYALSASWDKTLRLWDVATGETYQRF-VGHKSDVMSVAIDRKASMIISGSRDK 129

Query: 492 SIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKY-LAVSLL--- 547
           +IK W  +I+   +                T L  ND +  V+I+P D+   AV+++   
Sbjct: 130 TIKVW--TIKGQCLA---------------TLLGHNDWVSQVRIAPTDQNDDAVTVISAG 172

Query: 548 -DNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKS 606
            D  VK + L+  +      GH   V ++  S D  LI ++  D  I +W L       +
Sbjct: 173 NDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYT 232

Query: 607 LFAHQDSIMNVCFLPESHNFFSSSKDGLVKYW-------DGDKFECVQKLAAHQSEVWAL 659
           L A QD + ++ F P  +   +++  G+  +        D  + E      + +    +L
Sbjct: 233 LSA-QDEVFSLAFSPNRYWLAAATASGIKIFCLDPQSLIDDLRPEFAGYNKSAEPHAVSL 291

Query: 660 AITSDGSTVVSSSHDHSMRVWK 681
           A ++DG T+ +   D  +RVW+
Sbjct: 292 AWSADGQTLFAGYTDSVIRVWQ 313

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 93/203 (45%), Gaps = 23/203 (11%)

Query: 467 AHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLEL 526
            H+  +    +TQDG   ++ S DK+++ W+ +  +     T  +FV      H +    
Sbjct: 63  GHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGE-----TYQRFVG-----HKS---- 108

Query: 527 NDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGH-----KLPVLSIDISFDS 581
             D++SV I  +   +     D T+KV+ +   +   +L GH     ++ +   D + D+
Sbjct: 109 --DVMSVAIDRKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRIAPTDQNDDA 165

Query: 582 KLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGD 641
             +I++  DK +K W L+          H  ++  V   P+     S+ KDG +  W+  
Sbjct: 166 VTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLA 225

Query: 642 KFECVQKLAAHQSEVWALAITSD 664
           + + +  L+A Q EV++LA + +
Sbjct: 226 EKKAMYTLSA-QDEVFSLAFSPN 247

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 63/139 (45%), Gaps = 9/139 (6%)

Query: 557 DSMKFFL---SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDS 613
           D  KF +   S  GH   V    ++ D    +++S DK +++W +  G+ ++    H+  
Sbjct: 50  DDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSD 109

Query: 614 IMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITS-----DGSTV 668
           +M+V    ++    S S+D  +K W   K +C+  L  H   V  + I       D  TV
Sbjct: 110 VMSVAIDRKASMIISGSRDKTIKVWT-IKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTV 168

Query: 669 VSSSHDHSMRVWKETDDQV 687
           +S+ +D  ++ W     Q+
Sbjct: 169 ISAGNDKMVKAWNLNQFQI 187

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 564 SLYGHKLPVLSIDISF-DSKLIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMNV 617
           +L GH   V S+  S     L+++ S DK +  W L      FG   +S   H   + + 
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 618 CFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSM 677
               +     S+S D  ++ WD    E  Q+   H+S+V ++AI    S ++S S D ++
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 678 RVW 680
           +VW
Sbjct: 132 KVW 134

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 70/156 (44%), Gaps = 12/156 (7%)

Query: 87  DETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIW 146
           D   +++AG  D ++K W+L    +   F GH   V  +     GT + S  +D +I++W
Sbjct: 164 DAVTVISAGN-DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLW 222

Query: 147 DLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVE------THIA 200
           +L  +  ++ L +  +  +  +     WL +    G IK++ L  Q  ++          
Sbjct: 223 NLAEKKAMYTLSAQDEVFSLAFSPNRYWLAAATASG-IKIFCLDPQSLIDDLRPEFAGYN 281

Query: 201 QTGECWALGVH----GDLVVTTGTDSQIKIWNLDTS 232
           ++ E  A+ +     G  +    TDS I++W + T+
Sbjct: 282 KSAEPHAVSLAWSADGQTLFAGYTDSVIRVWQVMTA 317

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 64/158 (40%), Gaps = 18/158 (11%)

Query: 88  ETNLLAAGYADGVIKIWDLMS-----KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSD 142
           + NLL +G  D  +  W L          + SF GH   V        G   +S S D  
Sbjct: 29  QPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKT 88

Query: 143 IIIWDLVSEVGVFKLRSHKDAITGIWCEGE-DWLVSTAKDGLIKLWDLKTQQCVETHIAQ 201
           + +WD+ +     +   HK  +  +  + +   ++S ++D  IK+W +K  QC+ T +  
Sbjct: 89  LRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGH 147

Query: 202 TGECWALGVH---------GDLVVTTGTDSQIKIWNLD 230
               W   V             V++ G D  +K WNL+
Sbjct: 148 ND--WVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLN 183

>AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL137W
           (SEC27); 1-intron
          Length = 832

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/298 (22%), Positives = 132/298 (44%), Gaps = 33/298 (11%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTFDCGYA--LTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +L +  +G  +IWN +T++ +R+     A     KF+P  +  ++G+ + +I++F+  T 
Sbjct: 28  VLITLYSGRAEIWNYETQTEVRSISVCEAPVRAGKFIPRKSWIIVGSDDFKIRVFNYNTG 87

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKL 518
             +   + AH   I +L +      +++ S D ++K WN+     L              
Sbjct: 88  EKVVDFE-AHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWAL-------------- 132

Query: 519 IHDTTLELNDD-ILSVKISPED-KYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 576
             + T E ++  ++SV  +P+D    A + LD+TVK++ L       +L  H    L   
Sbjct: 133 --EQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAH----LEKG 186

Query: 577 ISF-------DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSS 629
           ++F       D   +ITSS D+ +K+W      C  +L  H  ++    + P      S 
Sbjct: 187 VNFVDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISG 246

Query: 630 SKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDG-STVVSSSHDHSMRVWKETDDQ 686
           S+DG VK W+ + ++  + L       W +A    G    +++  D+   V    +D+
Sbjct: 247 SEDGTVKIWNSNTYKLERTLNLGLERSWCVAAHPTGKRNFIAAGFDNGFTVLAIGNDE 304

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 72/167 (43%), Gaps = 8/167 (4%)

Query: 75  SKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVL-LSFSGHKSGVTILKFDSTGTR 133
           + P  +  L  H   + + +   D  +K+W+      L  +F GH+  V  + F+     
Sbjct: 95  AHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKDPN 154

Query: 134 -LMSGSRDSDIIIWDLVSEVGVFKLRSHKDA----ITGIWCEGEDWLVSTAKDGLIKLWD 188
              +   D  + IW L  E   F LR+H +     +     + + +L++++ D  +K+WD
Sbjct: 155 TFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRTVKVWD 214

Query: 189 LKTQQCVETHIAQTGECWALGVHGDL--VVTTGTDSQIKIWNLDTSK 233
            +T+ CV T             H  L  +++   D  +KIWN +T K
Sbjct: 215 YQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWNSNTYK 261

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 55/128 (42%), Gaps = 4/128 (3%)

Query: 88  ETNLLAAGYADGVIKIWDLMSKTVLLSFSGH-KSGVTILKFDSTGTR--LMSGSRDSDII 144
           + N  A    D  +KIW L  +T   +   H + GV  + +     +  L++ S D  + 
Sbjct: 152 DPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRTVK 211

Query: 145 IWDLVSEVGVFKLRSHKDAIT-GIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTG 203
           +WD  ++  V  L  H   ++  ++      ++S ++DG +K+W+  T +   T      
Sbjct: 212 VWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLNLGLE 271

Query: 204 ECWALGVH 211
             W +  H
Sbjct: 272 RSWCVAAH 279

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 70/167 (41%), Gaps = 7/167 (4%)

Query: 75  SKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRL 134
           S+   V  +++H     +      G  +IW+  ++T + S S  ++ V   KF    + +
Sbjct: 11  SRTDRVKGIDFHPSEPWVLITLYSGRAEIWNYETQTEVRSISVCEAPVRAGKFIPRKSWI 70

Query: 135 MSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEG-EDWLVSTAKDGLIKLWDLKTQQ 193
           + GS D  I +++  +   V    +H D I  +       +++S + D  +KLW+ +   
Sbjct: 71  IVGSDDFKIRVFNYNTGEKVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNW 130

Query: 194 CVETHIAQTGECWALGV-----HGDLVVTTGTDSQIKIWNLDTSKEN 235
            +E    +  E + + V       +   T   D  +KIW+L     N
Sbjct: 131 ALE-QTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSN 176

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 103/223 (46%), Gaps = 23/223 (10%)

Query: 467 AHNAAIWSLDITQDGKR--LVTGSADKSIKFWNFSIEQDLVPGTTDKF-VPVMKLIHDTT 523
            HN  + SL  T  G+   L++ S DK++  W  +       G   KF VPV      + 
Sbjct: 15  GHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHSH 66

Query: 524 LELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKL 583
           +     +    ++ +  Y   +  D T++++ + + + +    GHK  V+S+DI   + +
Sbjct: 67  I-----VQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASM 121

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLP------ESHNFFSSSKDGLVKY 637
           II+ S DK IK+W +  G C  +L  H D +  V  +P      +S    S+  D +VK 
Sbjct: 122 IISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKA 180

Query: 638 WDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           W+ ++F+       H S +  L  + DG+ + S+  D  + +W
Sbjct: 181 WNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 132/304 (43%), Gaps = 41/304 (13%)

