Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0B044901.82ON1940189785990.0
Kpol_2000.661.82ON193084622070.0
TDEL0C061901.82ON1879113521520.0
Suva_14.711.82ON1948111021140.0
Skud_14.691.82ON1946111221030.0
Smik_14.661.82ON1952111221010.0
YNL271C (BNI1)1.82ON1953111920900.0
NCAS0A005901.82ON1946111320790.0
CAGL0J08206g1.82ON1898110720590.0
ZYRO0F16676g1.82ON199499920210.0
KAFR0D039501.82ON195762319920.0
TBLA0A054401.82ON217068619990.0
NDAI0F042201.82ON202262019800.0
KNAG0F004701.82ON202866919510.0
SAKL0C02618g1.82ON198862918700.0
Kwal_33.133921.82ON196866118610.0
AFR669W1.82ON191853918080.0
KLTH0F02376g1.82ON197665717950.0
Ecym_10861.82ON209155617750.0
KLLA0C02321g1.82ON184260417220.0
SAKL0E15224g5.717ON13354588485e-92
Ecym_5679na 1ON13064287923e-85
CAGL0H06765g5.717ON12945047881e-84
KLLA0F10912g5.717ON12834777852e-84
TDEL0F055605.717ON12924797791e-83
NCAS0G001205.717ON13144797782e-83
Skud_9.85.717ON13744927731e-82
Ecym_40045.717ON14544187732e-82
Smik_9.95.717ON13744957703e-82
AFR301C5.717ON16554367744e-82
AGL364Cna 1ON12604207602e-81
KLTH0E00704g5.717ON13894147623e-81
YIL159W (BNR1)5.717ON13754907589e-81
Kpol_416.105.717ON14914207492e-79
ZYRO0B16654g5.717ON14244207473e-79
KNAG0L022505.717ON13674917453e-79
Kwal_55.196205.717ON13894147294e-77
NDAI0F001605.717ON13494157034e-74
Suva_9.265.717ON13754216982e-73
KAFR0D021205.717ON13244156944e-73
TPHA0E001205.717ON16424936975e-73
TBLA0E018105.717ON14514806617e-69
KLTH0H11968g1.394ON47745820.81
KAFR0A055704.315ON122353811.6
Kwal_54.19470singletonON542100782.6
ADL116C7.222ON43569782.7
Kwal_27.12438singletonON641100783.0
Kwal_33.15089singletonON478100774.0
Kwal_13.691singletonON865100774.6
Kwal_39.16409singletonON734100756.0
Kwal_50.19418singletonON348100756.2
NCAS0E009903.452ON432198747.8
Kwal_27.11219singletonON744100748.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0B04490
         (1940 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...  3316   0.0  
Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...   854   0.0  
TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_...   833   0.0  
Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...   818   0.0  
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...   814   0.0  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...   813   0.0  
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...   809   0.0  
NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {...   805   0.0  
CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...   797   0.0  
ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...   783   0.0  
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....   771   0.0  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...   774   0.0  
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}           767   0.0  
KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON}     756   0.0  
SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] ...   724   0.0  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...   721   0.0  
AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...   701   0.0  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...   696   0.0  
Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON...   688   0.0  
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...   667   0.0  
SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa...   331   5e-92
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...   309   3e-85
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...   308   1e-84
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...   306   2e-84
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...   304   1e-83
NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717      304   2e-83
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   302   1e-82
Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to ...   302   2e-82
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   301   3e-82
AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON} ...   302   4e-82
AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON} Sy...   297   2e-81
KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some si...   298   3e-81
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...   296   9e-81
Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] ...   293   2e-79
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...   292   3e-79
KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] ...   291   3e-79
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...   285   4e-77
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717     275   4e-74
Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (R...   273   2e-73
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....   271   4e-73
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...   273   5e-73
TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {...   259   7e-69
KLTH0H11968g Chr8 complement(1023447..1024880) [1434 bp, 477 aa]...    36   0.81 
KAFR0A05570 Chr1 (1112905..1116576) [3672 bp, 1223 aa] {ON} Anc_...    36   1.6  
Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -...    35   2.6  
ADL116C Chr4 complement(481043..482350) [1308 bp, 435 aa] {ON} S...    35   2.7  
Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON} YOR3...    35   3.0  
Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {...    34   4.0  
Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON} YB...    34   4.6  
Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A ...    33   6.0  
Kwal_50.19418 s50 complement(1189..2235) [1047 bp, 348 aa] {ON} ...    33   6.2  
NCAS0E00990 Chr5 complement(185805..187103) [1299 bp, 432 aa] {O...    33   7.8  
Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {...    33   8.5  

>TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_1.82
            YNL271C
          Length = 1940

 Score = 3316 bits (8599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1657/1897 (87%), Positives = 1657/1897 (87%)

Query: 26   LLHNLKKLXXXXXXXXXXXAINKSDISSPKSQLLTNKLSMDDLKPLNKRTSLNNQNLSQY 85
            LLHNLKKL           AINKSDISSPKSQLLTNKLSMDDLKPLNKRTSLNNQNLSQY
Sbjct: 26   LLHNLKKLTNSSSTTSQNNAINKSDISSPKSQLLTNKLSMDDLKPLNKRTSLNNQNLSQY 85

Query: 86   INGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSASVQXXXXXXXXXXXXXXX 145
            INGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSASVQ               
Sbjct: 86   INGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSASVQSSAKYSYSRRSSNST 145

Query: 146  XXXXXXXQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEELMYKR 205
                   QSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEELMYKR
Sbjct: 146  AATRLSRQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEELMYKR 205

Query: 206  NILQALSPDKQRDIMNYDTKKKWMIVKQDLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 265
            NILQALSPDKQRDIMNYDTKKKWMIVKQDLQ                             
Sbjct: 206  NILQALSPDKQRDIMNYDTKKKWMIVKQDLQNELKRIKLKNNNINNSDTTIIPSSMPSSN 265

Query: 266  XXXXXXVNTMDNNLRTIDTNASNPRIHRKGQKSMSSLSNATTTAPSGVNAEYSKIRSISE 325
                  VNTMDNNLRTIDTNASNPRIHRKGQKSMSSLSNATTTAPSGVNAEYSKIRSISE
Sbjct: 266  ISERSSVNTMDNNLRTIDTNASNPRIHRKGQKSMSSLSNATTTAPSGVNAEYSKIRSISE 325

Query: 326  SSDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRC 385
            SSDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRC
Sbjct: 326  SSDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRC 385

Query: 386  IYKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTR 445
            IYKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTR
Sbjct: 386  IYKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTR 445

Query: 446  KMALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKI 505
            KMALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKI
Sbjct: 446  KMALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKI 505

Query: 506  FQAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQ 565
            FQAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQ
Sbjct: 506  FQAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQ 565

Query: 566  RVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQD 625
            RVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQD
Sbjct: 566  RVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQD 625

Query: 626  PTSLIGSLWEVCKGTENEKXXXXXXXXXXXXXXKLVDDKREPAKLSKQLKLMDSLMTNIT 685
            PTSLIGSLWEVCKGTENEK              KLVDDKREPAKLSKQLKLMDSLMTNIT
Sbjct: 626  PTSLIGSLWEVCKGTENEKLLLSLMQHLFLSSSKLVDDKREPAKLSKQLKLMDSLMTNIT 685

Query: 686  ASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAEN 745
            ASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAEN
Sbjct: 686  ASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAEN 745

Query: 746  GLVGQXXXXXXQRDNILTKSQRVTKQLQAXXXXXXXXXXXXXXXXXXXXXXILTIVNTNT 805
            GLVGQ      QRDNILTKSQRVTKQLQA                      ILTIVNTNT
Sbjct: 746  GLVGQLELELEQRDNILTKSQRVTKQLQAELEDLKKKHLLEKHEHEVELRKILTIVNTNT 805

Query: 806  DADASLNNSSDKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEK 865
            DADASLNNSSDKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEK
Sbjct: 806  DADASLNNSSDKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEK 865

Query: 866  EARELEMTNFSEHQKLSLESPAVLNXXXXXXXXXXXXXXXXXXXXXXNNRKRANAIKKQK 925
            EARELEMTNFSEHQKLSLESPAVLN                      NNRKRANAIKKQK
Sbjct: 866  EARELEMTNFSEHQKLSLESPAVLNKTKKETKKKSKKKSKSSKSKEENNRKRANAIKKQK 925

Query: 926  LLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFDPND 985
            LLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFDPND
Sbjct: 926  LLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFDPND 985

Query: 986  FKQAQLDSNASYESLDPNFVTKKITDIDRIADELDAFXXXXXXXXXXXXXXXXEKNYYES 1045
            FKQAQLDSNASYESLDPNFVTKKITDIDRIADELDAF                EKNYYES
Sbjct: 986  FKQAQLDSNASYESLDPNFVTKKITDIDRIADELDAFSGDGTSSYSSSSLSDSEKNYYES 1045

Query: 1046 NAVPTIGPQKGLIDGSSFLESLSEKYGTAQNTEGTSLSPLSPQNRIASLGEKSFMNRFKR 1105
            NAVPTIGPQKGLIDGSSFLESLSEKYGTAQNTEGTSLSPLSPQNRIASLGEKSFMNRFKR
Sbjct: 1046 NAVPTIGPQKGLIDGSSFLESLSEKYGTAQNTEGTSLSPLSPQNRIASLGEKSFMNRFKR 1105

Query: 1106 KPSSMQFLEELSQKVGGEALGKDNNETSDIXXXXXXXXXXXXXXXXXXXXXXVEAIDADL 1165
            KPSSMQFLEELSQKVGGEALGKDNNETSDI                      VEAIDADL
Sbjct: 1106 KPSSMQFLEELSQKVGGEALGKDNNETSDINNISSEEDNSSNSESELNNEPEVEAIDADL 1165

Query: 1166 TVSESKGAGAXXXXXXXXXEFPASLLPNATGGSTIPVXXXXXXXXXXXXXXXXXXXNVTE 1225
            TVSESKGAGA         EFPASLLPNATGGSTIPV                   NVTE
Sbjct: 1166 TVSESKGAGAPPPPPPPPPEFPASLLPNATGGSTIPVPPPPPPPPPPPALPASLSPNVTE 1225

Query: 1226 GSSIXXXXXXQFMGLNKMYRSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSI 1285
            GSSI      QFMGLNKMYRSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSI
Sbjct: 1226 GSSIPPPPPPQFMGLNKMYRSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSI 1285

Query: 1286 WSSAMAEQFADDLYEKGVLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINL 1345
            WSSAMAEQFADDLYEKGVLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINL
Sbjct: 1286 WSSAMAEQFADDLYEKGVLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINL 1345

Query: 1346 HMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKH 1405
            HMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKH
Sbjct: 1346 HMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKH 1405

Query: 1406 VEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRID 1465
            VEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRID
Sbjct: 1406 VEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRID 1465

Query: 1466 SAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYV 1525
            SAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYV
Sbjct: 1466 SAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYV 1525

Query: 1526 EKIIRENYPEFNGFIEELEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSK 1585
            EKIIRENYPEFNGFIEELEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSK
Sbjct: 1526 EKIIRENYPEFNGFIEELEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSK 1585

Query: 1586 FHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKF 1645
            FHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKF
Sbjct: 1586 FHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKF 1645

Query: 1646 ADFINEYKKARAQNLKAEEEVRKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAKG 1705
            ADFINEYKKARAQNLKAEEEVRKYERHKQMV            NYMETGVSDSESAEAKG
Sbjct: 1646 ADFINEYKKARAQNLKAEEEVRKYERHKQMVEEQQRKAKEQEKNYMETGVSDSESAEAKG 1705

Query: 1706 DNRGHMDKLLAQLKNAGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYS 1765
            DNRGHMDKLLAQLKNAGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYS
Sbjct: 1706 DNRGHMDKLLAQLKNAGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYS 1765

Query: 1766 PTTDKVVDTSLGEDEMILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDI 1825
            PTTDKVVDTSLGEDEMILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDI
Sbjct: 1766 PTTDKVVDTSLGEDEMILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDI 1825

Query: 1826 TXXXXXXXXXXXXVITDRAKALLMELRGSQTPSKKNSHLDDQXXXXXXXXXXXXQTFGEE 1885
            T            VITDRAKALLMELRGSQTPSKKNSHLDDQ            QTFGEE
Sbjct: 1826 TDDGNSNGDGEDEVITDRAKALLMELRGSQTPSKKNSHLDDQREKLRSRRNRRRQTFGEE 1885

Query: 1886 SNSTPSNRLTFVSDENSPTATEFVDADEDTLQENVPN 1922
            SNSTPSNRLTFVSDENSPTATEFVDADEDTLQENVPN
Sbjct: 1886 SNSTPSNRLTFVSDENSPTATEFVDADEDTLQENVPN 1922

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930 aa]
            {ON} (137817..142124,142127..143611) [5793 nt, 1931 aa]
          Length = 1930

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/846 (52%), Positives = 586/846 (69%), Gaps = 26/846 (3%)

Query: 295  GQKSMSSLSNATTTAPSGVNAEYSKIRSISESSDKTNIAPIHYVRKILSDTLSKNELNDL 354
            G  S +S +N+     S  N   S I     ++D+ N  PIHYV+KI++D L+  E+NDL
Sbjct: 296  GSSSTASGTNSMIYQSSENNKSVSSI-----ATDRINRPPIHYVKKIIADRLTSEEMNDL 350

Query: 355  WVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELIEKEYGFFKCFRVLA 414
            WVTLRTEQLDWVDAFLEHQGHIA+AN L+  IYK APGS L+ EL EKE+ FFKCFRVL+
Sbjct: 351  WVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVLS 410

Query: 415  MLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKMALEILVYIINKKNTQRFESVIMSLDRF 474
            ML QGLYEF KHKLM DT+A GLFS+R++TRKMA E+LV +I K+N  RFE V+ SLDR+
Sbjct: 411  MLSQGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLDRY 470

Query: 475  FRLSENLNMLKIITQFGGAFSRTSPDTQFKIFQAFVISLESTLNGRGKMGSKVGASDDFK 534
            FR  ENLNM+ +     G + +++P+T++KI QA++I+L+ TLNGRGKMGS VGASDD++
Sbjct: 471  FRQEENLNMVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDDYR 530

Query: 535  VSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTKLKLMDYEKMT 594
             S GENAILEYCLW ++FIN LC+ S  LNQR++LRTK ENLG LR+MTKLK +DYEK+T
Sbjct: 531  -SAGENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLT 589

Query: 595  VQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEKXXXXXXXXXX 654
             Q+E Y+++KLDDFN++LE +S ++++NMQ+P SLI +LWE CKG++NEK          
Sbjct: 590  EQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKLLLSLIQHLY 649

Query: 655  XXXXKLVDDKREPAKLSKQLKLMDSLMTNITASEVDEQTHMNLAIQRLYDSMQTDDVARR 714
                KL+ +K +P KLSKQLKL+DSL+TN+  S  DE++HMNLAIQRLYDSMQTD+VARR
Sbjct: 650  LSSSKLMGEKEDPTKLSKQLKLIDSLLTNVNGSMFDEESHMNLAIQRLYDSMQTDEVARR 709

Query: 715  AILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQXXXXXXQRDNILTKSQRVTKQLQA 774
            AILE+RTL+KKLEE  AE++YL  KLS AENGLVGQ      QRDNIL K+QRV KQL++
Sbjct: 710  AILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMKQLES 769