Query: 399 NKLLASASNGLLKIWNL-----KTKSCIRTFDCGYALT--CKFLPSGTLCVIGTREGQIQ 451
           N LL+++ +  L  W L     K    +R+F     +   C     G   +  + +  ++
Sbjct: 31  NLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 452 LFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDK 511
           L+D+ T    +   V H + + S+DI +    +++GS DK+IK W  +I+   +      
Sbjct: 91  LWDVATGETYQRF-VGHKSDVMSVDIDKKASMIISGSRDKTIKVW--TIKGQCLA----- 142

Query: 512 FVPVMKLIHDTTLELNDDILSVKISPEDKY--LAVSLL----DNTVKVFFLDSMKFFLSL 565
                     T L  ND +  V++ P +K    +V+++    D  VK + L+  +     
Sbjct: 143 ----------TLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADF 192

Query: 566 YGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN 625
            GH   + ++  S D  LI ++  D  I +W L       +L A QD + ++ F P  + 
Sbjct: 193 IGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSA-QDEVFSLAFSPNRYW 251

Query: 626 FFSSSKDGLVKYWDGDKFECVQKL--------AAHQSEVWALAITSDGSTVVSSSHDHSM 677
             +++  G +K +  D    V  L         A +    +LA ++DG T+ +   D+ +
Sbjct: 252 LAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVI 310

Query: 678 RVWK 681
           RVW+
Sbjct: 311 RVWQ 314

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 65/153 (42%), Gaps = 26/153 (16%)

Query: 98  DGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIW----------- 146
           D  +++WD+ +      F GHKS V  +  D   + ++SGSRD  I +W           
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLL 145

Query: 147 ---DLVSEVGVF-KLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQT 202
              D VS+V V    ++  D++T         ++S   D ++K W+L   Q     I   
Sbjct: 146 GHNDWVSQVRVVPNEKADDDSVT---------IISAGNDKMVKAWNLNQFQIEADFIGHN 196

Query: 203 GECWALGVH--GDLVVTTGTDSQIKIWNLDTSK 233
                L     G L+ + G D +I +WNL   K
Sbjct: 197 SNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 88/198 (44%), Gaps = 18/198 (9%)

Query: 45  ENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIW 104
           + I +W IK   L ++L        + V  ++ A+       D   +++AG  D ++K W
Sbjct: 129 KTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKAD------DDSVTIISAGN-DKMVKAW 181

Query: 105 DLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAI 164
           +L    +   F GH S +  L     GT + S  +D +I++W+L ++  ++ L +  +  
Sbjct: 182 NLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVF 241

Query: 165 TGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVE------THIAQTGECWALGVH----GDL 214
           +  +     WL +    G IK++ L  Q  V+         ++  E  A+ +     G  
Sbjct: 242 SLAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQT 300

Query: 215 VVTTGTDSQIKIWNLDTS 232
           +    TD+ I++W + T+
Sbjct: 301 LFAGYTDNVIRVWQVMTA 318

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 564 SLYGHKLPVLSIDISF-DSKLIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMNV 617
           +L GH   V S+  S     L++++S DK +  W L      FG   +S   H   + + 
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 618 CFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSM 677
               +     S+S D  ++ WD    E  Q+   H+S+V ++ I    S ++S S D ++
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 678 RVW 680
           +VW
Sbjct: 132 KVW 134

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 65/157 (41%), Gaps = 15/157 (9%)

Query: 88  ETNLLAAGYADGVIKIWDLMSK-----TVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSD 142
           + NLL +   D  +  W L          + SF GH   V      + G   +S S D  
Sbjct: 29  QPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKT 88

Query: 143 IIIWDLVSEVGVFKLRSHKDAITGIWCEGE-DWLVSTAKDGLIKLWDLKTQQCVETHIAQ 201
           + +WD+ +     +   HK  +  +  + +   ++S ++D  IK+W +K  QC+ T +  
Sbjct: 89  LRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGH 147

Query: 202 TGECWALGVHGD--------LVVTTGTDSQIKIWNLD 230
                 + V  +         +++ G D  +K WNL+
Sbjct: 148 NDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLN 184

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 103/223 (46%), Gaps = 23/223 (10%)

Query: 467 AHNAAIWSLDITQDGKR--LVTGSADKSIKFWNFSIEQDLVPGTTDKF-VPVMKLIHDTT 523
            HN  + SL  T  G+   L++ S DK++  W  +       G   KF VPV      + 
Sbjct: 15  GHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHSH 66

Query: 524 LELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKL 583
           +     +    ++ +  Y   +  D T++++ + + + +    GHK  V+S+DI   + +
Sbjct: 67  I-----VQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASM 121

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLP------ESHNFFSSSKDGLVKY 637
           II+ S DK IK+W +  G C  +L  H D +  V  +P      +S    S+  D +VK 
Sbjct: 122 IISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKA 180

Query: 638 WDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           W+ ++F+       H S +  L  + DG+ + S+  D  + +W
Sbjct: 181 WNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 132/304 (43%), Gaps = 41/304 (13%)

Query: 399 NKLLASASNGLLKIWNL-----KTKSCIRTFDCGYALT--CKFLPSGTLCVIGTREGQIQ 451
           N LL+++ +  L  W L     K    +R+F     +   C     G   +  + +  ++
Sbjct: 31  NLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 452 LFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDK 511
           L+D+ T    +   V H + + S+DI +    +++GS DK+IK W  +I+   +      
Sbjct: 91  LWDVATGETYQRF-VGHKSDVMSVDIDKKASMIISGSRDKTIKVW--TIKGQCLA----- 142

Query: 512 FVPVMKLIHDTTLELNDDILSVKISPEDKY--LAVSLL----DNTVKVFFLDSMKFFLSL 565
                     T L  ND +  V++ P +K    +V+++    D  VK + L+  +     
Sbjct: 143 ----------TLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADF 192

Query: 566 YGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN 625
            GH   + ++  S D  LI ++  D  I +W L       +L A QD + ++ F P  + 
Sbjct: 193 IGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSA-QDEVFSLAFSPNRYW 251

Query: 626 FFSSSKDGLVKYWDGDKFECVQKL--------AAHQSEVWALAITSDGSTVVSSSHDHSM 677
             +++  G +K +  D    V  L         A +    +LA ++DG T+ +   D+ +
Sbjct: 252 LAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVI 310

Query: 678 RVWK 681
           RVW+
Sbjct: 311 RVWQ 314

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 65/153 (42%), Gaps = 26/153 (16%)

Query: 98  DGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIW----------- 146
           D  +++WD+ +      F GHKS V  +  D   + ++SGSRD  I +W           
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLL 145

Query: 147 ---DLVSEVGVF-KLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQT 202
              D VS+V V    ++  D++T         ++S   D ++K W+L   Q     I   
Sbjct: 146 GHNDWVSQVRVVPNEKADDDSVT---------IISAGNDKMVKAWNLNQFQIEADFIGHN 196

Query: 203 GECWALGVH--GDLVVTTGTDSQIKIWNLDTSK 233
                L     G L+ + G D +I +WNL   K
Sbjct: 197 SNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 88/198 (44%), Gaps = 18/198 (9%)

Query: 45  ENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIW 104
           + I +W IK   L ++L        + V  ++ A+       D   +++AG  D ++K W
Sbjct: 129 KTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKAD------DDSVTIISAGN-DKMVKAW 181

Query: 105 DLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAI 164
           +L    +   F GH S +  L     GT + S  +D +I++W+L ++  ++ L +  +  
Sbjct: 182 NLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVF 241

Query: 165 TGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVE------THIAQTGECWALGVH----GDL 214
           +  +     WL +    G IK++ L  Q  V+         ++  E  A+ +     G  
Sbjct: 242 SLAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQT 300

Query: 215 VVTTGTDSQIKIWNLDTS 232
           +    TD+ I++W + T+
Sbjct: 301 LFAGYTDNVIRVWQVMTA 318

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 564 SLYGHKLPVLSIDISF-DSKLIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMNV 617
           +L GH   V S+  S     L++++S DK +  W L      FG   +S   H   + + 
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 618 CFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSM 677
               +     S+S D  ++ WD    E  Q+   H+S+V ++ I    S ++S S D ++
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 678 RVW 680
           +VW
Sbjct: 132 KVW 134

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 65/157 (41%), Gaps = 15/157 (9%)

Query: 88  ETNLLAAGYADGVIKIWDLMSK-----TVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSD 142
           + NLL +   D  +  W L          + SF GH   V      + G   +S S D  
Sbjct: 29  QPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKT 88

Query: 143 IIIWDLVSEVGVFKLRSHKDAITGIWCEGE-DWLVSTAKDGLIKLWDLKTQQCVETHIAQ 201
           + +WD+ +     +   HK  +  +  + +   ++S ++D  IK+W +K  QC+ T +  
Sbjct: 89  LRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGH 147

Query: 202 TGECWALGVHGD--------LVVTTGTDSQIKIWNLD 230
                 + V  +         +++ G D  +K WNL+
Sbjct: 148 NDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLN 184

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 103/223 (46%), Gaps = 23/223 (10%)

Query: 467 AHNAAIWSLDITQDGKR--LVTGSADKSIKFWNFSIEQDLVPGTTDKF-VPVMKLIHDTT 523
            HN  + SL  T  G+   L++ S DK++  W  +       G   KF VPV      + 
Sbjct: 15  GHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHSH 66

Query: 524 LELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKL 583
           +     +    ++ +  Y   +  D T++++ + + + +    GHK  V+S+DI   + +
Sbjct: 67  I-----VQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASM 121

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLP------ESHNFFSSSKDGLVKY 637
           II+ S DK IK+W +  G C  +L  H D +  V  +P      +S    S+  D +VK 
Sbjct: 122 IISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKA 180

Query: 638 WDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           W+ ++F+       H S +  L  + DG+ + S+  D  + +W
Sbjct: 181 WNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 132/304 (43%), Gaps = 41/304 (13%)

Query: 399 NKLLASASNGLLKIWNL-----KTKSCIRTFDCGYALT--CKFLPSGTLCVIGTREGQIQ 451
           N LL+++ +  L  W L     K    +R+F     +   C     G   +  + +  ++
Sbjct: 31  NLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 452 LFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDK 511
           L+D+ T    +   V H + + S+DI +    +++GS DK+IK W  +I+   +      
Sbjct: 91  LWDVATGETYQRF-VGHKSDVMSVDIDKKASMIISGSRDKTIKVW--TIKGQCLA----- 142

Query: 512 FVPVMKLIHDTTLELNDDILSVKISPEDKY--LAVSLL----DNTVKVFFLDSMKFFLSL 565
                     T L  ND +  V++ P +K    +V+++    D  VK + L+  +     
Sbjct: 143 ----------TLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADF 192

Query: 566 YGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN 625
            GH   + ++  S D  LI ++  D  I +W L       +L A QD + ++ F P  + 
Sbjct: 193 IGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSA-QDEVFSLAFSPNRYW 251

Query: 626 FFSSSKDGLVKYWDGDKFECVQKL--------AAHQSEVWALAITSDGSTVVSSSHDHSM 677
             +++  G +K +  D    V  L         A +    +LA ++DG T+ +   D+ +
Sbjct: 252 LAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVI 310

Query: 678 RVWK 681
           RVW+
Sbjct: 311 RVWQ 314

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 65/153 (42%), Gaps = 26/153 (16%)

Query: 98  DGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIW----------- 146
           D  +++WD+ +      F GHKS V  +  D   + ++SGSRD  I +W           
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLL 145

Query: 147 ---DLVSEVGVF-KLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQT 202
              D VS+V V    ++  D++T         ++S   D ++K W+L   Q     I   
Sbjct: 146 GHNDWVSQVRVVPNEKADDDSVT---------IISAGNDKMVKAWNLNQFQIEADFIGHN 196

Query: 203 GECWALGVH--GDLVVTTGTDSQIKIWNLDTSK 233
                L     G L+ + G D +I +WNL   K
Sbjct: 197 SNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 88/198 (44%), Gaps = 18/198 (9%)

Query: 45  ENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIW 104
           + I +W IK   L ++L        + V  ++ A+       D   +++AG  D ++K W
Sbjct: 129 KTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKAD------DDSVTIISAGN-DKMVKAW 181

Query: 105 DLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAI 164
           +L    +   F GH S +  L     GT + S  +D +I++W+L ++  ++ L +  +  
Sbjct: 182 NLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVF 241

Query: 165 TGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVE------THIAQTGECWALGVH----GDL 214
           +  +     WL +    G IK++ L  Q  V+         ++  E  A+ +     G  
Sbjct: 242 SLAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQT 300

Query: 215 VVTTGTDSQIKIWNLDTS 232
           +    TD+ I++W + T+
Sbjct: 301 LFAGYTDNVIRVWQVMTA 318

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 564 SLYGHKLPVLSIDISF-DSKLIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMNV 617
           +L GH   V S+  S     L++++S DK +  W L      FG   +S   H   + + 
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 618 CFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSM 677
               +     S+S D  ++ WD    E  Q+   H+S+V ++ I    S ++S S D ++
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 678 RVW 680
           +VW
Sbjct: 132 KVW 134

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 65/157 (41%), Gaps = 15/157 (9%)

Query: 88  ETNLLAAGYADGVIKIWDLMSK-----TVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSD 142
           + NLL +   D  +  W L          + SF GH   V      + G   +S S D  
Sbjct: 29  QPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKT 88

Query: 143 IIIWDLVSEVGVFKLRSHKDAITGIWCEGE-DWLVSTAKDGLIKLWDLKTQQCVETHIAQ 201
           + +WD+ +     +   HK  +  +  + +   ++S ++D  IK+W +K  QC+ T +  
Sbjct: 89  LRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGH 147

Query: 202 TGECWALGVHGD--------LVVTTGTDSQIKIWNLD 230
                 + V  +         +++ G D  +K WNL+
Sbjct: 148 NDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLN 184

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 103/223 (46%), Gaps = 23/223 (10%)

Query: 467 AHNAAIWSLDITQDGKR--LVTGSADKSIKFWNFSIEQDLVPGTTDKF-VPVMKLIHDTT 523
            HN  + SL  T  G+   L++ S DK++  W  +       G   KF VPV      + 
Sbjct: 15  GHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHSH 66

Query: 524 LELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKL 583
           +     +    ++ +  Y   +  D T++++ + + + +    GHK  V+S+DI   + +
Sbjct: 67  I-----VQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASM 121

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLP------ESHNFFSSSKDGLVKY 637
           II+ S DK IK+W +  G C  +L  H D +  V  +P      +S    S+  D +VK 
Sbjct: 122 IISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKA 180

Query: 638 WDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           W+ ++F+       H S +  L  + DG+ + S+  D  + +W
Sbjct: 181 WNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 132/304 (43%), Gaps = 41/304 (13%)

Query: 399 NKLLASASNGLLKIWNL-----KTKSCIRTFDCGYALT--CKFLPSGTLCVIGTREGQIQ 451
           N LL+++ +  L  W L     K    +R+F     +   C     G   +  + +  ++
Sbjct: 31  NLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 452 LFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDK 511
           L+D+ T    +   V H + + S+DI +    +++GS DK+IK W  +I+   +      
Sbjct: 91  LWDVATGETYQRF-VGHKSDVMSVDIDKKASMIISGSRDKTIKVW--TIKGQCLA----- 142

Query: 512 FVPVMKLIHDTTLELNDDILSVKISPEDKY--LAVSLL----DNTVKVFFLDSMKFFLSL 565
                     T L  ND +  V++ P +K    +V+++    D  VK + L+  +     
Sbjct: 143 ----------TLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADF 192

Query: 566 YGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN 625
            GH   + ++  S D  LI ++  D  I +W L       +L A QD + ++ F P  + 
Sbjct: 193 IGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSA-QDEVFSLAFSPNRYW 251

Query: 626 FFSSSKDGLVKYWDGDKFECVQKL--------AAHQSEVWALAITSDGSTVVSSSHDHSM 677
             +++  G +K +  D    V  L         A +    +LA ++DG T+ +   D+ +
Sbjct: 252 LAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVI 310

Query: 678 RVWK 681
           RVW+
Sbjct: 311 RVWQ 314

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 65/153 (42%), Gaps = 26/153 (16%)

Query: 98  DGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIW----------- 146
           D  +++WD+ +      F GHKS V  +  D   + ++SGSRD  I +W           
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLL 145

Query: 147 ---DLVSEVGVF-KLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQT 202
              D VS+V V    ++  D++T         ++S   D ++K W+L   Q     I   
Sbjct: 146 GHNDWVSQVRVVPNEKADDDSVT---------IISAGNDKMVKAWNLNQFQIEADFIGHN 196

Query: 203 GECWALGVH--GDLVVTTGTDSQIKIWNLDTSK 233
                L     G L+ + G D +I +WNL   K
Sbjct: 197 SNINTLTASPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 88/198 (44%), Gaps = 18/198 (9%)

Query: 45  ENINLWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIW 104
           + I +W IK   L ++L        + V  ++ A+       D   +++AG  D ++K W
Sbjct: 129 KTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKAD------DDSVTIISAGN-DKMVKAW 181

Query: 105 DLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAI 164
           +L    +   F GH S +  L     GT + S  +D +I++W+L ++  ++ L +  +  
Sbjct: 182 NLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVF 241

Query: 165 TGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVE------THIAQTGECWALGVH----GDL 214
           +  +     WL +    G IK++ L  Q  V+         ++  E  A+ +     G  
Sbjct: 242 SLAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQT 300

Query: 215 VVTTGTDSQIKIWNLDTS 232
           +    TD+ I++W + T+
Sbjct: 301 LFAGYTDNVIRVWQVMTA 318

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 564 SLYGHKLPVLSIDISF-DSKLIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMNV 617
           +L GH   V S+  S     L++++S DK +  W L      FG   +S   H   + + 
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 618 CFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSM 677
               +     S+S D  ++ WD    E  Q+   H+S+V ++ I    S ++S S D ++
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 678 RVW 680
           +VW
Sbjct: 132 KVW 134

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 65/157 (41%), Gaps = 15/157 (9%)

Query: 88  ETNLLAAGYADGVIKIWDLMSK-----TVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSD 142
           + NLL +   D  +  W L          + SF GH   V      + G   +S S D  
Sbjct: 29  QPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKT 88

Query: 143 IIIWDLVSEVGVFKLRSHKDAITGIWCEGE-DWLVSTAKDGLIKLWDLKTQQCVETHIAQ 201
           + +WD+ +     +   HK  +  +  + +   ++S ++D  IK+W +K  QC+ T +  
Sbjct: 89  LRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGH 147

Query: 202 TGECWALGVHGD--------LVVTTGTDSQIKIWNLD 230
                 + V  +         +++ G D  +K WNL+
Sbjct: 148 NDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLN 184

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 94/220 (42%), Gaps = 18/220 (8%)

Query: 467 AHNAAIWSLDIT-QDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLE 525
            HN  + SL  +      L++GS DK++  W  + E          F     ++ D T  
Sbjct: 31  GHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCT-- 88

Query: 526 LNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLII 585
                    ++ + KY   +  D T++++ L S K      GHK  V+S+ I   +  I+
Sbjct: 89  ---------VTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIV 139

Query: 586 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLP-----ESHNFFSSSKDGLVKYWDG 640
           ++S DK +K+W    GDC  +L  H D + NV   P     ++    S+  D +VK WD 
Sbjct: 140 SASRDKTVKVWNT-VGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDL 198