Query: 775  XXXXXXXXXXXXXXXXXXXXXXILTIVNT-----NTDA-DASLNNSSDKKHNIQKALETE 828
                                  +LTI+N+     N D  D ++    +KK +IQKALE E
Sbjct: 770  ELEDLKKKHLLEKHEHEVELRKMLTILNSRNGTQNPDVDDVTITLDPNKKLDIQKALELE 829

Query: 829  LSRTKKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAV 888
            L++TKKDL+ND K+FGI+VQPNKRL+MLR+QMEDIE EAR+LEMTNF++H++ +L+ P +
Sbjct: 830  LNKTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNLKKPVI 889

Query: 889  LNXXXXXXXXXXXXXXXXXXXXXXNNRKRANAIKKQKLLELRRDLAMIQAETNDVSKFNV 948
            +                           + N +K +KL++LR+ LA IQ+ETND+SKFNV
Sbjct: 890  VKKEKKLRKKKKINTEEFD---------KENEMKTKKLMQLRKALAAIQSETNDISKFNV 940

Query: 949  DKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFDP-NDFKQAQLDSNASYESLDPNFVTK 1007
            + RVNE+F++KK +AL RL+ LE KYK FEI FD   D    +LD    + +LDP ++ K
Sbjct: 941  EGRVNEMFQDKKLKALQRLKQLEAKYKDFEIPFDELQDLDDRELDDEQQHSTLDPTYLQK 1000

Query: 1008 KITDIDRIADELDA--FXXXXXXXXXXXXXXXXEKNYYESNAVPTI--GPQKGLIDGSSF 1063
            KI ++D I+DEL    +                E +   ++++ ++   P KG+ +  SF
Sbjct: 1001 KINELDEISDELYLMNYDSDANNGNTSDSSSSSEADGDGTDSMRSVSNAPSKGISEAGSF 1060

Query: 1064 LESLSEKYGTAQNTEGTSLSPLSPQNRIASLGEKSFMNRFKRKPSSMQFLEELSQKVGGE 1123
            LESLS+KYGT QN   +  S  SP  RIAS GEKSFMNR KR+  +  FLEEL+QKV   
Sbjct: 1061 LESLSQKYGTGQNAISSPTSITSPNERIASQGEKSFMNRLKRQTMAAPFLEELTQKVNDT 1120

Query: 1124 ALGKDN 1129
            +   DN
Sbjct: 1121 SSIDDN 1126

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/674 (59%), Positives = 493/674 (73%), Gaps = 48/674 (7%)

Query: 1237 FMGLNKMYRSGDGSQILNESPSLYS-----KYPRPQKKLKQLHWDKLDDSEGSIWSSAMA 1291
             MG  + Y+S      + + PSL       + PRPQKKLKQLHWDKLD ++ SIWS  MA
Sbjct: 1246 MMGKKEPYKS------VVDQPSLLQLTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMA 1299

Query: 1292 EQFADDLYEKGVLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSL 1351
            E+FADDLYEKGVL NLEKAFAAREIKS+  +KKEDL KISFLS DISQQFGINLHM+GSL
Sbjct: 1300 ERFADDLYEKGVLRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSL 1359

Query: 1352 TVDELVIKILKCNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKA 1411
             V EL+ K+LKC+R+++NTPSVIEFL+K EI +VS+NLARNYAPY TDWEGVK ++  K 
Sbjct: 1360 AVPELIEKVLKCDRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQKF 1419

Query: 1412 PEKSVDGLQRADQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAI 1471
             ++ +    R    ++  MVNLQSYW SRMRA+KVITSYE+EY ELVTKLR++D AV A+
Sbjct: 1420 -QRRIQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAV 1478

Query: 1472 QKSDNLTNLFNVILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRE 1531
            Q+S+NL N+FNVILAVGNYMND+SKQAQGFKL+TLQRLTFIKD+TNSMTFLNYVEKI+R+
Sbjct: 1479 QRSENLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRD 1538

Query: 1532 NYPEFNGFIEELEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDK 1591
            NYP FN FI++LEPVLDVVK+SVEQL++DCNEF+QSI+NVERSLEIGNLSDSSKFHP DK
Sbjct: 1539 NYPSFNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDK 1598

Query: 1592 VITKVLPVLPEATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINE 1651
            V+TKVLPVLPEA KKS LLTDEVKLT MEFEALM+K+GED+GDKFA+NSFFKKFADFI E
Sbjct: 1599 VLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGDKFAKNSFFKKFADFITE 1658

Query: 1652 YKKARAQNLKAEEEVRKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGHM 1711
            YKKA++QNLK EEE R YE+HK+M+               E    + E  E + D R  M
Sbjct: 1659 YKKAQSQNLKQEEEERAYEKHKRMIEEQQHKQDLEEERSREV---EGEPGEEQSDRRAMM 1715

Query: 1712 DKLLAQLKNAGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKV 1771
            DKLL +LKNAGP ++DPSSARKRA++RKKLL++K+ T+ IL D++ GD SI+YSP T   
Sbjct: 1716 DKLLEKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNT--- 1772

Query: 1772 VDTSLGEDEMILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXX 1831
              T  G +++ L SPTP  K +L   + S             E   D  AE +       
Sbjct: 1773 -PTQEGPNDIHLASPTPSGKSDLVLASVSPTK----------ESTADGIAEDEF------ 1815

Query: 1832 XXXXXXXVITDRAKALLMELRGSQTPSKKNSHLDDQXXXXXXXXXXXXQTFGEESNSTPS 1891
                    I+DRAKALL+ELRGS+   K+NS L++Q                 ++ S  S
Sbjct: 1816 --------ISDRAKALLLELRGSEN-MKRNSQLEEQKEKLKARRSRRRT----QTESISS 1862

Query: 1892 NRLTFVSDENSPTA 1905
            N+L F  +E+  T+
Sbjct: 1863 NKLFFTDEESHSTS 1876

 Score =  152 bits (383), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 90/211 (42%), Positives = 121/211 (57%), Gaps = 19/211 (9%)

Query: 26  LLHNLKKLXXXXXXXXXXXAINKSDISSPKSQLLTNKLSMDDLKPLNKRTSLNNQNLSQY 85
           LL NLKK            +INK+DISSPK  ++  + +  +L+PLNK+++LN QNLSQY
Sbjct: 22  LLQNLKK--ITNSSSNSSTSINKADISSPKKPIVPKQFTSTELRPLNKKSTLNTQNLSQY 79

Query: 86  INGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSASVQXXXXXXXXXXXXXXX 145
           ++G   K   D               N N    ++ +H R+ S Q               
Sbjct: 80  VSGT--KIDQD---------------NPNPLPTNNTSHTRAHSSQSATKYSYSRRSSTAT 122

Query: 146 XXXXXXXQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEELMYKR 205
                  Q T  S  + SV SQGSY NL KY+DS+G++NL+MP D HE+E+LFE+LMYKR
Sbjct: 123 GPIKLSRQQTTQSLGSSSVLSQGSYTNLLKYIDSDGKINLEMPRDPHEVEALFEDLMYKR 182

Query: 206 NILQALSPDKQRDIMNYDTKKKWMIVKQDLQ 236
           NI QAL  DKQ+++M+YD  KKW +VKQDLQ
Sbjct: 183 NIFQALPQDKQKELMSYDVTKKWTLVKQDLQ 213

>TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_1.82
            YNL271C
          Length = 1879

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1135 (43%), Positives = 670/1135 (59%), Gaps = 100/1135 (8%)

Query: 26   LLHNLKKLXXXXXXXXXXXAINKSDISSPKSQLLTNKLS-MDDLKPLNKRTSLNNQNLSQ 84
            LL NLK+             I  SDISSP+   + +++S  +DL+PLNK++++N QNLS 
Sbjct: 26   LLSNLKRFAGSSGSQSGSQRIETSDISSPRKVSVPSRVSNANDLRPLNKKSTMNTQNLSH 85

Query: 85   YINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSASVQXXXXXXXXXXXXXX 144
            Y+NGK     S +  L                   S NH+RS SVQ              
Sbjct: 86   YMNGK-----SSAESL-------------------SSNHSRSPSVQSSTKYTYSRRSSSH 121

Query: 145  XXX----XXXXXQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEE 200
                        + TN S S+ SV SQ S++NL+ +M  +G++ LDMP+ +HE+E+LFE+
Sbjct: 122  LSTPGVNSTLTREPTNQSLSSSSVLSQDSFSNLAIFMTPDGKIKLDMPS-SHEVENLFED 180

Query: 201  LMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQXXXXXXXXXXXXXXXXXXXXXXXX 260
            +MYKRNILQ LSPDKQ+++M+YD  KKW+IVKQDLQ                        
Sbjct: 181  MMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFKKLLAKGVPAAHAAISSSNSD 240

Query: 261  XXXXXXXXXXXVNTM--DNNLRTIDTNASNPRIHRKGQKSMSSLSNATTTAPSGVNAEYS 318
                        ++M  ++  + I  N +N               N +++ P+  N   S
Sbjct: 241  SLPSSLKVSSPRSSMTYESIQQAIKFNKTN---------------NGSSSGPASNNK--S 283

Query: 319  KIRSISE--------SSDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFL 370
            K++ +S+        +++K N  PIHYV++I++D L+ NE+NDLWVTLRTEQLDWVD FL
Sbjct: 284  KLQQLSDKNSSTSTLTTEKINRPPIHYVKRIIADKLTGNEMNDLWVTLRTEQLDWVDGFL 343

Query: 371  EHQGHIAIANNLIRCIYKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMM 430
            EHQGHIA+AN L   IYKT P + LS +L+EKE+ FF+CFRVL++L QGLYE ++H +M 
Sbjct: 344  EHQGHIAMANVLTTSIYKTDPETPLSYDLLEKEHAFFRCFRVLSVLTQGLYELSRHNIMA 403

Query: 431  DTLAFGLFSTRVSTRKMALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQF 490
            +T+A GLFS R++TRKMA EI V ++ KKN  RFE+V+ +LD+ F++ ENL+ML  +   
Sbjct: 404  ETVANGLFSVRLATRKMATEIFVCMLEKKNKVRFEAVLNALDKKFKIGENLHMLHYMKNS 463

Query: 491  GGAFSRTSPDTQFKIFQAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWAL 550
               FS  + D+QFKI Q+++ ++E +L GRGKMGS VGAS+DFK SGGENAILEY  W +
Sbjct: 464  PQHFSHFTRDSQFKIVQSWLFAVEQSLEGRGKMGSLVGASEDFKASGGENAILEYSQWTM 523

Query: 551  IFINKLCNFSDELNQRVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNS 610
            +FIN  CN +D +NQR++LRT+ EN GGLR+M + KL+DY+K+   VE YE+ KLDD NS
Sbjct: 524  VFINHFCNGTDVINQRILLRTRLENAGGLRIMNQFKLLDYDKVMELVEAYENLKLDDLNS 583

Query: 611  LLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEKXXXXXXXXXXXXXXKLVDDKREPAKL 670
            +LE  + ++ I+M D  SL+  L++ CKGTE+EK              +L++D ++P KL
Sbjct: 584  VLETGAHASDIDMNDSASLLKKLFDYCKGTESEKLLNSLVKHLFLSTSRLMEDNQDPTKL 643

Query: 671  SKQLKLMDSLMTNITASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVT 730
            SKQL+LMDSL+TN++ S VDE + +N+AIQRLYDSMQTD+VARRAILE+RTL+KKLEE  
Sbjct: 644  SKQLRLMDSLVTNVSVSAVDESSSINMAIQRLYDSMQTDEVARRAILESRTLTKKLEEAQ 703

Query: 731  AEKEYLKEKLSKAENGLVGQXXXXXXQRDNILTKSQRVTKQLQAXXXXXXXXXXXXXXXX 790
            AE+++L +KLSK  NGLVGQ      QRD+IL K+QRVT QLQ                 
Sbjct: 704  AERDFLSQKLSKTGNGLVGQLEKEVQQRDDILEKNQRVTLQLQDELEELKKKHLLEKHEH 763

Query: 791  XXXXXXILTIVNTNTDADASLNNS-----------SDKKHNIQKALETELSRTKKDLNND 839
                  +LTI+N+  + D S   S            DKK  IQ+AL+  L +TKKDL+ D
Sbjct: 764  EVELRKMLTILNSRPEGDLSRKGSVHSKAQPGILDPDKKSTIQQALQDGLLKTKKDLSVD 823

Query: 840  VKKFGISVQPNKRLRMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNXXXXXXXXX 899
             K+FGI+VQPNKRL+MLRLQMEDIE+EARELEMTNF++H K  L++P  +          
Sbjct: 824  SKRFGITVQPNKRLKMLRLQMEDIEQEARELEMTNFADHNKAVLQAPVKVE--------- 874

Query: 900  XXXXXXXXXXXXXNNRKRANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEK 959
                          N  RA  +K  KL ELR+ LA IQ E+N VSKFNV++RVNELFK+K
Sbjct: 875  ------SSNYVRKENELRAKELKANKLSELRKALADIQKESNGVSKFNVEERVNELFKQK 928

Query: 960  KHEALNRLQMLEKKYKSFEID----FDPNDFKQAQLDSNASYE---SLDPNFVTKKITDI 1012
            K  AL+RL  LE  YK + ID    F   D  Q   +S  + E   +LDP     K+ +I
Sbjct: 929  KLSALDRLNDLENMYKEYGIDLSTHFPIQDEPQESAESEKNAEGPSTLDPRAYQAKLDEI 988

Query: 1013 DRIADELDAFXXXXXXXXXXXXXXXXEKNYYESNAVPTIGPQKGLID-------GSSFLE 1065
            DRI+ EL                    K   + + +   G    +++        SSFLE
Sbjct: 989  DRISKELIEMKSELKNDKALRRHESPSKQDTDDDEIQDTG---SMVNEDLQSSGTSSFLE 1045

Query: 1066 SLSEKYGTAQNTEGTSLSPLSPQNRIASLGEKSFMNRFKRKPSSMQFLEELSQKV 1120
            SLS+KYGT +N      + +   +       +SFM R K+      +LEEL  KV
Sbjct: 1046 SLSQKYGTGKNATNMLTNDILNSSERKGHSRQSFMERMKKPSGVPAYLEELPLKV 1100

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/629 (61%), Positives = 479/629 (76%), Gaps = 46/629 (7%)

Query: 1237 FMGLNKMYRSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFAD 1296
             +G    YR+   S +L +SPSL+S YPR +KKLKQLHW+KLD ++ SIWSS  AE+FA 
Sbjct: 1228 LLGQKMAYRTAVPSPLLPQSPSLFSSYPRARKKLKQLHWEKLDATDNSIWSSGKAEKFAG 1287

Query: 1297 DLYEKGVLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDEL 1356
            DLYEKGVL +LEKAFAAREIKSLA KK+EDLDKI+FLSRD+SQQFGINLHM+  L+V+EL
Sbjct: 1288 DLYEKGVLEDLEKAFAAREIKSLATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVEEL 1347

Query: 1357 VIKILKCNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSV 1416
            V KILKC RD M+TPSV+EFLSKPEI +VS NLARNY+PY TDW+GV  VEDAK+PEK  
Sbjct: 1348 VTKILKCERDFMDTPSVLEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEKDP 1407

Query: 1417 DGLQRADQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDN 1476
              LQRADQ+Y+QL+ NLQ YW SRMRA++VITSYE+EY+ELVTKLR++D AV+ IQKS N
Sbjct: 1408 AELQRADQLYLQLIYNLQPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVIQKSTN 1467

Query: 1477 LTNLFNVILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEF 1536
            L N+FNVILAVGNYMNDS+KQAQGFKL+TLQRLTFIKD+ NSMTFLNYVEKI+R+NYP F
Sbjct: 1468 LRNVFNVILAVGNYMNDSAKQAQGFKLSTLQRLTFIKDANNSMTFLNYVEKIVRDNYPSF 1527

Query: 1537 NGFIEELEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKV 1596
            N F+E+L+PVLDVVKIS+EQL++DC EF+QSI NVERS++IGNL+DSSKFHPLDKV+ KV
Sbjct: 1528 NDFLEDLQPVLDVVKISIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHPLDKVLVKV 1587

Query: 1597 LPVLPEATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKAR 1656
            LPVLPEA+K+ +LL +EVKL+ MEFE+LMQ++GEDS DKFA+NSFFKKFADFINEYK+A+
Sbjct: 1588 LPVLPEASKRVELLDEEVKLSIMEFESLMQRYGEDSADKFAKNSFFKKFADFINEYKRAQ 1647

Query: 1657 AQNLKAEEEVRKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLA 1716
            AQNLKAEEE R Y+ HK+MV            +      ++ +++E   D R  MDKLL 
Sbjct: 1648 AQNLKAEEEERLYQTHKKMVEEQQKRAEEKERS---ENATEEDASEENEDRRAMMDKLLE 1704

Query: 1717 QLKNAGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSL 1776
            QLKNAGP ++DP SARKRA++RKK+L++ ++ S +LD +   D S+IYSP   + +    
Sbjct: 1705 QLKNAGPVKADPLSARKRAMIRKKMLNDSEAVSDVLDSIQQEDDSMIYSPEKQEGITNPT 1764

Query: 1777 GEDEMILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXXXX 1836
            G+     +SP+  + +N +                D E+                     
Sbjct: 1765 GDSS---QSPSKGAANNQQ----------------DEEE--------------------- 1784

Query: 1837 XXVITDRAKALLMELRGSQTPSKKNSHLD 1865
               ITDRAKALLM LRG ++PSK+N+ L+
Sbjct: 1785 ---ITDRAKALLMGLRGGESPSKRNNVLN 1810

>Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847 bp,
            1948 aa] {ON} YNL271C (REAL)
          Length = 1948

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/1110 (44%), Positives = 665/1110 (59%), Gaps = 100/1110 (9%)

Query: 69   KPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSAS 128
            +PLNK+ +LN QNLSQY+NGK+      SS                        H RS S
Sbjct: 83   RPLNKKATLNTQNLSQYMNGKISTDAPTSSQ-----------------------HARSHS 119

Query: 129  VQXXXXXXXXXXXXXXXXXXXXXXQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMP 188
            VQ                      Q T  S S  S+ S GS  NLSK+   +G+++L+MP
Sbjct: 120  VQSKYSYSKRTSSQASNKLTR---QHTGQSHSATSLLSLGSLTNLSKFTTPDGKIHLEMP 176

Query: 189  TDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQXXXXXXXXXXXX 248
            +D +E+E LFE++MYKRNI Q+LS DKQ ++M+Y T+KKW+IVKQDLQ            
Sbjct: 177  SDPYEVEVLFEDIMYKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKIRANTTS 236

Query: 249  XXXXXXXXXXXXXXXXXXXXXXXVNTMDNNLRTIDTNASNPR--IHRKGQKSMSSLSNAT 306
                                    +T+ +    + T+AS+P   ++       ++LS+  
Sbjct: 237  SSAASRTSIASDQHPILTAN----STLSSPKSALMTSASSPTSTVYSNTLNHSTTLSSVG 292

Query: 307  TTAPSG----------------VNAEYSKIRSISESS-----DKTNIAPIHYVRKILSDT 345
            T+ P G                +N+ Y     I+ S+     D+TN  PIHYV++IL+D 
Sbjct: 293  TSTPKGHNNKKTIAGGLKKQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADK 352

Query: 346  LSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELIEKEYG 405
            L+ +E+ DLWVTLRTEQLDWVDAF++HQGHIA+AN L+  IYKTAP  +L+ EL+EKE  
Sbjct: 353  LTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENS 412

Query: 406  FFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKMALEILVYIINKKNTQRFE 465
            FFKCFRVL+ML QGLYEF+ H+LM DT+A GLFST++ TRKMA EI V ++ KKN  RFE
Sbjct: 413  FFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFE 472

Query: 466  SVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIFQAFVISLESTLNGRGKMGS 525
            +V+ +LD+ FR+ +NL+M++   +    FS  + ++  KI QA++ ++E TL+GRGKMGS
Sbjct: 473  AVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGS 532

Query: 526  KVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTKL 585
             VGASD+FK  GGENAILEYC W ++FIN LC+ SD +NQR++LRTK EN G LR+M K+
Sbjct: 533  LVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKI 592

Query: 586  KLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEKX 645
            KL+DY+K+  Q+E Y+++KLDDFN  LE  + +  ++++DP SL+ +LWE+CKGT+NEK 
Sbjct: 593  KLLDYDKVIDQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKL 652

Query: 646  XXXXXXXXXXXXXKLVDDKREPAKLSKQLKLMDSLMTNIT-ASEVDEQTHMNLAIQRLYD 704
                         KL+++ + P+KLSKQLKLMDSL+TN++ AS  DE+++MN+AIQRLYD
Sbjct: 653  LVSLVQHLFLSSSKLIEENQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYD 712

Query: 705  SMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQXXXXXXQRDNILTK 764
            +MQTD+VARRAILE+RTL+KKLEE+ AE++ L EKL KAE+GLVGQ       RD IL K
Sbjct: 713  AMQTDEVARRAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAK 772

Query: 765  SQRVTKQLQAXXXXXXXXXXXXXXXXXXXXXXILTIVNT-----------NTDADASLNN 813
            +QRV +QL++                      +LTI+N+             D + SLN+
Sbjct: 773  NQRVMQQLESELEELKKKHLLEKHQQEVELRKMLTILNSRPEESSDLSKGTKDINPSLNS 832

Query: 814  SSDKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEKEARELEMT 873
            S  +K NIQK L+  LSR KKD  +D KKFG+++QPNKRL+MLR+QME+IE EAR+LEMT
Sbjct: 833  S--EKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMT 890

Query: 874  NFSEHQKLSLESPAVLNXXXXXXXXXXXXXXXXXXXXXXNNRKRANAIKKQKLLELRRDL 933
            NF+E +K  LE P  +                        N          KL +LRR L
Sbjct: 891  NFAEFEKERLEPPIEIKKPKIKHKKHKIKKSSVKTQGADMN----------KLNDLRRAL 940

Query: 934  AMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFDPNDF----KQA 989
            A IQ E+ND+SKFNV++RVNELF EKK  AL RL+ LE KYK F IDF+  +F    K+ 
Sbjct: 941  AEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEFIETPKKF 1000

Query: 990  QLD--SNASYESLDPNFVTKKITDIDRIADELDAFXXXXXXXXXXXXXXXXEKNYYES-- 1045
             +D  ++A+Y SLDP     K+ +I+RI DEL                   + +   S  
Sbjct: 1001 SVDEENDAAYPSLDPKAYQSKLDEINRITDELLDLQTQVKQETEEDEDEETKSSSSSSDA 1060

Query: 1046 -------NAVPTI---GPQKGLIDGS---SFLESLSEKYGTAQN-TEGTSLSPLSPQNRI 1091
                   +A P+    G    L  GS   SFL++LS+KYGT QN T    L        +
Sbjct: 1061 DDDEIYQDASPSQERRGEYSELSAGSGPGSFLDALSQKYGTGQNVTASAGLRDNRGSGHM 1120

Query: 1092 ASLGEKSFMNRFKRK-PSSMQFLEELSQKV 1120
             S  EKSF+NR ++   SS  +LEEL+QKV
Sbjct: 1121 PSNVEKSFINRLRKSTASSAPYLEELTQKV 1150

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/624 (63%), Positives = 481/624 (77%), Gaps = 30/624 (4%)

Query: 1245 RSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVL 1304
            +S   S +L +SPSL+ KYPRP KKLKQLHW+K+D ++ SIW S  AE+FADDLYEKGVL
Sbjct: 1330 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVL 1389

Query: 1305 HNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCN 1364
             +LEKAFAAREIKSLA K+KEDL K++FLSRDISQQFGINLHM+ SL+V +LV KILKC+
Sbjct: 1390 ADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCD 1449

Query: 1365 RDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQ 1424
            RD + TPSV+EFLSKPEIT+VS+NLARNYAPY TDWEG++ +EDAK PEK  + LQRADQ
Sbjct: 1450 RDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQ 1509

Query: 1425 IYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVI 1484
            IY+QLMVNL+ YW SRMRA+ V+TSYEKEY EL+ KLR++D AV A+Q+SDNL N+FNVI
Sbjct: 1510 IYLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNLRNVFNVI 1569

Query: 1485 LAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELE 1544
            LAVGN+MND+SKQAQGFKL+TLQRLTFIKD+ NSMTFLNYVEKIIR NYP FN F++ELE
Sbjct: 1570 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1629

Query: 1545 PVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEAT 1604
            PVLDVVK+S+EQLVNDC +F+QSI+NVERS+EIGNLSDSSKFHPLDKV+ K LPVLPEA 
Sbjct: 1630 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1689

Query: 1605 KKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEE 1664
            +K DLL DEVKLT MEFE+LMQ +GEDSGDKFA+ SFFKKFADF+NEYK+A++QNL AEE
Sbjct: 1690 RKGDLLEDEVKLTIMEFESLMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQSQNLAAEE 1749

Query: 1665 EVRKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPA 1724
            E R YE+HK+MV            +   + + +    E   D R  MDKLL QLKNAGPA
Sbjct: 1750 EERLYEKHKKMVEEQQKRAQDKEKHREHSALPEGNEEEETEDRRAVMDKLLEQLKNAGPA 1809

Query: 1725 RSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSP-TTDKVVDTSLGEDEMIL 1783
            +SDPSSARKRA++RKK +S+KD+++ +L+DLN  +GSI+YSP  T    DT +  +    
Sbjct: 1810 KSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVIHAE---- 1865

Query: 1784 KSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXXXXXXVITDR 1843
             SPTP +            +R    T +D+   +  +A  D               ITDR
Sbjct: 1866 -SPTPLA------------TRGFMNTPEDLPSPSKASALED------------QEEITDR 1900

Query: 1844 AKALLMELRGSQTPSKKNSHLDDQ 1867
            A+ LL ELRGS  P K+NS LD+ 
Sbjct: 1901 ARMLLKELRGSDAPVKQNSILDEH 1924

>Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {ON}
            YNL271C (REAL)
          Length = 1946

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/1112 (43%), Positives = 663/1112 (59%), Gaps = 102/1112 (9%)

Query: 69   KPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSAS 128
            +PLNK+++LN QNLSQY++GK+      SS                        H RS S
Sbjct: 82   RPLNKKSTLNTQNLSQYMSGKMSADVPISSQ-----------------------HARSHS 118

Query: 129  VQXXXXXXXXXXXXXXXXXXXXXXQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMP 188
            VQ                      Q T  S S  S+ SQGS  NLSK+   +G+++L+MP
Sbjct: 119  VQSKYSYSKRNSSQASNKLTR---QHTGQSHSASSLLSQGSLTNLSKFTTPDGKIHLEMP 175

Query: 189  TDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQXXXXXXXXXXXX 248
            +D +E+E LFE++MYKRNI Q+LS DKQ  +M Y T+KKW+IVKQDLQ            
Sbjct: 176  SDPYEVEILFEDIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRANTTS 235

Query: 249  XXXXXXXXXXXXXXXXXXXXXXXVNTMDNNLRTIDTNASNP--RIHRKGQKSMSSLSNAT 306
                                    +++ +    + T+AS+P   ++       ++LS+A 
Sbjct: 236  SSAASRTSVASDHLPILTAN----SSLSSPKSILMTSASSPTSTVYSNNLNHSTTLSSAG 291

Query: 307  TTAP------SGVNAEYSKIRSISESSDKTNIA------------PIHYVRKILSDTLSK 348
            T+        +G   +   + +I     + NI+            PIHYV++IL+D L+ 
Sbjct: 292  TSTSKSKKIVTGSLKKQPSLNNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADKLTT 351

Query: 349  NELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELIEKEYGFFK 408
            +E+ DLWVTLRTEQLDWVDAF+EHQGHIA+AN L+  +YKTAP  NL+ EL+EKE  FFK
Sbjct: 352  DEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMNSMYKTAPRDNLTKELLEKENSFFK 411

Query: 409  CFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKMALEILVYIINKKNTQRFESVI 468
            CFRVL+ML QGLYEF+ H+LM DT+A GLFST+++T+KMA EI V ++ KKN  RFE+V+
Sbjct: 412  CFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLATKKMATEIFVCMLEKKNKSRFEAVL 471

Query: 469  MSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIFQAFVISLESTLNGRGKMGSKVG 528
             +LD+ FR+ +NL+M++   +    FS  + ++  KI QA++ ++E TL+GRGKMGS VG
Sbjct: 472  TALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVG 531

Query: 529  ASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTKLKLM 588
            ASDDFK  GGENAILEYC W ++FIN LC+ SD +NQR++LRTK EN G LR+M K+KL+
Sbjct: 532  ASDDFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLL 591

Query: 589  DYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEKXXXX 648
            DY+K+  Q++ Y+++KLDDFN  LE  + +  +++QDP SL+ +LW +CKGTENEK    
Sbjct: 592  DYDKVIDQIDLYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVS 651

Query: 649  XXXXXXXXXXKLVDDKREPAKLSKQLKLMDSLMTNIT-ASEVDEQTHMNLAIQRLYDSMQ 707
                      KL+++ +  +KL+KQLKLMDSL+TN++ AS  DE++++N+AIQRLYD+MQ
Sbjct: 652  LVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVTNVSIASAADEESNLNMAIQRLYDAMQ 711

Query: 708  TDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQXXXXXXQRDNILTKSQR 767
            TD+VARRAILE+R L+KKLEE+ AE++ L EKLSKAE+GLVGQ      +RD+IL K+QR
Sbjct: 712  TDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILAKNQR 771

Query: 768  VTKQLQAXXXXXXXXXXXXXXXXXXXXXXILTIVNTNTDADASLNNSS---------DKK 818
            V +QL++                      +LTI+N+  +  + +N  +          +K
Sbjct: 772  VMQQLESELEELKKKHLLEKHQQEVELRKMLTILNSRPEESSDINEGTRNIDPSLNFSEK 831

Query: 819  HNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEKEARELEMTNFSEH 878
             NIQK L+  LSR KKD  +D KKFG+++QPNKRL+MLR+QME+IE EAR+LEMTNF+E 
Sbjct: 832  ANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEF 891

Query: 879  QKLSLESPAVLNXXXXXXXXXXXXXXXXXXXXXXNNRKRANAIKKQKLLELRRDLAMIQA 938
            +K  LE P  +                       N   RA      KL +LRR LA IQ 
Sbjct: 892  EKERLEPPIQI----------KKPKLKKNKHKDKNFLARAQEADMNKLNDLRRALADIQM 941