Query: 641 DKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
             F        H + V  +  + DGS   S+  D  + +W
Sbjct: 199 QSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILW 238

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 133/303 (43%), Gaps = 40/303 (13%)

Query: 399 NKLLASASNGLLKIWNLKTKS-----CIRTFDCGYALT--CKFLPSGTLCVIGTREGQIQ 451
           N LL+ + +  L  W L  +       +R+F     +   C     G   +  + +  ++
Sbjct: 47  NMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLR 106

Query: 452 LFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDK 511
           L+DL +   I+   V H + + S+ I     ++V+ S DK++K WN ++   +V      
Sbjct: 107 LWDLQSGKCIKRF-VGHKSDVMSVSIDPRATQIVSASRDKTVKVWN-TVGDCVV------ 158

Query: 512 FVPVMKLIHDTTLELNDDILSVKISPEDKY-LAVSL----LDNTVKVFFLDSMKFFLSLY 566
                     T L  ND + +V+I+P +K   AV++    +D  VKV+ L S        
Sbjct: 159 ----------TLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFI 208

Query: 567 GHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNF 626
           GH   V ++  S D  +  ++  D  I +W L+      +L A +D +  V F P  +  
Sbjct: 209 GHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTLDA-KDEVFAVAFSPNRYWL 267

Query: 627 FSSSKDGLVKYWDGDKFECVQKL--------AAHQSEVWALAITSDGSTVVSSSHDHSMR 678
            +++  G +K +D ++   V  L         A      +LA ++DG T+ +   D+ +R
Sbjct: 268 TAATASG-IKIFDLEERTIVDDLKPEFAGYNKAQDPHAVSLAWSADGQTLFAGYTDNIIR 326

Query: 679 VWK 681
           VW+
Sbjct: 327 VWQ 329

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 72/153 (47%), Gaps = 10/153 (6%)

Query: 86  HDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIII 145
           HD    L+A + D  +++WDL S   +  F GHKS V  +  D   T+++S SRD  + +
Sbjct: 91  HDGKYALSASW-DKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKV 149

Query: 146 WDLVSEVGVFKLRSHKDAITGIWCEGED------WLVSTAKDGLIKLWDLKTQQCVETHI 199
           W+ V +  V  L  H D ++ +     +       ++S   D ++K+WDL++       I
Sbjct: 150 WNTVGDC-VVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFI 208

Query: 200 AQTGECWAL--GVHGDLVVTTGTDSQIKIWNLD 230
                   +     G +  + G D QI +WNL+
Sbjct: 209 GHNNYVTTVTPSPDGSIFASAGKDGQIILWNLN 241

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 87  DETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIW 146
           D   +++AG  D V+K+WDL S T+   F GH + VT +     G+   S  +D  II+W
Sbjct: 180 DAVTVISAGM-DKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILW 238

Query: 147 DLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVE 196
           +L  +  ++ L +  +     +     WL +    G IK++DL+ +  V+
Sbjct: 239 NLNEKTALYTLDAKDEVFAVAFSPNRYWLTAATASG-IKIFDLEERTIVD 287

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 62/130 (47%), Gaps = 6/130 (4%)

Query: 564 SLYGHKLPVLSIDIS-FDSKLIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMNV 617
           +L GH   V S+  S     ++++ S DK +  W L      +G   +S   H   + + 
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDC 87

Query: 618 CFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSM 677
               +     S+S D  ++ WD    +C+++   H+S+V +++I    + +VS+S D ++
Sbjct: 88  TVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTV 147

Query: 678 RVWKETDDQV 687
           +VW    D V
Sbjct: 148 KVWNTVGDCV 157

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 102/253 (40%), Gaps = 42/253 (16%)

Query: 384 KGHRTXXXXXXXXXXNKLLASAS-NGLLKIWNLKTKSCIRTFDCGY---ALTCKFLPSGT 439
           KGH             K   SAS +  L++W+L++  CI+ F  G+    ++    P  T
Sbjct: 78  KGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRF-VGHKSDVMSVSIDPRAT 136

Query: 440 LCVIGTREGQIQLFDLV---TSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFW 496
             V  +R+  +++++ V     TL+   D   N  I   + + D   +++   DK +K W
Sbjct: 137 QIVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVW 196

Query: 497 N---FSIEQDLV-------------------PGTTDKFVPVMKLIHDT---TLELNDDIL 531
           +   F+IE D +                       D  + +  L   T   TL+  D++ 
Sbjct: 197 DLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTLDAKDEVF 256

Query: 532 SVKISPEDKYLAVSLLDNTVKVF------FLDSMKFFLSLY--GHKLPVLSIDISFDSKL 583
           +V  SP ++Y   +   + +K+F       +D +K   + Y        +S+  S D + 
Sbjct: 257 AVAFSP-NRYWLTAATASGIKIFDLEERTIVDDLKPEFAGYNKAQDPHAVSLAWSADGQT 315

Query: 584 IITSSADKNIKIW 596
           +     D  I++W
Sbjct: 316 LFAGYTDNIIRVW 328

>NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 100/223 (44%), Gaps = 22/223 (9%)

Query: 467 AHNAAIWSLDITQDGKR--LVTGSADKSIKFWNFSIEQDLVPGTTDKF-VPVMKLIHDTT 523
            HN  + SL  T  G+   L++ S DK++  W  +       G   KF VPV      + 
Sbjct: 15  GHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHSH 66

Query: 524 LELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKL 583
           +     +    ++ +  Y   +  D T++++ + + + +    GHK  V+S+ I   + +
Sbjct: 67  I-----VQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASM 121

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN-----FFSSSKDGLVKYW 638
           II+ S DK IK+W +  G C  +L  H D +  V   P   N       S+  D +VK W
Sbjct: 122 IISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAW 180

Query: 639 DGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWK 681
           + ++F+       H   V A+  + DGS + S+  D  + +W 
Sbjct: 181 NLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLWN 223

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 69/160 (43%), Gaps = 26/160 (16%)

Query: 86  HDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIII 145
            D    L+A + D  +++WD+ +      F GHKS V  +  D   + ++SGSRD  I +
Sbjct: 75  QDGAYALSASW-DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKV 133

Query: 146 W--------------DLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKT 191
           W              D VS+V +     + D +T         ++S   D ++K W+L  
Sbjct: 134 WTIKGQCLATLLGHNDWVSQVRIAPTDQNDDTVT---------VISAGNDKMVKAWNLNQ 184

Query: 192 QQCVETHIAQTGECWALGVH--GDLVVTTGTDSQIKIWNL 229
            Q     +   G   A+     G L+ + G D +I +WNL
Sbjct: 185 FQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLWNL 224

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/303 (23%), Positives = 129/303 (42%), Gaps = 40/303 (13%)

Query: 399 NKLLASASNGLLKIWNL-----KTKSCIRTFDCGYALT--CKFLPSGTLCVIGTREGQIQ 451
           N LL+++ +  L  W L     K    +R+F     +   C     G   +  + +  ++
Sbjct: 31  NLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLR 90

Query: 452 LFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDK 511
           L+D+ T    +   V H + + S+ I +    +++GS DK+IK W  +I+   +      
Sbjct: 91  LWDVATGETYQRF-VGHKSDVMSVAIDRKASMIISGSRDKTIKVW--TIKGQCLA----- 142

Query: 512 FVPVMKLIHDTTLELNDDILSVKISPEDKY-LAVSLL----DNTVKVFFLDSMKFFLSLY 566
                     T L  ND +  V+I+P D+    V+++    D  VK + L+  +      
Sbjct: 143 ----------TLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 567 GHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNF 626
           GH   V ++  S D  LI ++  D  I +W L       +L A QD +  + F P  +  
Sbjct: 193 GHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYTLSA-QDEVFALAFSPNRYWL 251

Query: 627 FSSSKDGLVKYWDGDKFECVQKL--------AAHQSEVWALAITSDGSTVVSSSHDHSMR 678
            +++  G VK +  D    +  L         A +    +L  ++DG T+ +   D+ +R
Sbjct: 252 AAATASG-VKIFSLDPQSLIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIR 310

Query: 679 VWK 681
           VW+
Sbjct: 311 VWQ 313

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 58/123 (47%), Gaps = 6/123 (4%)

Query: 564 SLYGHKLPVLSIDISF-DSKLIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMNV 617
           +L GH   V S+  S     L++++S DK +  W L      FG   +S   H   + + 
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 618 CFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSM 677
               +     S+S D  ++ WD    E  Q+   H+S+V ++AI    S ++S S D ++
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 678 RVW 680
           +VW
Sbjct: 132 KVW 134

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 52/110 (47%), Gaps = 2/110 (1%)

Query: 87  DETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIW 146
           D   +++AG  D ++K W+L    +   F GH   V  +     G+ + S  +D +I++W
Sbjct: 164 DTVTVISAGN-DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLW 222

Query: 147 DLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVE 196
           +L+ +  ++ L +  +     +     WL +    G +K++ L  Q  ++
Sbjct: 223 NLLEKTAMYTLSAQDEVFALAFSPNRYWLAAATASG-VKIFSLDPQSLID 271

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 64/294 (21%), Positives = 114/294 (38%), Gaps = 26/294 (8%)

Query: 88  ETNLLAAGYADGVIKIWDLMS-----KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSD 142
           + NLL +   D  +  W L          + SF GH   V        G   +S S D  
Sbjct: 29  QPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKT 88

Query: 143 IIIWDLVSEVGVFKLRSHKDAITGIWCEGE-DWLVSTAKDGLIKLWDLKTQQCVETHIAQ 201
           + +WD+ +     +   HK  +  +  + +   ++S ++D  IK+W +K  QC+ T +  
Sbjct: 89  LRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGH 147