Query: 939  ETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFD-------PNDFKQA-Q 990
            E+N++SKFNV++RVNELF EKK  AL RL+ LE KYK F IDF+       P     A +
Sbjct: 942  ESNNISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEKIMESPKKLSVADE 1001

Query: 991  LDSNASYESLDPNFVTKKITDIDRIADELDAFXXXXXXXXXXXXXXXXEKN--------- 1041
             + +A Y SLDP    KK+ +I+RI DEL                     +         
Sbjct: 1002 REGDARYSSLDPKAYQKKLDEINRITDELLDLQTQTKQETKEEENGKSSFSSSSSDADDD 1061

Query: 1042 --YYESNAVPTIGPQKG-LIDGS---SFLESLSEKYGTAQNTEGTSLSPLSPQNRIASLG 1095
              Y +++    I  +   L  GS   SFL++LS+KYGT QN   T+ + L     ++ LG
Sbjct: 1062 EVYQDASPTHEIRSENSELSAGSGPGSFLDALSQKYGTGQNV--TASAGLRDSGYVSGLG 1119

Query: 1096 ------EKSFMNRFKRKP-SSMQFLEELSQKV 1120
                  EK+FMNR KR   +S  +LEEL+QKV
Sbjct: 1120 HTPSKVEKTFMNRLKRSTVNSAPYLEELTQKV 1151

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/627 (62%), Positives = 471/627 (75%), Gaps = 34/627 (5%)

Query: 1245 RSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVL 1304
            +S   S +L +SPSL+ KYPRP KKLKQLHW+KLD ++ SIW S  AE+FADDLYEKGVL
Sbjct: 1326 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVL 1385

Query: 1305 HNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCN 1364
             +LEKAFAAREIKSLA K+KEDL KI+FLSRDISQQFGINLHM+ SL+V +LV K+L C+
Sbjct: 1386 ADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCD 1445

Query: 1365 RDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQ 1424
            RD + TPSV+EFLSK EI +VS+NLARNYAPY TDWEGV++++DAK PEK  + LQRADQ
Sbjct: 1446 RDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQ 1505

Query: 1425 IYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVI 1484
            +Y+QLM+NL+SYW SRMRA+ V+TSYE+EY EL+ KLR++D AV A+Q SDNL N+FNVI
Sbjct: 1506 VYLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNLRNVFNVI 1565

Query: 1485 LAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELE 1544
            LAVGN+MND+SKQAQGFKL+TLQRLTFIKD+TNSMTFLNYVEKIIR NYP FN F++ELE
Sbjct: 1566 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFNDFLKELE 1625

Query: 1545 PVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEAT 1604
            PVLDVVK+S+EQLVNDC +F+QSI+NVERS+EIGNLSDSSKFHPLDKV+ K LPVLPEA 
Sbjct: 1626 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1685

Query: 1605 KKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEE 1664
            +K DLL DEVKLT MEFE+LMQ +GEDSGDKFA+ SFFKKFADFINEYKKA+AQNL  EE
Sbjct: 1686 RKGDLLKDEVKLTIMEFESLMQTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAGEE 1745

Query: 1665 EVRKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAE--AKGDNRGHMDKLLAQLKNAG 1722
            E R YE+HK++V                +     E  E     D R  MDKLL QLKNAG
Sbjct: 1746 EERLYEKHKKLVEEQQKKAQEKEKQKERSASPSPEGNEEDEAEDRRDVMDKLLEQLKNAG 1805

Query: 1723 PARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSP--TTDKVVDTSLGEDE 1780
            PA++DPSSARKRA++RKK LS+KDS   +L+DL+  +GSI+YSP  TT         E  
Sbjct: 1806 PAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYTAVHAE-- 1863

Query: 1781 MILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXXXXXXVI 1840
                SPTP +   L        S +    ++D E+                        I
Sbjct: 1864 ----SPTPLATRGLMNTPEDLPSPSKAPALEDQEE------------------------I 1895

Query: 1841 TDRAKALLMELRGSQTPSKKNSHLDDQ 1867
            +DRA+ LL ELRGS+   K+NS LD+ 
Sbjct: 1896 SDRARMLLKELRGSEISVKQNSTLDEH 1922

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
            YNL271C (REAL)
          Length = 1952

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/1112 (42%), Positives = 664/1112 (59%), Gaps = 106/1112 (9%)

Query: 69   KPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSAS 128
            +PLNK+++LN QNLSQY+NGK+      SS                        H RS S
Sbjct: 84   RPLNKKSTLNTQNLSQYMNGKISADVPVSSQ-----------------------HARSHS 120

Query: 129  VQXXXXXXXXXXXXXXXXXXXXXXQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMP 188
            +Q                      Q T  S S  S+ SQGS  NLSK+   +G+++L+MP
Sbjct: 121  MQSKYSYSKRNSSQASNKLTR---QHTGQSHSVSSLLSQGSLTNLSKFTTPDGKIHLEMP 177

Query: 189  TDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQXXXXXXXXXXXX 248
            +D +E+E LFE++MYKRNI Q+LS DKQ  +M+Y T+KKW+IVKQDLQ            
Sbjct: 178  SDPYEVEVLFEDIMYKRNIFQSLSGDKQEALMSYSTEKKWLIVKQDLQNELKKLRANTTS 237

Query: 249  XXXXXXXXXXXXXXXXXXXXXXXVNTMDNNLRTIDTNASNPRIHRKGQKSMSSLSNATTT 308
                                    +++ +    + T+AS+P          +SL+++TT 
Sbjct: 238  SSTASRTSIASDHHPILTAN----SSLSSPKSVLMTSASSP----TSTVYSNSLNHSTTL 289

Query: 309  APSGVNAEYSK----------------IRSISESSDKTNIAP--------IHYVRKILSD 344
            +  G +   SK                 R  SE++   +  P        IHYV++IL+D
Sbjct: 290  SSVGTSTSKSKKLMGGSLKKQPSLNNIYRGGSENNTSASTLPGDRTNRPPIHYVQRILAD 349

Query: 345  TLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELIEKEY 404
             L+ +E+ DLWVTLRTEQLDWVDAF++HQGHIA+AN L+  IYKTAP  +L+ EL+EKE 
Sbjct: 350  KLTTDEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPRDSLTKELLEKEN 409

Query: 405  GFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKMALEILVYIINKKNTQRF 464
             FFKCFRVL+ML QGLYEF+ H+LM DT+A GLFSTR++TRKMA EI V ++ KKN  RF
Sbjct: 410  SFFKCFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTRLATRKMATEIFVCMLEKKNKSRF 469

Query: 465  ESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIFQAFVISLESTLNGRGKMG 524
            E+V+ +LD+ FR+ +NL+M++   +    FS  + ++  KI QA++ ++E TL+GRGKMG
Sbjct: 470  EAVLTALDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMG 529

Query: 525  SKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTK 584
            S VGASD+FK  GGENAILEYC W ++FIN LC+ SD +NQR++LRTK EN G LR+M K
Sbjct: 530  SLVGASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNK 589

Query: 585  LKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEK 644
            +KL+DY+K+  Q+E Y+++KLDDFN  LE  + +  +++QDP SL+ +LW++CKGTENEK
Sbjct: 590  IKLLDYDKVMDQIELYDNNKLDDFNVRLEANNKAFNVDLQDPLSLLKNLWDICKGTENEK 649

Query: 645  XXXXXXXXXXXXXXKLVDDKREPAKLSKQLKLMDSLMTNIT-ASEVDEQTHMNLAIQRLY 703
                          KL+++ + P+KL+KQLK+MDSL+T+++ AS  DE+++MN+AIQRLY
Sbjct: 650  LLVSLVQHLFLSSSKLIEENQNPSKLTKQLKVMDSLVTSVSIASTSDEESNMNMAIQRLY 709

Query: 704  DSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQXXXXXXQRDNILT 763
            D+MQTD+VARRAILE+R L+KKLEE+ AE++ L EKLSKAE+GLVGQ       RD IL 
Sbjct: 710  DAMQTDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHGRDRILA 769

Query: 764  KSQRVTKQLQAXXXXXXXXXXXXXXXXXXXXXXILTIVNTNTDADASLNNS--------- 814
            K+QRV +QL+A                      +LTI+N+  + ++S+N           
Sbjct: 770  KNQRVMQQLEAELEELKKKHLLEKHQQEVELRKMLTILNSRPEENSSINEGIRGKNSSLN 829

Query: 815  SDKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEKEARELEMTN 874
            S +K NIQK L+  LSR KKD  +D KKFG+++QPNKRL+MLR+QME+IE EAR+LEMTN
Sbjct: 830  SSEKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTN 889

Query: 875  FSEHQKLSLESPAVLNXXXXXXXXXXXXXXXXXXXXXXNNRKRANAIKKQKLLELRRDLA 934
            F+E +K  LE P  +                           R   +   KL +LRR LA
Sbjct: 890  FAEFEKDHLEPPIQIKKPKLKKIKHKDKKLIS----------RPQEVDMNKLNDLRRALA 939

Query: 935  MIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFDPNDFKQA----- 989
             IQ E+ND+SKFNV++RVNELF EKK  AL RL+ LE KYK F IDF+  +  ++     
Sbjct: 940  EIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVEEIMESPKKNS 999

Query: 990  ---QLDSNASYESLDPNFVTKKITDIDRIADEL----------DAFXXXXXXXXXXXXXX 1036
               + +  A+Y SLDP     K+ +I+RI D+L          D                
Sbjct: 1000 ANERKEDGANYSSLDPRTYQNKLDEINRITDQLLDLQAQTKQDDGGVSSLSSSSSSAEGE 1059

Query: 1037 XXEKNYYESNAVPTIGPQKGLIDGS-SFLESLSEKYGTAQNTEGTSLSPLSPQNRIASLG 1095
               ++ + +  V +   +  +  GS SFL++LS+KYGT QN   T    L   + ++ +G
Sbjct: 1060 DVYQDAFPAQEVRSENSELSVESGSGSFLDALSQKYGTGQN--NTVSVGLRDSDYVSVIG 1117

Query: 1096 ------EKSFMNRFKRK-PSSMQFLEELSQKV 1120
                  EK+FMN+ ++   SS  +LEEL+QKV
Sbjct: 1118 HMPSKVEKTFMNKLRKSTASSAPYLEELTQKV 1149

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/655 (61%), Positives = 487/655 (74%), Gaps = 38/655 (5%)

Query: 1245 RSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVL 1304
            +S   S +L +SPSL+ KYPRP KKLKQLHW+KLD ++ SIW +  AE+FADDLYEKGVL
Sbjct: 1332 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEKGVL 1391

Query: 1305 HNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCN 1364
             +LEKAFAAREIKSLA K+KEDL KI+FLSRDISQQFGINLHM+ SL+V +LV KIL C+
Sbjct: 1392 ADLEKAFAAREIKSLATKRKEDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKILNCD 1451

Query: 1365 RDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQ 1424
            RD + TPSV+EFLSKPEI +VS+NLARNYAPY TDWEGVK+++DAK PEK  + LQRADQ
Sbjct: 1452 RDFLQTPSVVEFLSKPEIIEVSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQRADQ 1511

Query: 1425 IYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVI 1484
            IY+QLMVNL+SYW SRMRA+ V+TSYEKEY EL+TKLR++D AV A+Q+SDNL N+FNVI
Sbjct: 1512 IYLQLMVNLESYWGSRMRALIVVTSYEKEYNELLTKLRKVDKAVGALQESDNLRNVFNVI 1571

Query: 1485 LAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELE 1544
            LAVGN+MND+SKQAQGFKL+TLQRLTFIKD+ NSMTFLNYVEKIIR NYP FN F++ELE
Sbjct: 1572 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFNDFLKELE 1631

Query: 1545 PVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEAT 1604
            PVLDVVK+S+EQLVNDC +F+QSI+NVERS+EIGNLSDSSKFHPLDK++ K LPVLPEA 
Sbjct: 1632 PVLDVVKVSIEQLVNDCRDFSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTLPVLPEAR 1691

Query: 1605 KKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEE 1664
            KK DLL DEVKLT MEFE+LM  +GEDSGDKFA+ SFFKKFADFINEYKKA++QNL AEE
Sbjct: 1692 KKGDLLEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQSQNLAAEE 1751

Query: 1665 EVRKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAKG--DNRGHMDKLLAQLKNAG 1722
            E R YE+HK++V                +  S SE  E     D R  MDKLL QLKNAG
Sbjct: 1752 EERIYEKHKKIVEEQQKRAQEREKQKENSNSSSSEGNEEDEAEDRRAVMDKLLEQLKNAG 1811

Query: 1723 PARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTT-DKVVDTSLGEDEM 1781
            P +SDPSSARKRA++RK+ LS+KD++  +L+DL+  +GSI+YSP   D   D  +  +  
Sbjct: 1812 PGKSDPSSARKRALVRKRYLSDKDNSQQLLNDLDNEEGSILYSPEALDPDADAVIHAE-- 1869

Query: 1782 ILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXXXXXXVIT 1841
               SPTP +            S +   T++D E+                        I+
Sbjct: 1870 ---SPTPLTTRGTLNIPEDLPSPSKASTLEDQEE------------------------IS 1902

Query: 1842 DRAKALLMELRGSQTPSKKNSHLDDQXXXXXXXXXXXXQTFGEESNSTPSNRLTF 1896
            DRAK LL ELRGS TP K+NS LD+             +T GE S     N+L+F
Sbjct: 1903 DRAKMLLKELRGSDTPVKQNSILDEH---LEKLRARKERTIGEGS---AGNKLSF 1951

>YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}
            BNI1Formin, nucleates the formation of linear actin
            filaments, involved in cell processes such as budding and
            mitotic spindle orientation which require the formation
            of polarized actin cables, functionally redundant with
            BNR1
          Length = 1953

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/1119 (43%), Positives = 666/1119 (59%), Gaps = 116/1119 (10%)

Query: 69   KPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSAS 128
            +PLNK+++LN QNLSQY+NGKL          G+V                S  H RS S
Sbjct: 83   RPLNKKSTLNTQNLSQYMNGKLS---------GDVPV--------------SSQHARSHS 119

Query: 129  VQXXXXXXXXXXXXXXXXXXXXXXQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMP 188
            +Q                      Q T  S S  S+ SQGS  NLSK+   +G++ L+MP
Sbjct: 120  MQSKYSYSKRNSSQASNKLTR---QHTGQSHSASSLLSQGSLTNLSKFTTPDGKIYLEMP 176

Query: 189  TDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQXXXXXXXXXXXX 248
            +D +E+E LFE++MYKRNI Q+LS DKQ  +M Y  +KKW+IVKQDLQ            
Sbjct: 177  SDPYEVEVLFEDIMYKRNIFQSLSEDKQEALMGYSIEKKWLIVKQDLQNELKKMRANTTS 236

Query: 249  XXXXXXXXXXXXXXXXXXXXXXXVNTMDNNLRTIDTNASNP--RIHRKGQKSMSSLSNAT 306
                                    +++ +    + T+AS+P   ++       ++LS+  
Sbjct: 237  SSTASRTSMASDHHPILTAN----SSLSSPKSVLMTSASSPTSTVYSNSLNHSTTLSSVG 292

Query: 307  TTAPSG---VNAEYSK-------IRSISESSDKTNIAP--------IHYVRKILSDTLSK 348
            T+   G   V+    K        R  +E++   +  P        IHYV++IL+D L+ 
Sbjct: 293  TSTSKGKKLVSGSLKKQPSLNNIYRGGAENNTSASTLPGDRTNRPPIHYVQRILADKLTS 352

Query: 349  NELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELIEKEYGFFK 408
            +E+ DLWVTLRTEQLDWVDAF++HQGHIA+AN L+  IYKTAP  NL+ EL+EKE  FFK
Sbjct: 353  DEMKDLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPRENLTKELLEKENSFFK 412

Query: 409  CFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKMALEILVYIINKKNTQRFESVI 468
            CFRVL+ML QGLYEF+ H+LM DT+A GLFST+++TRKMA EI V ++ KKN  RFE+V+
Sbjct: 413  CFRVLSMLSQGLYEFSTHRLMTDTVAEGLFSTKLATRKMATEIFVCMLEKKNKSRFEAVL 472

Query: 469  MSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIFQAFVISLESTLNGRGKMGSKVG 528
             SLD+ FR+ +NL+M++   +    FS  + ++  KI QA++ ++E TL+GRGKMGS VG
Sbjct: 473  TSLDKKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVG 532

Query: 529  ASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTKLKLM 588
            ASD+FK  GGENAILEYC W ++FIN LC+ SD +NQR++LRTK EN G LR+M K+KL+
Sbjct: 533  ASDEFKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGILRIMNKIKLL 592

Query: 589  DYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEKXXXX 648
            DY+K+  Q+E Y+++KLDDFN  LE  + +  +++ DP SL+ +LW++CKGTENEK    
Sbjct: 593  DYDKVIDQIELYDNNKLDDFNVKLEANNKAFNVDLHDPLSLLKNLWDICKGTENEKLLVS 652

Query: 649  XXXXXXXXXXKLVDDKREPAKLSKQLKLMDSLMTNIT-ASEVDEQTHMNLAIQRLYDSMQ 707
                      KL+++ +  +KL+KQLKLMDSL+TN++ AS  DE+T+MN+AIQRLYD+MQ
Sbjct: 653  LVQHLFLSSSKLIEENQNSSKLTKQLKLMDSLVTNVSVASTSDEETNMNMAIQRLYDAMQ 712

Query: 708  TDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQXXXXXXQRDNILTKSQR 767
            TD+VARRAILE+R L+KKLEE+ AE++ L EKLSKAE+GLVGQ      +RD IL K+QR
Sbjct: 713  TDEVARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDRILAKNQR 772

Query: 768  VTKQLQAXXXXXXXXXXXXXXXXXXXXXXILTIVNTNTD-----------ADASLNNSSD 816
            V +QL+A                      +LTI+N+  +            ++SLN+S  
Sbjct: 773  VMQQLEAELEELKKKHLLEKHQQEVELRKMLTILNSRPEESFNKNEGTRGMNSSLNSS-- 830

Query: 817  KKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEKEARELEMTNFS 876
            +K NIQK L+  LSR KKD  +D KKFG+++QPNKRL+MLR+QME+IE EAR+LEMTNF+
Sbjct: 831  EKANIQKVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFA 890

Query: 877  EHQKLSLESPAVLNXXXXXXXXXXXXXXXXXXXXXXNNRKRANAIKKQ-----KLLELRR 931
            E +K  LE P  +                           R   +K Q     KL +LRR
Sbjct: 891  EFEKDRLEPPIHIKKPKVKKMKNKD---------------RKPLVKPQEADVNKLNDLRR 935

Query: 932  DLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFDPNDFKQA-- 989
             LA IQ E+ND+SKFNV++RVNELF EKK  AL RL+ LE KYK F IDF+ ++   +  
Sbjct: 936  ALAEIQMESNDISKFNVEERVNELFNEKKSLALKRLKELETKYKGFGIDFNVDEIMDSPK 995

Query: 990  ------QLDSNASYESLDPNFVTKKITDIDRIADELDAFXXXXXXXXXXXXXXXXEKNYY 1043
                  + + +A+Y SLDP    KK+ +I+RI D+L                   + +  
Sbjct: 996  KNTGDVETEEDANYASLDPKTYQKKLDEINRITDQLLDIQTQTEHEIQVEEDGESDLSSS 1055

Query: 1044 ES---------NAVPTI---GPQKGLIDGS---SFLESLSEKYGTAQNTEGTSLSPLSPQ 1088
             S         +A PT         L  GS   SFL++LS+KYGT QN   T+ +     
Sbjct: 1056 SSDDESEEIYQDASPTQELRSEHSELSSGSGPGSFLDALSQKYGTGQNV--TASAAFGEN 1113

Query: 1089 NRIASLG------EKSFMNRFKRKP-SSMQFLEELSQKV 1120
            N  + +G      EK+FMNR ++   SS  +LEEL+QKV
Sbjct: 1114 NNGSGIGPLHSKVEKTFMNRLRKSTVSSAPYLEELTQKV 1152

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/655 (62%), Positives = 489/655 (74%), Gaps = 38/655 (5%)

Query: 1245 RSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVL 1304
            +S   S +L +SPSL+ KYPRP KKLKQLHW+KLD ++ SIW +  AE+FADDLYEKGVL
Sbjct: 1333 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVL 1392

Query: 1305 HNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCN 1364
             +LEKAFAAREIKSLA+K+KEDL KI+FLSRDISQQFGINLHM+ SL+V +LV KIL C+
Sbjct: 1393 ADLEKAFAAREIKSLASKRKEDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCD 1452

Query: 1365 RDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQ 1424
            RD + TPSV+EFLSK EI +VS+NLARNYAPY TDWEGV+++EDAK PEK  + LQRADQ
Sbjct: 1453 RDFLQTPSVVEFLSKSEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQ 1512

Query: 1425 IYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVI 1484
            IY+QLMVNL+SYW SRMRA+ V+TSYE+EY EL+ KLR++D AVSA+Q+SDNL N+FNVI
Sbjct: 1513 IYLQLMVNLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVI 1572

Query: 1485 LAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELE 1544
            LAVGN+MND+SKQAQGFKL+TLQRLTFIKD+TNSMTFLNYVEKI+R NYP FN F+ ELE
Sbjct: 1573 LAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFNDFLSELE 1632

Query: 1545 PVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEAT 1604
            PVLDVVK+S+EQLVNDC +F+QSI+NVERS+EIGNLSDSSKFHPLDKV+ K LPVLPEA 
Sbjct: 1633 PVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEAR 1692

Query: 1605 KKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEE 1664
            KK DLL DEVKLT MEFE+LM  +GEDSGDKFA+ SFFKKFADFINEYKKA+AQNL AEE
Sbjct: 1693 KKGDLLEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEE 1752

Query: 1665 EVRKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAE--AKGDNRGHMDKLLAQLKNAG 1722
            E R Y +HK++V                +    SE  E     D R  MDKLL QLKNAG
Sbjct: 1753 EERLYIKHKKIVEEQQKRAQEKEKQKENSNSPSSEGNEEDEAEDRRAVMDKLLEQLKNAG 1812

Query: 1723 PARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSP-TTDKVVDTSLGEDEM 1781
            PA+SDPSSARKRA++RKK LSEKD+   +L+DL+  +GSI+YSP   D   DT +  +  
Sbjct: 1813 PAKSDPSSARKRALVRKKYLSEKDNAPQLLNDLDTEEGSILYSPEAMDPTADTVIHAE-- 1870

Query: 1782 ILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXXXXXXVIT 1841
               SPTP +            +R    T +D+   + T+A  D               I+
Sbjct: 1871 ---SPTPLA------------TRGVMNTSEDLPSPSKTSALED------------QEEIS 1903

Query: 1842 DRAKALLMELRGSQTPSKKNSHLDDQXXXXXXXXXXXXQTFGEESNSTPSNRLTF 1896
            DRA+ LL ELRGS TP K+NS LD+             ++ GE S     NRL+F
Sbjct: 1904 DRARMLLKELRGSDTPVKQNSILDEH---LEKLRARKERSIGEAST---GNRLSF 1952

>NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {ON}
            Anc_1.82
          Length = 1946

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/1113 (42%), Positives = 650/1113 (58%), Gaps = 129/1113 (11%)

Query: 68   LKPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSA 127
            LKPLNK+TSLN QNLSQYIN                             D  SP H RSA
Sbjct: 70   LKPLNKKTSLNTQNLSQYIN-----------------------------DKHSPQHTRSA 100

Query: 128  SVQXXXXXXXXXXXXXXX---XXXXXXXQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLN 184
            SVQ                         Q TN   S+ S+ SQGS+ NLSK++  +G++N
Sbjct: 101  SVQSSSKYSYSRRSSSQTLGSTLNQIARQHTN--QSSASILSQGSFTNLSKFIAPDGKIN 158

Query: 185  LDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQXXXXXXXX 244
            L+MP D +E+E LFE++M KRNILQ+L  DKQ ++M+YD +KKW+IVKQDLQ        
Sbjct: 159  LEMPRDPNEVEVLFEDIMLKRNILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMKKMRL 218

Query: 245  XXXXXXXXXXXXXXXXXXXXXXXXXXXVNTMDNNLRTIDTNASNPRIHRKGQKSMSSLSN 304
                                        N+   NL +  T   +P  H     + S  S+
Sbjct: 219  KTNSTNTNNNNNNNRSSMSPE-------NSSTINLNSPATMQMSPHHHIGSNSNSSINSH 271

Query: 305  AT----TTAPSGV------NAEYSKI--RSISESS--DKTNIAPIHYVRKILSDTLSKNE 350
             T    +  P+G       NA+  K+  R+ S SS  DKTN  PIHYV++I++DT++  E
Sbjct: 272  HTPITISKRPTGPISNPIPNADMYKLSMRNTSSSSMSDKTNRPPIHYVKRIIADTITSEE 331

Query: 351  LNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELIEKEYGFFKCF 410
            + DLWVTLRTEQ+DWVDAF+EHQGHIA+AN L++ +YKT+     + +L+EKE  FFKCF
Sbjct: 332  MKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSDGTPNPQLLEKENAFFKCF 391

Query: 411  RVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKMALEILVYIINKKNTQRFESVIMS 470
            RVL+ML QGL EFT+H++M  T+A GLFS  +STR+MA EI V ++ KKN +RF+ ++ +
Sbjct: 392  RVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIFVCMLEKKNPERFKVILNA 451

Query: 471  LDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIFQAFVISLESTLNGRGKMGSKVGAS 530
            LD+ F++  N +M + I  F   F+  + D+Q K+ QA++ ++E TL+GRGKMGS VGAS
Sbjct: 452  LDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQLKVTQAWLFAVEHTLDGRGKMGSLVGAS 511

Query: 531  DDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTKLKLMDY 590
            DDFK SGGENAILEYC W++IFIN LC+ S  +NQR++LRTK EN G LR+M K+K +DY
Sbjct: 512  DDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTKLENCGILRIMNKVKTLDY 571

Query: 591  EKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEKXXXXXX 650
            +K+  Q++ YE++KLDD N+LLE  + +A IN+QDPTS++ +LW+ CKGTENEK      
Sbjct: 572  DKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRNLWDACKGTENEKLLISLM 631

Query: 651  XXXXXXXXKLVDDKREPAKLSKQLKLMDSLMTNITASEVDEQTHMNLAIQRLYDSMQTDD 710
                    + +++K++P KLS+QLKL+DSL+TN++ S  D++  MN+AIQRLYD+MQTD+
Sbjct: 632  QHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVTNVSVSSTDQEASMNMAIQRLYDAMQTDE 691

Query: 711  VARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQXXXXXXQRDNILTKSQRVTK 770
            VARR+ILE+RTL+KKLEEV AE++ L +KL  AE+GLVGQ      QRD IL+K+QRV +
Sbjct: 692  VARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQLQDELAQRDRILSKNQRVME 751

Query: 771  QLQAXXXXXXXXXXXXXXXXXXXXXXILTIVNT--------NTDADASLNNSS----DKK 818
            QLQ                       +LTI+N          T       N S     KK
Sbjct: 752  QLQGELEELKKKHLLEKHEQEVELRKMLTILNARPEIVEGNGTSKKTKAKNPSALDPSKK 811

Query: 819  HNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEKEARELEMTNFSEH 878
             +IQ+AL+  LSRTKKD + D + FG+++QPNKRL++LR+QMEDIE EARELEMTNF+E+
Sbjct: 812  QSIQQALQDGLSRTKKDYSVDARNFGMTIQPNKRLKLLRMQMEDIENEARELEMTNFTEY 871

Query: 879  QKLSLESPAVLNXXXXXXXXXXXXXXXXXXXXXXNNRKRANAIKKQKLLELRRDLAMIQA 938
            +K  LE+P+ +                                   KL +LR+ LA IQ 
Sbjct: 872  EKRKLEAPSKIKKPKKVATKKEIDPSI------------------NKLNDLRQTLAEIQM 913

Query: 939  ETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFDPNDF-KQAQLDSNAS- 996
            E+ND+SKFNVD+RVNELF +K+  AL RLQ LE KYK F IDF+ ++    A  D N + 
Sbjct: 914  ESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDELVDSASKDENGNN 973

Query: 997  -----YESLDPNFVTKKITDIDRIADEL----------------------DAFXXXXXXX 1029
                 Y SLDP    +K+ +++R+ DEL                       +        
Sbjct: 974  QQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLSSRRPSASSSSESASSSS 1033

Query: 1030 XXXXXXXXXEKNYYESNAVPT-IGPQKGLIDGSSFLESLSEKYGTAQNTEGTSLSPLSPQ 1088
                     E+   +SN   T  GP        SFLE+L++KY T Q +        SP+
Sbjct: 1034 DSDDGESLIERQDTQSNFSGTSAGP-------GSFLEALTQKYATGQKS-------ASPR 1079

Query: 1089 NRIASLGEKSFMNRFKRKPSSMQFLEELSQKVG 1121
            ++   + +  F+NR K+   +  FL+EL+ KV 
Sbjct: 1080 DQSTRMKDNIFINRIKQTNVAPPFLDELTDKVA 1112

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/631 (64%), Positives = 481/631 (76%), Gaps = 53/631 (8%)

Query: 1249 GSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLE 1308
             S +L +S SL+  YPRPQKKLKQLHW+KLD ++ SIW +  AE+FADDLYEKGVL +LE
Sbjct: 1277 ASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKGVLTDLE 1336

Query: 1309 KAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVM 1368
            KAFAAREIKSLA+KKKEDLDKISFLSRDISQQFGINLHM+ +L VD++V KILKC+RD +
Sbjct: 1337 KAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILKCDRDFL 1396

Query: 1369 NTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQ 1428
            +TPSVIEFLSKPEI +VS+NLARNYAPY TDWEGVK VEDAKAPEK  + LQRADQ+Y+Q
Sbjct: 1397 HTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRADQLYLQ 1456

Query: 1429 LMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVG 1488
            L++NLQSYW SRMRA+ VIT+++KEY EL+TKLR++D AVS++Q+S+NL N+FNVILAVG
Sbjct: 1457 LIINLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESENLKNVFNVILAVG 1516

Query: 1489 NYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLD 1548
            NYMND+SKQAQGFKL TLQRLTFIKDSTNSMTFLNYVEKI+R NYP FN F+ ELEPVLD
Sbjct: 1517 NYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPSFNDFLTELEPVLD 1576

Query: 1549 VVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSD 1608
            VVKIS+EQLV+DC EF+QSI+NVERS+E GNLSDSSKFHP D+V+ KVLP+LP+A KK +
Sbjct: 1577 VVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAKVLPILPDARKKGE 1636

Query: 1609 LLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRK 1668
            LL DEVKLT MEF  LMQ +GEDS DKFA+NSFFKKFADFI EYKKA+ QN+KAEEE + 
Sbjct: 1637 LLGDEVKLTIMEFLRLMQIYGEDSEDKFAKNSFFKKFADFITEYKKAQNQNIKAEEEEQV 1696

Query: 1669 YERHKQMVXXXXXXXXXXXXNYMETGVSDSESAEA-----KGDNRGHMDKLLAQLKNAGP 1723
            YERHK+MV               E G + SE+ E       GD R  MDKLL QLKNAGP
Sbjct: 1697 YERHKKMVEDQQKKLQE-----QENGSNGSENGEEGSGDDSGDRRAMMDKLLDQLKNAGP 1751

Query: 1724 ARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKV------VDTSLG 1777
            +++DPSSARKRA++RKKL++E   ++ +L D+   D SIIYSP           +DT   
Sbjct: 1752 SKTDPSSARKRALVRKKLMTE---STALLKDIETEDDSIIYSPEGKNPFVNPVDLDTPHD 1808

Query: 1778 EDEM-ILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXXXX 1836
            E EM +  SP  +S            SRN TL  DD ++                     
Sbjct: 1809 ESEMDVSSSPIQRS---------LSPSRNSTLLSDDQDE--------------------- 1838

Query: 1837 XXVITDRAKALLMELRGSQTPSKKNSHLDDQ 1867
               +TDRAKALLMELRGS TPSK+NS LD+ 
Sbjct: 1839 ---VTDRAKALLMELRGSNTPSKRNSLLDEH 1866

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
            to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
            regulator of budding
          Length = 1898

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1107 (42%), Positives = 666/1107 (60%), Gaps = 84/1107 (7%)

Query: 64   SMDDLKPLNKRTSLNNQNLSQYIN-GKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPN 122
            S+D  +PLNK+++LN+QNLSQY+N GK    +S S+H       H+    ++ Q G   +
Sbjct: 70   SIDQSRPLNKKSTLNSQNLSQYVNNGKALSPESGSNH-------HR---TDSTQSGFKYS 119

Query: 123  HNRSASVQXXXXXXXXXXXXXXXXXXXXXXQSTNFSGSTPSVFSQGSYANLSKYMDSNGR 182
            ++R +S Q                       +TN S S+ SV S GS  NLS++M  +G+
Sbjct: 120  YSRRSSGQVSMAPSSMGNINLTR-------HNTNTSFSSASVLSHGSITNLSRFMTPDGK 172

Query: 183  LNLDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQXX-XXX 241
            +NL MP+D +E+ESLFE++MYKRNILQ+L  +KQ ++M+Y  +KKW+IVKQDLQ      
Sbjct: 173  INLTMPSDPYEVESLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRI 232

Query: 242  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNTMDNNLRTIDTNASNPRIH-RKGQKSMS 300
                                          +++  +++ + D  ++ P  + R G+K++ 
Sbjct: 233  KASNKGDSRTGMSMPDLGSDPSNSVSPPGPISSSGSSIFSSDVTSTAPSTYSRSGKKNIP 292

Query: 301  SLSNATTTAPSGVNAEYSKIRSISESSDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRT 360
                   T+    +       S +  SDK N  PIHYV+KI+ D LSK+E+ DLWVTLRT
Sbjct: 293  ISKPIAATSTELYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDLWVTLRT 352

Query: 361  EQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGL 420
            EQLDWVDAFLE+QGHIA+AN L++ IYKT P   +S+ L++KE  FFKCFRVLA+L QGL
Sbjct: 353  EQLDWVDAFLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLAVLSQGL 412

Query: 421  YEFTKHKLMMDTLAFGLFSTRVSTRKMALEILVYIINKKNTQRFESVIMSLDRFFRLSEN 480
            +EFT H LM DT+A GLFS R++TRKMA EI V+++ KKN +RFESV+ SLD+ F + +N
Sbjct: 413  HEFTIHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKNFIIGQN 472

Query: 481  LNMLKIITQFGGAFSRTSPDTQFKIFQAFVISLESTLNGRGKMGSKVGASDDFKVSGGEN 540
             +M +   +    F+  + ++  K+ QA++ ++E TL+GRGKMGS VGAS+D+K +GGEN
Sbjct: 473  SHMNESYKKLPQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYKNAGGEN 532

Query: 541  AILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENY 600
            AILEYC W ++FIN LC+ S+ +NQR +LR K EN G LR+M K+KL+DYEK+  Q+E Y
Sbjct: 533  AILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVIDQIELY 592

Query: 601  EDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEKXXXXXXXXXXXXXXKL 660
            E++KLDDFN+LLE    +  +++QDP SL+ +L + CKGTENEK              KL
Sbjct: 593  ENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIFLPTSKL 652

Query: 661  VDDKREPAKLSKQLKLMDSLMTNITASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETR 720
            +D+K++P K++KQLKLMDSL+TN++ +  +E +++N+AIQRLYDSMQTD+VARRAILE+R
Sbjct: 653  LDEKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARRAILESR 712

Query: 721  TLSKKLEEVTAEKEYLKEKLSKAENGLVGQXXXXXXQRDNILTKSQRVTKQLQAXXXXXX 780
            TL+KKLEE+ AE++ L EKLSKAE+GLVGQ      +RD IL K+QRV KQL++      
Sbjct: 713  TLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMKQLESELEELK 772

Query: 781  XXXXXXXXXXXXXXXXILTIVNTNTDADASLNN-----SSDKKHNIQKALETELSRTKKD 835
                            +LTI+N+                + +K ++Q+AL++ L + KKD
Sbjct: 773  KKHLLEKHEQEVELRKMLTILNSRPAKTKEQKKKIGSIEASEKEDLQRALQSGLQKAKKD 832

Query: 836  LNNDVKKFGISVQPNKRLRMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNXXXXX 895
              +D KKFG+++QPN+RL++LR+QME IE EAR+LEMTNF+E++K  L+ PA        
Sbjct: 833  FKDDSKKFGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPA-------- 884

Query: 896  XXXXXXXXXXXXXXXXXNNRKRANAIKK-------QKLLELRRDLAMIQAETNDVSKFNV 948
                             N +K++  I +       QKL ELR  L  IQ E+NDVSKFNV
Sbjct: 885  -----------------NVQKKSKPISELNKEQRIQKLNELRDKLRRIQMESNDVSKFNV 927

Query: 949  DKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFDPNDFKQAQLDS-NASYESLDPNFVTK 1007
            D+RVNELF +KK  AL RL+ LE KYK F IDF   DF     DS N  Y SLDP     
Sbjct: 928  DERVNELFNDKKRTALQRLKELETKYKGFGIDFKVEDFTHESTDSSNEGYSSLDPKVYQD 987

Query: 1008 KITDIDRIADEL----------DAFXXXXXXXXXXXXXXXXEKNYYESNAVPTIGPQKGL 1057
            K+ +I +I++EL                                   +N     G    +
Sbjct: 988  KLDEITKISEELLQQKNELETTQTSSSESNSDSESSSDSDDSMEDALTNNKDINGTSSNV 1047

Query: 1058 ID--GSSFLESLSEKYGTAQNTEGTSLSPL-SPQNRIASLGEKSFMNRFKRKPSSMQFLE 1114
             D    SFL++L++KYGT Q        P+ SP    ++  EKSF++R KR      ++E
Sbjct: 1048 SDLASGSFLDTLTQKYGTGQ------AEPIQSPVGHYSNRNEKSFVDRMKRNSRVPSYVE 1101

Query: 1115 ELSQKVGG-------EALGKDNNETSD 1134
            ELS+K+ G       E   K+ N++SD
Sbjct: 1102 ELSKKMRGNKDHEFEEDDHKNGNQSSD 1128

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/661 (60%), Positives = 478/661 (72%), Gaps = 46/661 (6%)

Query: 1250 SQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLEK 1309
            S +L +SPSL+  YPRPQKKLKQLHW+K++ ++ SIW S  AE+FADDLYEKGVL  LEK
Sbjct: 1245 SPLLPQSPSLFENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEK 1304

Query: 1310 AFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMN 1369
            AFAAREIKSLA +KKEDL KISFLS DISQQFGINLHM+ +LTV++ V K+LKC RD MN
Sbjct: 1305 AFAAREIKSLATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMN 1364

Query: 1370 TPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQL 1429
            TPSVIEFLSK EI +VS NLARNYAPY TDWEG+K +EDAKAPEK  + LQRADQIY+QL
Sbjct: 1365 TPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQL 1424

Query: 1430 MVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGN 1489
            MVNLQSYW SRMRAI++ITSYE+EY EL+ KL R+D AV ++Q SDNL N+FNVILAVGN
Sbjct: 1425 MVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGN 1484

Query: 1490 YMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLDV 1549
            +MNDS+KQA+GFKL+TLQRLTFIKD+ NSMTFLNYVEKI+R NYPEFN F+ ELEPVL+V
Sbjct: 1485 FMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEV 1544

Query: 1550 VKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDL 1609
            VK+S+EQLVNDCN+F Q I NVERS+EIGNLSDSSKFHPLDKV+ KVLP L EA KK +L
Sbjct: 1545 VKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGEL 1604

Query: 1610 LTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKY 1669
            L DE+KLT MEFE +MQ +GED GDKFA+ SFF+KFADFI EYKKA+AQN+K EEE   Y
Sbjct: 1605 LADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAY 1664

Query: 1670 ERHKQMVXXXXXXXXXXXX----NYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPAR 1725
            ERHK+MV                N  +TG  +S+  E   D R  MDKLL QLKNAG  +
Sbjct: 1665 ERHKKMVEEQQRKAQEDASKLNENSSQTG--NSDEEEESEDRRAVMDKLLEQLKNAGQVK 1722

Query: 1726 SDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMILKS 1785
            +DP+SARKRA++RKK+ S ++S S  L ++  G  S+IYSP   + +     E E+ + S
Sbjct: 1723 TDPTSARKRALLRKKIHSSEESESSPLAEMQVGGDSLIYSPDAKEQI-----ELEIHMAS 1777

Query: 1786 PTPKSKDN--LETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXXXXXXVITDR 1843
            PTPK+K++  L T  NS                   N E+ +              I DR
Sbjct: 1778 PTPKTKEDGKLGTGENS-------------------NGESPLKKINEDEE------IGDR 1812

Query: 1844 AKALLMELRGSQTPSKKNSHLDDQXXXXXXXXXXXXQTFGEESNSTP-SNRLTFVSDENS 1902
            AK LLMELRGS     +N+ LD+                  +SN  P SNRL FV DE S
Sbjct: 1813 AKTLLMELRGSDALMDRNTALDEHKERLRARRKRT------DSNKIPSSNRLKFV-DEKS 1865

Query: 1903 P 1903
            P
Sbjct: 1866 P 1866

>ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} some
            similarities with uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1994

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/999 (43%), Positives = 606/999 (60%), Gaps = 89/999 (8%)

Query: 156  NFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEELMYKRNILQALSPDK 215
            N   S  SV SQGS  NL ++M  +G++ LDMP D HE+ESLFE++MYKRNI+Q L P+K
Sbjct: 152  NSQSSAASVLSQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEK 211

Query: 216  QRDIMNYDTKKKWMIVKQDLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNTM 275
            Q+++ NYD  KKW+IV+QDL                                     NT 
Sbjct: 212  QQELRNYDIDKKWLIVRQDL-----------------SSDLKKMMAKSSSSATQASANTT 254

Query: 276  D----NNLRTIDTNASNPRIHRKGQKSMSSLSNATTTAPSGVNAEYSKIRSISESSDKTN 331
            D    N + + D + +    H K   S  SL N+   + +  N+  + +     +++K N
Sbjct: 255  DLSLTNTISSHDYSDATSIRHMKTNASSKSL-NSNLYSNANANSSNTTV-----NTEKIN 308

Query: 332  IAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAP 391
              P +YV+KI++D L+ +ELNDLWVTLRTEQLDWVDAFLEHQGHIA+AN L++ +YKT  
Sbjct: 309  RPPTYYVKKIIADDLTIDELNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMKSLYKTTQ 368

Query: 392  GSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKMALEI 451
               L+++ +E+E  +FKCFRVL ML QGLYEFTKH +M +T+A+ LFS R+ TRKMA EI
Sbjct: 369  EVKLTEKSLEREASYFKCFRVLVMLAQGLYEFTKHAIMAETVAYALFSIRLPTRKMATEI 428

Query: 452  LVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIFQAFVI 511
             V ++ KKN  RF+ ++ +LD+ F + ENL+M++ +      F     D+QFKI QA++ 
Sbjct: 429  FVCMLEKKNKSRFDVILTALDKKFMIGENLHMMQFVKNSPQQFIHLKRDSQFKIVQAWLT 488

Query: 512  SLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRT 571
             LE+ L GRGKMGS VGAS++ + +GGEN+ILEY  W ++FIN LC  +D +NQRV+LRT
Sbjct: 489  GLETALQGRGKMGSLVGASEEVRAAGGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRT 548

Query: 572  KFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIG 631
            + EN G LR+M + KL+DY+K+T Q+E YE+ KLDD N+LLE +  + Q+NMQDP  ++ 
Sbjct: 549  RLENAGALRIMNRFKLLDYDKITAQIEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQ 608

Query: 632  SLWEVCKGTENEKXXXXXXXXXXXXXXKLVDDKREPAKLSKQLKLMDSLMTNITASEVDE 691
            ++W+ CKGTENEK              K+ DD+ +P+KL+KQLKLMDSL+ N++ S VDE
Sbjct: 609  TMWDYCKGTENEKTFISLIKHLFLSSSKVADDRGDPSKLAKQLKLMDSLVANVSVSAVDE 668

Query: 692  QTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQX 751
            ++ +N+AIQRLYD+MQTD+VARRAILE+R L+K+LEE+ AE+++L++KL+   +G+VG+ 
Sbjct: 669  ESSVNVAIQRLYDAMQTDEVARRAILESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRL 728

Query: 752  XXXXXQRDNILTKSQRVTKQLQAXXXXXXXXXXXXXXXXXXXXXXILTIVNTNTDADASL 811
                 QRD+IL K+QRV + LQA                      +LTI+N   D D +L
Sbjct: 729  EEELKQRDDILAKNQRVNRHLQAELEELKKKHLLEKHEHEVELRKMLTILNARPD-DENL 787

Query: 812  NNSS-----------DKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQM 860
              S+           D++ +IQKAL+  L RT+KDL+ D K+FGI+VQPNKRLRMLR++M
Sbjct: 788  AKSTKVTKSVNGLDPDRQTSIQKALQDGLQRTRKDLSVDSKRFGITVQPNKRLRMLRMKM 847

Query: 861  EDIEKEARELEMTNFSEHQKLSLESPAVLNXXXXXXXXXXXXXXXXXXXXXXNNRKRANA 920
            E IE+EARELEMTNF+EH++  LE P                            +K+A  
Sbjct: 848  EGIEQEARELEMTNFAEHEEKQLEEPV-----------------------GTGTKKKAGV 884