Query: 202 TGECWALGV------HGD---LVVTTGTDSQIKIWNLDTSKENGSKIVEKGTYEKQSKQR 252
               W   V        D    V++ G D  +K WNL+  +     +   G     +   
Sbjct: 148 ND--WVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASP 205

Query: 253 GLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMKEKGSTDEQIQQY 312
             S+      D    L+  N  +   ++ +  QDE+  AL     R     +T   ++ +
Sbjct: 206 DGSLIASAGKDGEIMLW--NLLEKTAMYTLSAQDEV-FALAFSPNRYWLAAATASGVKIF 262

Query: 313 FIDTYVSLM--LQP-FQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEYYSI 363
            +D   SL+  L+P F       +  AVS T +A+ +  L    + N I  + +
Sbjct: 263 SLDPQ-SLIDDLRPEFAGYNKAAEPHAVSLTWSADGQT-LFAGYTDNVIRVWQV 314

>KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.239
           YGL137W
          Length = 911

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 124/287 (43%), Gaps = 25/287 (8%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTFDCGY--ALTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +L +  +G ++IWN +T+  +R+           +F+      V+G+ + ++++F+  T 
Sbjct: 28  VLTTLYSGKIEIWNYETQQEVRSIHVTETPVRAGRFIARKNWIVVGSDDFRLRIFNYNTG 87

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKL 518
             I   + AH   I S+ +      ++TGS D ++K WN+     L              
Sbjct: 88  EKISDFE-AHPDYIRSIAVHPTKPYVITGSDDLTVKLWNWEKNWAL-------------- 132

Query: 519 IHDTTLELNDD-ILSVKISPED-KYLAVSLLDNTVKVFFL-DSMKFFLSLYGHKLPVLSI 575
             + T E +D  ++SV  +P+D    A   LD TVKV+ L  S   F  + G +  V  +
Sbjct: 133 --EQTFEGHDHFVMSVAFNPKDPNTFASGCLDRTVKVWSLGQSQPNFTLVTGQEKGVNYV 190

Query: 576 DISF--DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDG 633
           D     D   ++T+S D  +KIW      C  +L  H  ++    F P      S S+DG
Sbjct: 191 DYYPLPDKPYLLTASDDMTVKIWDYQTKSCVATLEGHMANVSFAIFHPTLPIIISGSEDG 250

Query: 634 LVKYWDGDKFECVQKLAAHQSEVWALAITSDG-STVVSSSHDHSMRV 679
            VK W+   ++  + L       W +A    G    +++  D+   V
Sbjct: 251 TVKIWNSSTYKIEKTLNLGLERSWCIASHPTGKKNYIAAGFDNGFTV 297

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 66/167 (39%), Gaps = 8/167 (4%)

Query: 75  SKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVL-LSFSGHKSGVTILKFDSTGTR 133
           + P  +  +  H     +  G  D  +K+W+      L  +F GH   V  + F+     
Sbjct: 95  AHPDYIRSIAVHPTKPYVITGSDDLTVKLWNWEKNWALEQTFEGHDHFVMSVAFNPKDPN 154

Query: 134 -LMSGSRDSDIIIWDLVSEVGVFKLRSHKDA----ITGIWCEGEDWLVSTAKDGLIKLWD 188
              SG  D  + +W L      F L + ++     +       + +L++ + D  +K+WD
Sbjct: 155 TFASGCLDRTVKVWSLGQSQPNFTLVTGQEKGVNYVDYYPLPDKPYLLTASDDMTVKIWD 214

Query: 189 LKTQQCVETHIAQTGECWALGVHGDL--VVTTGTDSQIKIWNLDTSK 233
            +T+ CV T             H  L  +++   D  +KIWN  T K
Sbjct: 215 YQTKSCVATLEGHMANVSFAIFHPTLPIIISGSEDGTVKIWNSSTYK 261

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 68/156 (43%), Gaps = 2/156 (1%)

Query: 527 NDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIIT 586
           +D +  +   P + ++  +L    ++++  ++ +   S++  + PV +         I+ 
Sbjct: 13  SDRVKGIDFHPSEPWVLTTLYSGKIEIWNYETQQEVRSIHVTETPVRAGRFIARKNWIVV 72

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDK-FEC 645
            S D  ++I+  + G+      AH D I ++   P      + S D  VK W+ +K +  
Sbjct: 73  GSDDFRLRIFNYNTGEKISDFEAHPDYIRSIAVHPTKPYVITGSDDLTVKLWNWEKNWAL 132

Query: 646 VQKLAAHQSEVWALAITS-DGSTVVSSSHDHSMRVW 680
            Q    H   V ++A    D +T  S   D +++VW
Sbjct: 133 EQTFEGHDHFVMSVAFNPKDPNTFASGCLDRTVKVW 168

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 58/128 (45%), Gaps = 4/128 (3%)

Query: 88  ETNLLAAGYADGVIKIWDL-MSKTVLLSFSGHKSGVTILKFDSTGTR--LMSGSRDSDII 144
           + N  A+G  D  +K+W L  S+      +G + GV  + +     +  L++ S D  + 
Sbjct: 152 DPNTFASGCLDRTVKVWSLGQSQPNFTLVTGQEKGVNYVDYYPLPDKPYLLTASDDMTVK 211

Query: 145 IWDLVSEVGVFKLRSHKDAIT-GIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTG 203
           IWD  ++  V  L  H   ++  I+      ++S ++DG +K+W+  T +  +T      
Sbjct: 212 IWDYQTKSCVATLEGHMANVSFAIFHPTLPIIISGSEDGTVKIWNSSTYKIEKTLNLGLE 271

Query: 204 ECWALGVH 211
             W +  H
Sbjct: 272 RSWCIASH 279

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 61/336 (18%), Positives = 132/336 (39%), Gaps = 69/336 (20%)

Query: 157 LRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDLKTQQCVET-HIAQTG-ECWALGVHGD 213
             +  D + GI +   E W+++T   G I++W+ +TQQ V + H+ +T           +
Sbjct: 9   FSNRSDRVKGIDFHPSEPWVLTTLYSGKIEIWNYETQQEVRSIHVTETPVRAGRFIARKN 68

Query: 214 LVVTTGTDSQIKIWNLDTSKENGSKIVEKGTYEKQSKQ-RGLSVNFKTTADETTFLYIQN 272
            +V    D +++I+N +T    G KI +   +E      R ++V+         ++   +
Sbjct: 69  WIVVGSDDFRLRIFNYNT----GEKISD---FEAHPDYIRSIAVH-----PTKPYVITGS 116

Query: 273 SDKTVEIFRIRKQDEISRALKKREKRMKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTY 332
            D TV+++   K   + +  +  +               +F+ +       P        
Sbjct: 117 DDLTVKLWNWEKNWALEQTFEGHD---------------HFVMSVAFNPKDPNTFASGCL 161

Query: 333 KIKAVSWTVAANSKIELVVTTSS---NTIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTX 389
                 W++  +     +VT      N ++YY           P P K Y          
Sbjct: 162 DRTVKVWSLGQSQPNFTLVTGQEKGVNYVDYY-----------PLPDKPY---------- 200

Query: 390 XXXXXXXXXNKLLASASNGLLKIWNLKTKSCIRTFDCGYALT--CKFLPSGTLCVIGTRE 447
                      LL ++ +  +KIW+ +TKSC+ T +   A      F P+  + + G+ +
Sbjct: 201 -----------LLTASDDMTVKIWDYQTKSCVATLEGHMANVSFAIFHPTLPIIISGSED 249

Query: 448 GQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKR 483
           G +++++  T  + +++++    + W +     GK+
Sbjct: 250 GTVKIWNSSTYKIEKTLNLGLERS-WCIASHPTGKK 284

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 42/213 (19%), Positives = 89/213 (41%), Gaps = 15/213 (7%)

Query: 74  SSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTR 133
           S++   V  +++H     +      G I+IW+  ++  + S    ++ V   +F +    
Sbjct: 10  SNRSDRVKGIDFHPSEPWVLTTLYSGKIEIWNYETQQEVRSIHVTETPVRAGRFIARKNW 69

Query: 134 LMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGL-IKLWDLKT- 191
           ++ GS D  + I++  +   +    +H D I  I        V T  D L +KLW+ +  
Sbjct: 70  IVVGSDDFRLRIFNYNTGEKISDFEAHPDYIRSIAVHPTKPYVITGSDDLTVKLWNWEKN 129

Query: 192 ---QQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIVEKGTYEKQ 248
              +Q  E H              +   +   D  +K+W+L  S+ N + +         
Sbjct: 130 WALEQTFEGHDHFVMSVAFNPKDPNTFASGCLDRTVKVWSLGQSQPNFTLVT-------- 181

Query: 249 SKQRGLS-VNFKTTADETTFLYIQNSDKTVEIF 280
            +++G++ V++    D+  +L   + D TV+I+
Sbjct: 182 GQEKGVNYVDYYPLPDK-PYLLTASDDMTVKIW 213

>TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 888
           aa] {ON} 
          Length = 888

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/287 (24%), Positives = 126/287 (43%), Gaps = 25/287 (8%)

Query: 401 LLASASNGLLKIWNLKTKSCIRTFDCGY--ALTCKFLPSGTLCVIGTREGQIQLFDLVTS 458
           +L +  +G ++IWN +T++ +R+         + +F+      V+G+ + +I++F+  T 
Sbjct: 28  VLTTLYSGRIEIWNYETETEVRSIQVTETPVRSGRFIARKNWIVVGSDDFRIRIFNYNTG 87

Query: 459 TLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKL 518
             +   + AH   I S+ +      +++GS D ++K WN+     L              
Sbjct: 88  EKVSDFE-AHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWEKNWAL-------------- 132

Query: 519 IHDTTLELNDD-ILSVKISPEDK-YLAVSLLDNTVKVFFL-DSMKFFLSLYGHKLPVLSI 575
             + T E ++  ++SV  +P+D    A   LD TVKV+ L  S   F    G +  V  +
Sbjct: 133 --EQTFEGHEHFVMSVAFNPKDPSTFASGCLDRTVKVWSLGQSSPNFTLTTGQEKGVNYV 190

Query: 576 DISF--DSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDG 633
           D     D   +ITSS D ++KIW      C  +L  H  ++    F P      S S+DG
Sbjct: 191 DYYPLPDKPYLITSSDDFSVKIWDYQTKSCVATLEGHMSNVSFAVFHPSLPIIVSGSEDG 250

Query: 634 LVKYWDGDKFECVQKLAAHQSEVWALAITSDG-STVVSSSHDHSMRV 679
            VK W    ++ ++ +       W +A    G    +++  D+   V
Sbjct: 251 TVKLWSSTTYKVLKTMNLGLERAWCVATHPTGKKNYIAAGFDNGFSV 297

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 105/261 (40%), Gaps = 24/261 (9%)

Query: 434 FLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSI 493
           F P     +     G+I++++  T T + SI V     + S         +V GS D  I
Sbjct: 21  FHPVEPWVLTTLYSGRIEIWNYETETEVRSIQVTE-TPVRSGRFIARKNWIVVGSDDFRI 79

Query: 494 KFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDD-ILSVKISPEDKYLAVSLLDNTVK 552
           + +N++  + +                 +  E + D I S+ + P   Y+     D TVK
Sbjct: 80  RIFNYNTGEKV-----------------SDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVK 122

Query: 553 VF-FLDSMKFFLSLYGHKLPVLSIDISF-DSKLIITSSADKNIKIWGLDFGDCHKSLFAH 610
           ++ +  +     +  GH+  V+S+  +  D     +   D+ +K+W L     + +L   
Sbjct: 123 LWNWEKNWALEQTFEGHEHFVMSVAFNPKDPSTFASGCLDRTVKVWSLGQSSPNFTLTTG 182

Query: 611 QDSIMNVC---FLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGST 667
           Q+  +N      LP+     +SS D  VK WD     CV  L  H S V           
Sbjct: 183 QEKGVNYVDYYPLPDKPYLITSSDDFSVKIWDYQTKSCVATLEGHMSNVSFAVFHPSLPI 242

Query: 668 VVSSSHDHSMRVWKETDDQVF 688
           +VS S D ++++W  T  +V 
Sbjct: 243 IVSGSEDGTVKLWSSTTYKVL 263

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 72/168 (42%), Gaps = 3/168 (1%)

Query: 516 MKL-IHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS 574
           MKL I  T    +D +  +   P + ++  +L    ++++  ++     S+   + PV S
Sbjct: 1   MKLDITKTFTSRSDRVKGIDFHPVEPWVLTTLYSGRIEIWNYETETEVRSIQVTETPVRS 60

Query: 575 IDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGL 634
                    I+  S D  I+I+  + G+      AH D I ++   P      S S D  
Sbjct: 61  GRFIARKNWIVVGSDDFRIRIFNYNTGEKVSDFEAHPDYIRSIAVHPTKPYVLSGSDDLT 120

Query: 635 VKYWDGDK-FECVQKLAAHQSEVWALAITS-DGSTVVSSSHDHSMRVW 680
           VK W+ +K +   Q    H+  V ++A    D ST  S   D +++VW
Sbjct: 121 VKLWNWEKNWALEQTFEGHEHFVMSVAFNPKDPSTFASGCLDRTVKVW 168

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 70/167 (41%), Gaps = 8/167 (4%)

Query: 75  SKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVL-LSFSGHKSGVTILKFDSTG-T 132
           + P  +  +  H     + +G  D  +K+W+      L  +F GH+  V  + F+    +
Sbjct: 95  AHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWEKNWALEQTFEGHEHFVMSVAFNPKDPS 154

Query: 133 RLMSGSRDSDIIIWDLVSEVGVFKLRSHKDA----ITGIWCEGEDWLVSTAKDGLIKLWD 188
              SG  D  + +W L      F L + ++     +       + +L++++ D  +K+WD
Sbjct: 155 TFASGCLDRTVKVWSLGQSSPNFTLTTGQEKGVNYVDYYPLPDKPYLITSSDDFSVKIWD 214

Query: 189 LKTQQCVETHIAQTGECWALGVHGDL--VVTTGTDSQIKIWNLDTSK 233
            +T+ CV T             H  L  +V+   D  +K+W+  T K
Sbjct: 215 YQTKSCVATLEGHMSNVSFAVFHPSLPIIVSGSEDGTVKLWSSTTYK 261

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 56/124 (45%), Gaps = 4/124 (3%)

Query: 92  LAAGYADGVIKIWDLMSKTVLLSFS-GHKSGVTILKFDSTGTR--LMSGSRDSDIIIWDL 148
            A+G  D  +K+W L   +   + + G + GV  + +     +  L++ S D  + IWD 
Sbjct: 156 FASGCLDRTVKVWSLGQSSPNFTLTTGQEKGVNYVDYYPLPDKPYLITSSDDFSVKIWDY 215

Query: 149 VSEVGVFKLRSHKDAIT-GIWCEGEDWLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWA 207
            ++  V  L  H   ++  ++      +VS ++DG +KLW   T + ++T        W 
Sbjct: 216 QTKSCVATLEGHMSNVSFAVFHPSLPIIVSGSEDGTVKLWSSTTYKVLKTMNLGLERAWC 275

Query: 208 LGVH 211
           +  H
Sbjct: 276 VATH 279

 Score = 39.3 bits (90), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 7/93 (7%)

Query: 80  VTYLEYH---DETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMS 136
           V Y++Y+   D+  L+ +   D  +KIWD  +K+ + +  GH S V+   F  +   ++S
Sbjct: 187 VNYVDYYPLPDKPYLITSS-DDFSVKIWDYQTKSCVATLEGHMSNVSFAVFHPSLPIIVS 245

Query: 137 GSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWC 169
           GS D  + +W   S      L++    +   WC
Sbjct: 246 GSEDGTVKLW---SSTTYKVLKTMNLGLERAWC 275

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 73/168 (43%), Gaps = 7/168 (4%)

Query: 74  SSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTR 133
           +S+   V  +++H     +      G I+IW+  ++T + S    ++ V   +F +    
Sbjct: 10  TSRSDRVKGIDFHPVEPWVLTTLYSGRIEIWNYETETEVRSIQVTETPVRSGRFIARKNW 69

Query: 134 LMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEG-EDWLVSTAKDGLIKLWDLKTQ 192
           ++ GS D  I I++  +   V    +H D I  I     + +++S + D  +KLW+ +  
Sbjct: 70  IVVGSDDFRIRIFNYNTGEKVSDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWEKN 129

Query: 193 QCVETHIAQTGECWALGVHGD-----LVVTTGTDSQIKIWNLDTSKEN 235
             +E    +  E + + V  +        +   D  +K+W+L  S  N
Sbjct: 130 WALE-QTFEGHEHFVMSVAFNPKDPSTFASGCLDRTVKVWSLGQSSPN 176

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 107/237 (45%), Gaps = 17/237 (7%)

Query: 447 EGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVP 506
           +G I +FD  +   + S+  AH   +  LD   +G  LVTG+ D  ++   ++ E +   
Sbjct: 199 DGGISVFDCESLESLASLP-AHAGKVGGLDWNSEGSLLVTGADDNYVRLTRYNGESN--- 254

Query: 507 GTTDKFVPVMKLIHDTTLELNDD-ILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSL 565
                      L++  TL  +++ +++    P DKY+A +  D T +++ +++ +     
Sbjct: 255 ----------GLVNVATLGGHENRVVNTVFHPSDKYVASASFDTTWRLWDVETAQELQLQ 304

Query: 566 YGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN 625
            GH   V S+    D  LI +   D    +W L  G    +L  H   +  V +   SH 
Sbjct: 305 EGHSKEVYSLSFQPDGALICSGGLDSLAMVWDLRSGKNIVTLQGHAKPVYCVDWSSNSHQ 364

Query: 626 FFSSSKDGLVKYWDGDKFE-CVQKLAAHQSEVWALAITSD-GSTVVSSSHDHSMRVW 680
             +   DG+V  WD  K E    KL AH+S V +L    + G  +VS  +D ++ V+
Sbjct: 365 LATGGGDGVVNVWDLRKLEQPATKLLAHKSIVSSLRFERNRGDVLVSGGYDRALNVY 421

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 83/187 (44%), Gaps = 23/187 (12%)

Query: 49  LWDIKTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMS 108
           LWD++T + L +            +     EV  L +  +  L+ +G  D +  +WDL S
Sbjct: 292 LWDVETAQELQL------------QEGHSKEVYSLSFQPDGALICSGGLDSLAMVWDLRS 339

Query: 109 KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVS-EVGVFKLRSHKDAITGI 167
              +++  GH   V  + + S   +L +G  D  + +WDL   E    KL +HK  ++ +
Sbjct: 340 GKNIVTLQGHAKPVYCVDWSSNSHQLATGGGDGVVNVWDLRKLEQPATKLLAHKSIVSSL 399

Query: 168 WCEGE--DWLVSTAKDGLIKLWDLKTQQ---CVETHIAQTGECWALGVHGDL--VVTTGT 220
             E    D LVS   D  + ++         C+E H   T +   + V GD   +V++G 
Sbjct: 400 RFERNRGDVLVSGGYDRALNVYSSDNWNKICCLEGH---TDKLLGVDVAGDCKYLVSSGW 456