Query: 921  IKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEID 980
               +KL ELR+ L+ IQ ETN+V+KFNV++RV ELF +K+ +AL RL+ LE  YK F ID
Sbjct: 885  ---RKLSELRKQLSDIQKETNEVTKFNVEERVKELFNQKRLKALKRLKELETTYKGFGID 941

Query: 981  FDPNDFKQAQLDSNAS--------YESLDPNFVTKKITDIDRIADELDAFXXXXXXXXXX 1032
            F+ N    A L+S            +  D     +K+ ++DRIA+EL A           
Sbjct: 942  FNAN----ALLESKGGDIHWNDDEIDGQDLQGAQEKMDEMDRIANELTAMKMKVEIQNQQ 997

Query: 1033 XXXXXXEKNYYESNAVPTIG---------PQKGLIDGS-SFLESLSEKYGTAQNTEGTSL 1082
                         +     G          QK    G+ SFLE+LS+KYG  QNT   S 
Sbjct: 998  QHTDSSSTESSSEDDDGATGSRTDTASEFSQKSFGSGAGSFLEALSQKYGAGQNTT-ISN 1056

Query: 1083 SPLSPQNRIASLGEKSFMNRFKRKPSSMQFLEELSQKVG 1121
            SP    +R +S    SF NR K K ++  + +EL++KV 
Sbjct: 1057 SPFPGVDRKSSNHRTSFANRMK-KSNATPYFDELTRKVA 1094

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/677 (59%), Positives = 491/677 (72%), Gaps = 32/677 (4%)

Query: 1237 FMGLNKMYRSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFAD 1296
            F G  KMYRS D S  L E+P+    YP+P KKLKQLHW+KLD +E SIWSS +AE+FA 
Sbjct: 1234 FAGQKKMYRS-DMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAG 1292

Query: 1297 DLYEKGVLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDEL 1356
            DLYEKGVL  LEKAFAAREIK+LA KKKEDL KI+FLS D SQQFGINLHM+  ++V++L
Sbjct: 1293 DLYEKGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDL 1352

Query: 1357 VIKILKCNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSV 1416
            VIKILKC+RD M TPSVIEFLSK EIT+VS+NLARN++PY TDW+G+K +EDAK PEK  
Sbjct: 1353 VIKILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDP 1412

Query: 1417 DGLQRADQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDN 1476
            + LQRADQIY+QL+ NLQ+YW SRMRAIKVITSY+KEY ELVTKLR++D AV AI KS+N
Sbjct: 1413 NDLQRADQIYLQLIFNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGAILKSEN 1472

Query: 1477 LTNLFNVILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEF 1536
            L+N+FNVILAVGN+MND++K+AQGFKL+TLQRLTFIKD+ NSMTFLNYVEKIIR NYP F
Sbjct: 1473 LSNIFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRGNYPSF 1532

Query: 1537 NGFIEELEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKV 1596
            N F++ELEPVL+V KIS++QLVNDCNE+ Q++ NVERS+EIGNLSDSSKFHPLD+V+ KV
Sbjct: 1533 NDFLKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLDRVLIKV 1592

Query: 1597 LPVLPEATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKAR 1656
            LPVLPEA KK DLL DEV+L+ MEFE LMQK+GED+GDKFA+NSFFKKFADF+ EYKKA+
Sbjct: 1593 LPVLPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGDKFAKNSFFKKFADFVQEYKKAQ 1652

Query: 1657 AQNLKAEEEVRKYERHKQMVXXXXXXXXXXXXN--YMETGVSDSESAEAKGDNRGHMDKL 1714
             QNLK EEE R YERHK+MV            N  Y+     +  + +   D R  MDKL
Sbjct: 1653 NQNLKVEEEERVYERHKKMVEEQQRREQTPSKNRDYV-VNEDEDIADDDDQDRRAMMDKL 1711

Query: 1715 LAQLKNAGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDT 1774
            L QLKNAGP  SDPSSARKRA+MR+KL ++KD+ + ++ DL++ + SI+YSP   +  D 
Sbjct: 1712 LDQLKNAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNASQ--DQ 1769

Query: 1775 SLGEDEMILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXX 1834
            S   +E    SPT     N          +N+   + D+E     +   D          
Sbjct: 1770 SANAEEA---SPTVHKGSN----------KNNKPVLSDLESPIKASRNAD------RNNE 1810

Query: 1835 XXXXVITDRAKALLMELRGSQTPSKKNSHLDDQXXXXXXXXXXXXQTFGEESNSTPSNRL 1894
                 I+D+AK LLMEL G+  P+++   L+              Q  GE      SN+L
Sbjct: 1811 NEEEEISDKAKNLLMELSGNGAPTRREELLNGH-KERLRARRRRTQGHGE---LISSNKL 1866

Query: 1895 TFVSDEN---SPTATEF 1908
             F+ DE    +PT +EF
Sbjct: 1867 AFLDDETPPVTPTDSEF 1883

>KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1.82
            YNL271C
          Length = 1957

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/623 (60%), Positives = 470/623 (75%), Gaps = 34/623 (5%)

Query: 1245 RSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVL 1304
            +S   S +L +SPSL+ +YPR QKK+KQLHW+K++ ++ SIW++  AE+FADDL+EKGV 
Sbjct: 1285 KSVSSSPLLPQSPSLFERYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFADDLFEKGVF 1344

Query: 1305 HNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCN 1364
             NLEKAFAARE+KSLA+K+K+DLDKI+FLSRDISQQFGINLHM+ SL+V++LV KILKC+
Sbjct: 1345 SNLEKAFAAREVKSLASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVEDLVTKILKCD 1404

Query: 1365 RDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQ 1424
            RD ++TPSVIEFLSKPEIT+VS+NLARNY+PY TDWEG+K +EDAK PEK  + LQRADQ
Sbjct: 1405 RDFLHTPSVIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKDPNDLQRADQ 1464

Query: 1425 IYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVI 1484
            IY+QLMVNLQ YW SRMRA+K+IT+YEKEY EL+ KLR++D AV ++Q+S+NL N+FNVI
Sbjct: 1465 IYLQLMVNLQPYWASRMRALKIITTYEKEYNELLLKLRKVDKAVGSLQESENLRNVFNVI 1524

Query: 1485 LAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELE 1544
            LAVGNYMND+SKQAQGFKL+TLQRLTFIKDSTNSMTFLNYVEKIIR NYP FN F++ELE
Sbjct: 1525 LAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTNSMTFLNYVEKIIRMNYPSFNSFLQELE 1584

Query: 1545 PVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEAT 1604
            PVL+VVKIS+EQL NDC EF QS+ NVERS+EIGNLSDSSKFHPLD+V+ KVLP LP+  
Sbjct: 1585 PVLEVVKISIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHPLDRVLAKVLPTLPDVR 1644

Query: 1605 KKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEE 1664
            KK DLL DEV LT MEF+ LMQ +GED+ DKFA+NSFFKKFADFINEY+KA+ QN+K EE
Sbjct: 1645 KKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADFINEYRKAQEQNIKVEE 1704

Query: 1665 EVRKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPA 1724
            E   YERHK+MV                    + +  + + D RG MDKLL QLKN GP+
Sbjct: 1705 EEEAYERHKRMVEEQQRKAERKEAKNQNNIDENEDDDQERTDRRGTMDKLLEQLKNVGPS 1764

Query: 1725 RSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMILK 1784
            R+DPSSARKRA+ RKK+L++K+ T  ++ DL     SIIYSP    +  T  G +     
Sbjct: 1765 RADPSSARKRALARKKMLTDKEGTVNMMHDLETESDSIIYSPDNKAIGSTPFGAN----G 1820

Query: 1785 SPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXXXXXXVITDRA 1844
            + + K   N   + +  K   D L+ ++                           I++RA
Sbjct: 1821 ASSHKQNSN---ELSPSKGFRDDLSEEE---------------------------ISERA 1850

Query: 1845 KALLMELRGSQTPSKKNSHLDDQ 1867
            K LLM LRG+ +PSK+NS LD+ 
Sbjct: 1851 KTLLMGLRGTASPSKRNSMLDEH 1873

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/821 (48%), Positives = 541/821 (65%), Gaps = 37/821 (4%)

Query: 326  SSDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRC 385
            SSDKTN  P  YV KI++D LS +E+ DLWVTLRTEQLDWVD+FLE+QGHIA+AN L++ 
Sbjct: 309  SSDKTNRPPNRYVEKIIADKLSPDEMRDLWVTLRTEQLDWVDSFLENQGHIAMANILMKQ 368

Query: 386  IYKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTR 445
            IYKT P  +LS +L+EKE  FFKCF+VL+ML QG+YEF+KHKLM DT+A GLFSTR+ TR
Sbjct: 369  IYKTTPKDHLSSKLLEKENSFFKCFKVLSMLSQGIYEFSKHKLMTDTIARGLFSTRLGTR 428

Query: 446  KMALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKI 505
            KMA+EI V ++ K+N  RFE+++ SLD+ FR+  N +M + + +    F   +PD+  K+
Sbjct: 429  KMAIEIFVCMLEKRNKSRFEAILNSLDQNFRIGSNFHMFQNLKKLPQYFIHLTPDSHLKV 488

Query: 506  FQAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQ 565
             QA++ S+E+T++GRGKMGS VGAS D K SGGENAILEYCLW ++F+N LCN S  + Q
Sbjct: 489  LQAWLFSIENTIDGRGKMGSLVGASTDLKNSGGENAILEYCLWTMVFVNMLCNASTIIQQ 548

Query: 566  RVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQD 625
            R++LRTK EN G LR+M K+KL++YEK+  ++E+YE++KLDDFN +LE K+ ++ +N+QD
Sbjct: 549  RMLLRTKLENSGFLRIMNKIKLLNYEKVIDEIESYENNKLDDFNLMLESKNKNSNVNLQD 608

Query: 626  PTSLIGSLWEVCKGTENEKXXXXXXXXXXXXXXKLVDDKREPAKLSKQLKLMDSLMTNIT 685
            P SL+ +LW+ CKGTENEK              +L+++  +P KLSKQLKLMDSL+TN++
Sbjct: 609  PVSLLNNLWQSCKGTENEKLLISLIQHLFLSSSRLIEEVDDPTKLSKQLKLMDSLVTNVS 668

Query: 686  ASE-VDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAE 744
            +S   DE++ MN+AIQRLYDSMQTD+VARRAILE+RTL+KKLEE+ AEK+ L EKLSKAE
Sbjct: 669  SSSTADEESTMNMAIQRLYDSMQTDEVARRAILESRTLTKKLEELQAEKDLLHEKLSKAE 728

Query: 745  NGLVGQXXXXXXQRDNILTKSQRVTKQLQAXXXXXXXXXXXXXXXXXXXXXXILTIVNTN 804
            NGLVGQ      +RD IL K+QRVT+QLQ+                      +LTI+NT 
Sbjct: 729  NGLVGQLENDLNERDQILAKNQRVTQQLQSELEELKKKHLLEKHEHEVELRKMLTILNTR 788

Query: 805  T---DADASLNNSSD--------KKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRL 853
            +   D   +++   D        K  NIQK L+  L R K D   D KKFG++VQPNKRL
Sbjct: 789  SSTNDGAKTIDKDKDNISKLNLQKHENIQKVLQDGLIRAKNDFTIDAKKFGMTVQPNKRL 848

Query: 854  RMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNXXXXXXXXXXXXXXXXXXXXXXN 913
            +MLR+QMEDIE EAR+LEMTNF+E ++  LE P  +                        
Sbjct: 849  KMLRMQMEDIENEARQLEMTNFTEFERKKLEPPVEVTKPKHRHKKHKIEKI--------- 899

Query: 914  NRKRANAIKKQ--KLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLE 971
            N++ +N  K +  KL +LR  LA IQ E+N++SKFN+++RVNELF EKK +AL RL+ LE
Sbjct: 900  NQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERVNELFNEKKLKALQRLKELE 959

Query: 972  KKYKSFEIDFDPNDFKQAQLD-------SNASYESLDPNFVTKKITDIDRIADELDAFXX 1024
             KYK F I+F+  DF + + +       +   YESLDP    KK+ DIDR+ ++L     
Sbjct: 960  TKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIYEKKLDDIDRLTEQLLNLQK 1019

Query: 1025 XXXXXXXXXXXXXXEKNYYESNA----VPTIGPQKGLIDGSSFLESLSEKYGTAQNTEGT 1080
                           ++  E++     V +   +       SFLE+LSEKYGT Q     
Sbjct: 1020 TQELREESSSSYSSSESDEENDDDEIFVASSSSKPAGSGTRSFLETLSEKYGTGQKNVAM 1079

Query: 1081 SLSPLSPQNRIASLGEKSFMNRFKRKPSSMQFLEELSQKVG 1121
            + +P S   RI +  EK F++R +R  ++  FL+EL++KV 
Sbjct: 1080 TATPNS---RIVTQSEKQFLDRMRRSSTAAPFLQELTEKVA 1117

 Score =  104 bits (260), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/79 (60%), Positives = 63/79 (79%), Gaps = 1/79 (1%)

Query: 159 GSTPSVFSQ-GSYANLSKYMDSNGRLNLDMPTDTHEIESLFEELMYKRNILQALSPDKQR 217
            S+ S+ SQ  SY N SK++  +G+ NL+MP D  EIE+LFEE+MYKRNILQ LS +KQR
Sbjct: 143 SSSASIHSQNSSYINFSKFITPDGKTNLEMPRDPKEIENLFEEIMYKRNILQNLSVEKQR 202

Query: 218 DIMNYDTKKKWMIVKQDLQ 236
           ++MNYD +KKW+IVKQD+Q
Sbjct: 203 ELMNYDVRKKWLIVKQDIQ 221

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/686 (59%), Positives = 500/686 (72%), Gaps = 36/686 (5%)

Query: 1243 MYRSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKG 1302
            MYR+ D +   + SP+ + KYPR QKKLKQLHW+KLDD++ SIW +  AE+FADDL+EKG
Sbjct: 1420 MYRT-DSAPDFSTSPNFFEKYPRSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFEKG 1478

Query: 1303 VLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILK 1362
            VL  LE AFAAREIKSLA+KKKED  KI++LSRDISQQFGINLHMF +LTVD+L+ KI++
Sbjct: 1479 VLKRLESAFAAREIKSLASKKKEDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKIIR 1538

Query: 1363 CNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRA 1422
            C+R ++NTPSVI+FLSK EI +VS+NLAR+YAPY TDWEGVK V+DAK PEK  + LQRA
Sbjct: 1539 CDRSILNTPSVIDFLSKQEIVEVSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQRA 1598

Query: 1423 DQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFN 1482
            DQIY+QLMVNLQSYW SRM A+KV+TSYEK++ EL+ KLRR+D AV +IQKS+NL N+FN
Sbjct: 1599 DQIYLQLMVNLQSYWGSRMIALKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNVFN 1658

Query: 1483 VILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEE 1542
            VILAVGN+MND+SKQAQGFKL TLQRLTFIKDSTN+MTFLNYVE IIR+NYPEFN F+ E
Sbjct: 1659 VILAVGNFMNDASKQAQGFKLATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFLNE 1718