Query: 221 DSQIKIW 227
           D  +K+W
Sbjct: 457 DRSVKLW 463

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 67/152 (44%), Gaps = 5/152 (3%)

Query: 85  YHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDII 144
           +H     +A+   D   ++WD+ +   L    GH   V  L F   G  + SG  DS  +
Sbjct: 274 FHPSDKYVASASFDTTWRLWDVETAQELQLQEGHSKEVYSLSFQPDGALICSGGLDSLAM 333

Query: 145 IWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLWDL-KTQQCVETHIAQT 202
           +WDL S   +  L+ H   +  + W      L +   DG++ +WDL K +Q     +A  
Sbjct: 334 VWDLRSGKNIVTLQGHAKPVYCVDWSSNSHQLATGGGDGVVNVWDLRKLEQPATKLLAHK 393

Query: 203 GECWALGV---HGDLVVTTGTDSQIKIWNLDT 231
               +L      GD++V+ G D  + +++ D 
Sbjct: 394 SIVSSLRFERNRGDVLVSGGYDRALNVYSSDN 425

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 93/217 (42%), Gaps = 22/217 (10%)

Query: 385 GHRTXXXXXXXXXXNKLLASAS-NGLLKIWNLKTKSCIRTFDCGYA---LTCKFLPSGTL 440
           GH            +K +ASAS +   ++W+++T   ++  + G++    +  F P G L
Sbjct: 264 GHENRVVNTVFHPSDKYVASASFDTTWRLWDVETAQELQLQE-GHSKEVYSLSFQPDGAL 322

Query: 441 CVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFS- 499
              G  +    ++DL +   I ++   H   ++ +D + +  +L TG  D  +  W+   
Sbjct: 323 ICSGGLDSLAMVWDLRSGKNIVTLQ-GHAKPVYCVDWSSNSHQLATGGGDGVVNVWDLRK 381

Query: 500 IEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSM 559
           +EQ   P T  K +    ++     E N              L     D  + V+  D+ 
Sbjct: 382 LEQ---PAT--KLLAHKSIVSSLRFERN----------RGDVLVSGGYDRALNVYSSDNW 426

Query: 560 KFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596
                L GH   +L +D++ D K +++S  D+++K+W
Sbjct: 427 NKICCLEGHTDKLLGVDVAGDCKYLVSSGWDRSVKLW 463

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 81/169 (47%), Gaps = 9/169 (5%)

Query: 72  VKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTG 131
           V S++P  V+ +      +  A+   DG I ++D  S   L S   H   V  L ++S G
Sbjct: 175 VASTRP--VSLVRISPNQSRFASASWDGGISVFDCESLESLASLPAHAGKVGGLDWNSEG 232

Query: 132 TRLMSGSRDSDIIIWDLVSE----VGVFKLRSHKDAITG-IWCEGEDWLVSTAKDGLIKL 186
           + L++G+ D+ + +     E    V V  L  H++ +   ++   + ++ S + D   +L
Sbjct: 233 SLLVTGADDNYVRLTRYNGESNGLVNVATLGGHENRVVNTVFHPSDKYVASASFDTTWRL 292

Query: 187 WDLKTQQCVETHIAQTGECWALGVH--GDLVVTTGTDSQIKIWNLDTSK 233
           WD++T Q ++     + E ++L     G L+ + G DS   +W+L + K
Sbjct: 293 WDVETAQELQLQEGHSKEVYSLSFQPDGALICSGGLDSLAMVWDLRSGK 341

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%)

Query: 621 PESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRV 679
           P    F S+S DG +  +D +  E +  L AH  +V  L   S+GS +V+ + D+ +R+
Sbjct: 188 PNQSRFASASWDGGISVFDCESLESLASLPAHAGKVGGLDWNSEGSLLVTGADDNYVRL 246

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 100/222 (45%), Gaps = 22/222 (9%)

Query: 467 AHNAAIWSLDITQDGKR--LVTGSADKSIKFWNFSIEQDLVPGTTDKF-VPVMKLIHDTT 523
            HN  + SL  T  G+   L++GS DK++  W  +       G   KF VPV      + 
Sbjct: 15  GHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKLT-------GDDQKFGVPVRSFKGHSH 66

Query: 524 LELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKL 583
           +     +    ++ +  Y   +  D T++++ + + + +    GHK  V+S+ I   + +
Sbjct: 67  I-----VQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASM 121

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHN-----FFSSSKDGLVKYW 638
           II+ S DK IK+W +  G C  +L  H D +  V   P   N       S+  D +VK W
Sbjct: 122 IISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAW 180

Query: 639 DGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
           + ++F+       H   V  +  + DG+ + S+  D  + +W
Sbjct: 181 NLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLW 222

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 114/263 (43%), Gaps = 33/263 (12%)

Query: 432 CKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADK 491
           C     G   +  + +  ++L+D+ T    +   V H + + S+ I +    +++GS DK
Sbjct: 71  CTLTQDGAYALSASWDKTLRLWDVATGETYQRF-VGHKSDVMSVAIDRKASMIISGSRDK 129

Query: 492 SIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKY-LAVSLL--- 547
           +IK W  +I+   +                T L  ND +  V+I+P D+   +V+++   
Sbjct: 130 TIKVW--TIKGQCLA---------------TLLGHNDWVSQVRIAPTDQNDDSVTVISAG 172

Query: 548 -DNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKS 606
            D  VK + L+  +      GH   V ++  S D  LI ++  D  I +W L       +
Sbjct: 173 NDKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYT 232

Query: 607 LFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKL--------AAHQSEVWA 658
           L A QD +  + F P  +   +++  G +K +  D    V  L         + +    +
Sbjct: 233 LSA-QDEVFALAFSPNRYWLAAATASG-IKIFCLDPQSLVDDLRPEFAGYNKSAEPHAVS 290

Query: 659 LAITSDGSTVVSSSHDHSMRVWK 681
           LA ++DG T+ +   D  +RVW+
Sbjct: 291 LAWSADGQTLFAGYTDSVIRVWQ 313

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 70/164 (42%), Gaps = 26/164 (15%)

Query: 86  HDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIII 145
            D    L+A + D  +++WD+ +      F GHKS V  +  D   + ++SGSRD  I +
Sbjct: 75  QDGAYALSASW-DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKV 133

Query: 146 W--------------DLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKT 191
           W              D VS+V +     + D++T         ++S   D ++K W+L  
Sbjct: 134 WTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVT---------VISAGNDKMVKAWNLNQ 184

Query: 192 QQCVETHIAQTGECWALGVH--GDLVVTTGTDSQIKIWNLDTSK 233
            Q     +   G    +     G L+ + G D +I +WNL   K
Sbjct: 185 FQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKK 228

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 93/203 (45%), Gaps = 23/203 (11%)

Query: 467 AHNAAIWSLDITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLEL 526
            H+  +    +TQDG   ++ S DK+++ W+ +  +     T  +FV      H +    
Sbjct: 63  GHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGE-----TYQRFVG-----HKS---- 108

Query: 527 NDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGH-----KLPVLSIDISFDS 581
             D++SV I  +   +     D T+KV+ +   +   +L GH     ++ +   D + DS
Sbjct: 109 --DVMSVAIDRKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRIAPTDQNDDS 165

Query: 582 KLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGD 641
             +I++  DK +K W L+          H  ++  V   P+     S+ KDG +  W+  
Sbjct: 166 VTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLA 225

Query: 642 KFECVQKLAAHQSEVWALAITSD 664
           + + +  L+A Q EV+ALA + +
Sbjct: 226 EKKAMYTLSA-QDEVFALAFSPN 247

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 63/139 (45%), Gaps = 9/139 (6%)

Query: 557 DSMKFFL---SLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDS 613
           D  KF +   S  GH   V    ++ D    +++S DK +++W +  G+ ++    H+  
Sbjct: 50  DDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSD 109

Query: 614 IMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITS-----DGSTV 668
           +M+V    ++    S S+D  +K W   K +C+  L  H   V  + I       D  TV
Sbjct: 110 VMSVAIDRKASMIISGSRDKTIKVWT-IKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTV 168

Query: 669 VSSSHDHSMRVWKETDDQV 687
           +S+ +D  ++ W     Q+
Sbjct: 169 ISAGNDKMVKAWNLNQFQI 187

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 564 SLYGHKLPVLSIDISF-DSKLIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMNV 617
           +L GH   V S+  S     L+++ S DK +  W L      FG   +S   H   + + 
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 618 CFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSM 677
               +     S+S D  ++ WD    E  Q+   H+S+V ++AI    S ++S S D ++
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 678 RVW 680
           +VW
Sbjct: 132 KVW 134

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 69/156 (44%), Gaps = 12/156 (7%)

Query: 87  DETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIW 146
           D   +++AG  D ++K W+L    +   F GH   V  +     GT + S  +D +I++W
Sbjct: 164 DSVTVISAGN-DKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLW 222

Query: 147 DLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAKDGLIKLWDLKTQQCVE------THIA 200
           +L  +  ++ L +  +     +     WL +    G IK++ L  Q  V+          
Sbjct: 223 NLAEKKAMYTLSAQDEVFALAFSPNRYWLAAATASG-IKIFCLDPQSLVDDLRPEFAGYN 281

Query: 201 QTGECWALGVH----GDLVVTTGTDSQIKIWNLDTS 232
           ++ E  A+ +     G  +    TDS I++W + T+
Sbjct: 282 KSAEPHAVSLAWSADGQTLFAGYTDSVIRVWQVMTA 317

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 64/158 (40%), Gaps = 18/158 (11%)

Query: 88  ETNLLAAGYADGVIKIWDLMS-----KTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSD 142
           + NLL +G  D  +  W L          + SF GH   V        G   +S S D  
Sbjct: 29  QPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKT 88

Query: 143 IIIWDLVSEVGVFKLRSHKDAITGIWCEGE-DWLVSTAKDGLIKLWDLKTQQCVETHIAQ 201
           + +WD+ +     +   HK  +  +  + +   ++S ++D  IK+W +K  QC+ T +  
Sbjct: 89  LRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGH 147

Query: 202 TGECWALGVH---------GDLVVTTGTDSQIKIWNLD 230
               W   V             V++ G D  +K WNL+
Sbjct: 148 ND--WVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLN 183

>TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.534
           YPR178W
          Length = 477

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 116/279 (41%), Gaps = 30/279 (10%)

Query: 432 CKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADK 491
            K  P   L   G+ +G I + D +          AH   I  ++ + D   L TG  D 
Sbjct: 194 VKLAPQSKLLASGSWDGAISIVDNMNLERKTHFQAAHVGKIGGIEWSNDEAYLFTGGEDC 253

Query: 492 SIKFWNFSIEQ----DLVPGTTD-----KFVPVMKLI----HDTTLELND---------- 528
            +K + +        D + G        K  P+ K +     D T  L D          
Sbjct: 254 LVKVFGYEKNDLTSIDTLKGHQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEILLQ 313

Query: 529 -----DILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKL 583
                +I S+    +    A +  D+   ++ L S K  ++L GH  P+ S+D + +   
Sbjct: 314 EGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQ 373

Query: 584 IITSSADKNIKIWGLDFGDCH-KSLFAHQDSIMNVCFLPESHNF-FSSSKDGLVKYWDGD 641
           + T S D  IKIW L   + +  S+FAH++ + +V +   +  F FS+  D L+K  D  
Sbjct: 374 LATGSGDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIHDSK 433

Query: 642 KFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVW 680
            +E V  L  H  ++  L  +   + +VSS  D ++++W
Sbjct: 434 TYESVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIW 472

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 89/189 (47%), Gaps = 19/189 (10%)

Query: 49  LWDI-KTGELLSVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLM 107
           LWDI K  E+L             ++     E+  L +H + +L A    D +  IWDL 
Sbjct: 301 LWDIEKKKEIL-------------LQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLR 347

Query: 108 SKTVLLSFSGHKSGVTILKFDSTGTRLMSGSRDSDIIIWDLVS-EVGVFKLRSHKDAITG 166
           S   +++  GH   +  L +   G +L +GS D  I IWDL + E     + +HK+ +T 
Sbjct: 348 SGKNIMNLIGHAKPIYSLDWAPNGYQLATGSGDGTIKIWDLRNKESNCASIFAHKNLVTS 407

Query: 167 IWCEGED--WLVSTAKDGLIKLWDLKTQQCVETHIAQTGECWALGVH--GDLVVTTGTDS 222
           +  E  +  ++ S   D LIK+ D KT + V T    T +   L      +L+V++G D 
Sbjct: 408 VQYEKNNGGFVFSAGYDKLIKIHDSKTYESVATLEGHTEKILTLDTSPISNLIVSSGWDR 467

Query: 223 QIKIWNLDT 231
            +KIW+ D 
Sbjct: 468 TVKIWDNDN 476

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 88/215 (40%), Gaps = 12/215 (5%)

Query: 69  SIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKSGVTILKFD 128
           SID        V+ ++ H     L +   D   ++WD+  K  +L   GH   +  L F 
Sbjct: 267 SIDTLKGHQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEILLQEGHSKEIFSLAFH 326

Query: 129 STGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGI-WCEGEDWLVSTAKDGLIKLW 187
           + G+   +   DS  +IWDL S   +  L  H   I  + W      L + + DG IK+W
Sbjct: 327 TDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLATGSGDGTIKIW 386

Query: 188 DLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIVEKGTYEK 247
           DL+ ++           C ++  H +LV +   +     +      +   KI +  TYE 
Sbjct: 387 DLRNKES---------NCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIHDSKTYES 437

Query: 248 QSKQRGLSVNFKT--TADETTFLYIQNSDKTVEIF 280
            +   G +    T  T+  +  +     D+TV+I+
Sbjct: 438 VATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIW 472

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 94/220 (42%), Gaps = 20/220 (9%)

Query: 384 KGHRTXXXXXXXXXXNKLLASAS-NGLLKIWNLKTKSCIRTFDCGYA---LTCKFLPSGT 439
           KGH+            K L S+S +   ++W+++ K  I     G++    +  F   G+
Sbjct: 272 KGHQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEI-LLQEGHSKEIFSLAFHTDGS 330

Query: 440 LCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKFWNFS 499
           L      +    ++DL +   I ++ + H   I+SLD   +G +L TGS D +IK W+  
Sbjct: 331 LTATAGFDSIGMIWDLRSGKNIMNL-IGHAKPIYSLDWAPNGYQLATGSGDGTIKIWDLR 389

Query: 500 IEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSM 559
            ++               L+     E N+            ++  +  D  +K+    + 
Sbjct: 390 NKE----SNCASIFAHKNLVTSVQYEKNNG----------GFVFSAGYDKLIKIHDSKTY 435

Query: 560 KFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLD 599
           +   +L GH   +L++D S  S LI++S  D+ +KIW  D
Sbjct: 436 ESVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIWDND 475

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 90/212 (42%), Gaps = 14/212 (6%)

Query: 73  KSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSK--TVLLSFSGHKSGVTILKFDST 130
           +++   ++  +E+ ++   L  G  D ++K++       T + +  GH+  V+ +K    
Sbjct: 227 QAAHVGKIGGIEWSNDEAYLFTGGEDCLVKVFGYEKNDLTSIDTLKGHQGRVSDVKLHPL 286

Query: 131 GTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK-DGLIKLWDL 189
           G  L S S D+   +WD+  +  +     H   I  +    +  L +TA  D +  +WDL
Sbjct: 287 GKYLGSSSFDNTWRLWDIEKKKEILLQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDL 346

Query: 190 KTQQCVETHIAQTGECWAL--GVHGDLVVTTGTDSQIKIWNLDTSKENGSKIVEKGTYEK 247
           ++ + +   I      ++L    +G  + T   D  IKIW+L   + N + I        
Sbjct: 347 RSGKNIMNLIGHAKPIYSLDWAPNGYQLATGSGDGTIKIWDLRNKESNCASIFA------ 400

Query: 248 QSKQRGLSVNFKTTADETTFLYIQNSDKTVEI 279
               + L  + +   +   F++    DK ++I
Sbjct: 401 ---HKNLVTSVQYEKNNGGFVFSAGYDKLIKI 429

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 79/171 (46%), Gaps = 14/171 (8%)

Query: 72  VKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSF-SGHKSGVTILKFDST 130
           V + +P  V  L    ++ LLA+G  DG I I D M+      F + H   +  +++ + 
Sbjct: 185 VIAERPVSVVKLA--PQSKLLASGSWDGAISIVDNMNLERKTHFQAAHVGKIGGIEWSND 242

Query: 131 GTRLMSGSRDSDIIIW-----DLVSEVGVFKLRSHKDAITGIWCEG-EDWLVSTAKDGLI 184
              L +G  D  + ++     DL S   +  L+ H+  ++ +       +L S++ D   
Sbjct: 243 EAYLFTGGEDCLVKVFGYEKNDLTS---IDTLKGHQGRVSDVKLHPLGKYLGSSSFDNTW 299

Query: 185 KLWDLKTQQCVETHIAQTGECWALGVH--GDLVVTTGTDSQIKIWNLDTSK 233
           +LWD++ ++ +      + E ++L  H  G L  T G DS   IW+L + K
Sbjct: 300 RLWDIEKKKEILLQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGK 350

>KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 73.2 bits (178), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 103/224 (45%), Gaps = 23/224 (10%)

Query: 467 AHNAAIWSLDITQDGKR--LVTGSADKSIKFWNFSIEQDLVPGTTDKF-VPVMKLIHDTT 523
            HN  + SL  T  G+   LV+ S DK++  W  +       G   KF VPV      + 
Sbjct: 15  GHNGWVTSL-ATSAGQPNLLVSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHSH 66

Query: 524 LELNDDILSVKISPEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKL 583
           +     +  V ++P+  Y   +  D T++++ + + + +    GHK  V+S+ I   + +
Sbjct: 67  I-----VQDVTLTPDGAYALSASWDKTLRLWDVATGETYQRFVGHKGDVMSVAIDRKASM 121

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVCFLP-ESHN-----FFSSSKDGLVKY 637
           II+ S DK+IK+W +  G C  +L  H D +  V   P E  N       S+  D +VK 
Sbjct: 122 IISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPTEKENDDTVTVISAGNDKMVKA 180

Query: 638 WDGDKFECVQKLAAHQSEVWALAITSDGSTVVSSSHDHSMRVWK 681
           W+ ++F+       H + V  +  + DG+ + S+     + +W 
Sbjct: 181 WNLNQFQIEADFVGHNANVNTITASPDGTLIASADKSGEIMLWN 224

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 63/259 (24%), Positives = 109/259 (42%), Gaps = 32/259 (12%)

Query: 436 PSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQDGKRLVTGSADKSIKF 495
           P G   +  + +  ++L+D+ T    +   V H   + S+ I +    +++GS DKSIK 
Sbjct: 75  PDGAYALSASWDKTLRLWDVATGETYQRF-VGHKGDVMSVAIDRKASMIISGSRDKSIKV 133

Query: 496 WNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDKYL--AVSLL----DN 549
           W     Q L