Query: 1543 LEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPE 1602
            L+PVLDVVK+S+EQLV DC EF+Q I+NV RS+EIG LSDSSKFHP DKV+ KVLPVLPE
Sbjct: 1719 LQPVLDVVKVSIEQLVRDCKEFSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVLPE 1778

Query: 1603 ATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKA 1662
            ATKK+DLL+DEVKL+ MEFE LMQ FGEDS DKFA+NSFFKKFADFINEYK+A+ QNLK 
Sbjct: 1779 ATKKADLLSDEVKLSIMEFENLMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNLKV 1838

Query: 1663 EEEVRKYERHKQMVXXXXX--XXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQLKN 1720
            EEE R YE HK+ +              +  +T  +D    E   D R  MDKLL QLKN
Sbjct: 1839 EEEERIYENHKKRIEEQQKRLEDSKKKSHSDDTSNTDGTEEEEDEDRRDVMDKLLEQLKN 1898

Query: 1721 AGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDE 1780
             GP ++DP+SARKRA++RKKL +EK++ S IL +   G+ SI+YSPT  K+    +  + 
Sbjct: 1899 VGPVKTDPTSARKRAMVRKKLQNEKETASQILKEFETGEDSIVYSPTDSKITPKKVSNE- 1957

Query: 1781 MILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXXXXXXVI 1840
              L+SPTP  K +L    ++      T T D    N  +N + D               I
Sbjct: 1958 -YLQSPTPGEKSSLADMTSTPNPTTITTTTDGKVTNDSSNDDLD-------------QEI 2003

Query: 1841 TDRAKALLMELRGSQTPSKKNSHLDDQXXXXXXXXXXXXQTFGEESNSTPSNRLTFVSDE 1900
             DRAK+LL ELRGSQTP++KNS L+++                  ++   SN+L FVS +
Sbjct: 2004 VDRAKSLLFELRGSQTPTRKNSVLEERKEKLRARR--------RNTSDLTSNKLKFVSSD 2055

Query: 1901 NSPTATEFVDADEDT----LQENVPN 1922
             +      VD + D+     QE+ PN
Sbjct: 2056 KT------VDGEPDSPDLLTQESNPN 2075

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/852 (45%), Positives = 526/852 (61%), Gaps = 65/852 (7%)

Query: 326  SSDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRC 385
            S D+TN  P  Y+++IL+D LS +E+NDLWVTLRTEQL WV+ FLE QGHIA+AN+L++ 
Sbjct: 414  SPDRTNRLPNDYIKEILNDRLSVDEMNDLWVTLRTEQLTWVNTFLEDQGHIAMANSLMKS 473

Query: 386  IYKTAPGSN-LSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVST 444
            IY+     N LS  LI+KEY FFKCFRVL+ML QGL EF KHKLM DTL  GLFSTR++T
Sbjct: 474  IYRINTMQNSLSTYLIDKEYNFFKCFRVLSMLSQGLTEFIKHKLMTDTLVQGLFSTRLAT 533

Query: 445  RKMALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFS--RTSPDTQ 502
            RK+A EI V ++ K N      ++ + D+ F ++ENLNM+ ++      +    ++  TQ
Sbjct: 534  RKIATEIFVLMLQKINDDGLNILLTTFDKTFSINENLNMVYLLKNVPDKYHYLNSTNTTQ 593

Query: 503  FKIFQAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDE 562
             K+  +++ ++ESTL+GRGKMGS VGAS DFK++GGENAILEYC W ++ IN+LCN S  
Sbjct: 594  IKVLVSWLYAVESTLDGRGKMGSLVGASQDFKITGGENAILEYCQWTMVLINRLCNASTI 653

Query: 563  LNQRVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQIN 622
            +NQRV+LRTK EN+G +R+M KLK +DYEK+T Q+E+YE+ KLDD N+LLE  + S+ ++
Sbjct: 654  INQRVLLRTKLENIGSIRIMNKLKKLDYEKITEQLEDYENKKLDDLNTLLEQDTKSS-VD 712

Query: 623  MQDPTSLIGSLWEVCKGTENEKXXXXXXXXXXXXXXKLVDDKREPAKLSKQLKLMDSLMT 682
            + +P SL+  L EVCK TE E+              KL DDK +P KLSKQLKLMDSLMT
Sbjct: 713  LDNPISLLSHLLEVCKDTEGEQSLTSIIQHLYLSSSKLFDDKDDPTKLSKQLKLMDSLMT 772

Query: 683  NITASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSK 742
            + T S VD ++ MN+AIQ LYDSM TDDVARRAILE+R L+KKLEEV AE+++L  +LS+
Sbjct: 773  DATLSTVDNESKMNMAIQHLYDSMVTDDVARRAILESRNLTKKLEEVQAERDFLSNRLSE 832

Query: 743  AENGLVGQXXXXXXQRDNILTKSQRVTKQLQAXXXXXXXXXXXXXXXXXXXXXXILTIVN 802
            AENGLVG+      QRD+IL K+QRVT+QL+                       +LTI+N
Sbjct: 833  AENGLVGKLENELAQRDSILAKNQRVTQQLRTELDELKKKHLMEKHDHEVELRKMLTILN 892

Query: 803  TN--TDADASLNNSSDKKHN---------------IQKALETELSRTKKDLNNDVKKFGI 845
            +   T+ D ++++ S  K N               I+KAL+  L +TKKDL+ D K+FGI
Sbjct: 893  SRPETELDNTMSSISRTKRNKHEIEKLELLKRKKVIEKALQDGLQKTKKDLSLDSKRFGI 952

Query: 846  SVQPNKRLRMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNXXXXXXXXXXXXXXX 905
            +VQPNKRL+ LRLQMEDIE EAR+LEMTNF++     + +P                   
Sbjct: 953  TVQPNKRLQALRLQMEDIENEARQLEMTNFTD----PVRTPKKGQEKRDSHNKHPSLKPG 1008

Query: 906  XXXXXXXNNRKRANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALN 965
                    +R    A K+QKL ELR+ LA IQ ETND+S+FNV++ VNELF  KK +A+ 
Sbjct: 1009 IPIAKKNKDRSEEMAKKQQKLAELRKALADIQQETNDISRFNVEEHVNELFNAKKIQAME 1068

Query: 966  RLQMLEKKYKSFEIDFDPNDFKQ------AQLDSNA-SYESLDPNFVTKKITDIDRIADE 1018
            RL+ LE  Y++F +DF+  +F +       +LD ++ +YE+LDPN    K+ ++D+ + +
Sbjct: 1069 RLKELETMYQNFGVDFNMEEFLEKNNTSTKELDPDSPAYETLDPNLFIDKMDELDKFSMK 1128

Query: 1019 LDAFXXXXXXXXXXXXXXXXEKNYYE-----------------------SNAV----PTI 1051
            LD                    N  +                       SN V     T 
Sbjct: 1129 LDQLTSDLNNTMSAKQNSLSTTNSNQISTPSSTSSSDFESDEENENTALSNNVNDNSSTF 1188

Query: 1052 GPQKGLIDGSSFLESLSEKYGTAQNTEGTSLSPLSPQNRIASL--GEKSFMNRFKRKPSS 1109
              Q     GSSFLESLS+KYGT QN  G    P+S      S    E+ FM+R K++ ++
Sbjct: 1189 SHQSTTSGGSSFLESLSQKYGTGQNASG----PMSSNTPNVSHYNPERKFMSRMKKQHAT 1244

Query: 1110 MQFLEELSQKVG 1121
              ++ EL+QKV 
Sbjct: 1245 PNYIRELNQKVS 1256

 Score =  105 bits (262), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/169 (37%), Positives = 95/169 (56%), Gaps = 7/169 (4%)

Query: 70  PLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSASV 129
           PLN R SL N N++QY+       + ++SH  N   N    +N N    +  +++R  S 
Sbjct: 95  PLNMRNSLTNPNMNQYVTSPY-THEYNNSHSRNTSIN---SVNSNPL-STKYSYSRRGSN 149

Query: 130 QXXXXXXXXXXXXXXXXXXXXXXQSTNFSG--STPSVFSQGSYANLSKYMDSNGRLNLDM 187
           Q                      + +  S   ++ S+ SQGS  NL K+M  +G++NL+M
Sbjct: 150 QILSPSPTGNSSNNNTSNINPQQRYSVHSNNPNSSSILSQGSLHNLMKFMTPDGKVNLEM 209

Query: 188 PTDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQ 236
           P +  E+E+L+E++MYKRNILQ L  DKQR++M+YD  KKW+IVKQDLQ
Sbjct: 210 PNNPAEVEALYEDIMYKRNILQNLPADKQRELMSYDVSKKWLIVKQDLQ 258

>NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON} 
          Length = 2022

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/620 (61%), Positives = 471/620 (75%), Gaps = 29/620 (4%)

Query: 1250 SQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLEK 1309
            S +L +SPSL+  YPRP KKLKQLHW+K++ ++ SIW +  AEQFADDLYEKGVL  LE 
Sbjct: 1336 SPLLPQSPSLFENYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELEN 1395

Query: 1310 AFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMN 1369
            AFAAREIKSLA+K+K+DL KI+FLS D+SQQFGINLHM+ SL V +L+ KILKC+RD + 
Sbjct: 1396 AFAAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQ 1455

Query: 1370 TPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQL 1429
            TPSVIEFLS+PEI DVS+NLARNYAPY+ DWEG+K+VEDAK PEK+ + LQRADQIY+QL
Sbjct: 1456 TPSVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQIYLQL 1515

Query: 1430 MVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGN 1489
            MVNLQSYW SRMRA+KVIT++EKEY EL+TKLR++D AVS++Q+S+NL N+F VILAVGN
Sbjct: 1516 MVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVILAVGN 1575

Query: 1490 YMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLDV 1549
            YMND+SKQAQGFKL TLQRLTFIKDSTN+MTFLNYVEKI+R NYP FN F+ ELEPVLDV
Sbjct: 1576 YMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELEPVLDV 1635

Query: 1550 VKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDL 1609
            VKIS+EQLV+DC EF+QSI+NVERS+EIGNLSDSSKFHP D+V+ KVLP LP+A KK +L
Sbjct: 1636 VKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDARKKGEL 1695

Query: 1610 LTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKY 1669
            L DEVKLT MEF  LMQ +GEDSGDKFA+NSFFKKFADFI EYKKA+ QNL+ EEE + Y
Sbjct: 1696 LGDEVKLTIMEFLRLMQIYGEDSGDKFAKNSFFKKFADFITEYKKAQTQNLRLEEEEKVY 1755

Query: 1670 ERHKQMVXXXXXXXXXXXXNYMETGVSDSESAE-AKGDNRGHMDKLLAQLKNAGPA-RSD 1727
            ERHK+MV            + + +G   ++  E   GD R  MD LL QLKN  P  ++D
Sbjct: 1756 ERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTPTNKTD 1815

Query: 1728 PSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMILKSPT 1787
            PSSARKRA++RKKL+ E  STS IL D++  D SIIYSP   K + T++      L+S  
Sbjct: 1816 PSSARKRALVRKKLMGE--STSNILKDIDTEDDSIIYSPDAKKPMATTVDMANTTLES-- 1871

Query: 1788 PKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXXXXXXVITDRAKAL 1847
                   E D +S    N +   +++  N D   E                 I +RA+AL
Sbjct: 1872 -------ELDVSSPTRHNSSPIKNEISMNVDEEEEE----------------IGNRAQAL 1908

Query: 1848 LMELRGSQTPSKKNSHLDDQ 1867
            L++L GS +P+K++S L++ 
Sbjct: 1909 LIQLTGSHSPTKRHSLLNEH 1928

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/858 (46%), Positives = 527/858 (61%), Gaps = 91/858 (10%)

Query: 327  SDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCI 386
            +DKTN  PI YV+KI+SDTL+  E+ DLWVTLRTEQLDWVDAF+EHQGHIA+AN L++ I
Sbjct: 331  TDKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSI 390

Query: 387  YKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRK 446
            YKT P   L+ +L+EKE  FFKCFRVL+ML QGL EFTKH+LM  T+A GLFST +STRK
Sbjct: 391  YKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRK 450

Query: 447  MALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIF 506
            MA EI V ++NKKN +RF+ ++  LD+ F++ +NL+M   + +FG  F   + D+  K+ 
Sbjct: 451  MATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNLKVT 510

Query: 507  QAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQR 566
            +A++ ++E +L+GRGKMGS VGASDD+K SGGENA LEYC W++IFIN LC  SD +NQR
Sbjct: 511  RAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQR 570

Query: 567  VVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDP 626
            ++LR K E  G +R+M ++K + YEK+  Q++ YE+ KLDD N LLE+ + +A IN+ DP
Sbjct: 571  MLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINLHDP 630

Query: 627  TSLIGSLWEVCKGTENEKXXXXXXXXXXXXXXKLVDDKREPAKLSKQLKLMDSLMTNITA 686
            TSL+ +LW+ CKGTENEK              +L++DK++  +LSKQLKLMDSL+TN++ 
Sbjct: 631  TSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTNVSV 690

Query: 687  SEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENG 746
            +  D+++ MN+AIQRLYD+MQTD+VARR+ILE+RTL+KKLEE  AE + L +KL  AE+G
Sbjct: 691  ASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHG 750

Query: 747  LVGQXXXXXXQRDNILTKSQRVTKQLQAXXXXXXXXXXXXXXXXXXXXXXILTIVNTNTD 806
            LVGQ      QRD +  K+QR+T+QLQA                      +LTI+N  +D
Sbjct: 751  LVGQLQDELRQRDRMFAKNQRITEQLQAELEDLKKKHLLEKHEQEVELRKMLTILNARSD 810

Query: 807  ADASLNNSSDKKH-------------NIQKALETELSRTKKDLNNDVKKFGISVQPNKRL 853
                +   S KKH             NIQK L+  L+RTKKD   D K FG++VQPNKRL
Sbjct: 811  K-GEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPNKRL 869

Query: 854  RMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNXXXXXXXXXXXXXXXXXXXXXXN 913
            + LR+QMEDIE EARELEMTNF+E +K  LE PA                          
Sbjct: 870  KALRMQMEDIENEARELEMTNFAEFEKKKLE-PA-------------PKIKKLKQKKQNK 915

Query: 914  NRKRANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKK 973
            N K+    K +KL ELR+ LA IQ E+ND+SKFNV++RVNELF EK+  AL RL+ LE K
Sbjct: 916  NEKKEEDDKIKKLNELRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETK 975

Query: 974  YKSFEIDFDPNDFKQAQL------DSNASYESLDPNFVTKKITDIDRIADE-LDAFXXXX 1026
            YK F I+F+ +D  +         D +  Y SLDPN    K+ +++RI ++ LDA     
Sbjct: 976  YKDFGINFNIDDISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQLLDA----- 1030

Query: 1027 XXXXXXXXXXXXEKNYYESNAVPT------------------------------------ 1050
                        EKN  +S+   T                                    
Sbjct: 1031 -------QAKLNEKNLKDSSNKSTFSESSSSSSSSSSSSSSSSSSDEEEIDDIKSRDRQS 1083

Query: 1051 -IGPQKGLIDGSSFLESLSEKYGTAQNTEGTSLSPLSPQ-NRIASLGEKSFMNRFKRKPS 1108
             I  Q       SFLE+LS+KY   QN      +P SPQ +R     +  F+NR ++   
Sbjct: 1084 EISAQSTSSAAGSFLEALSQKYAMGQN------NPSSPQRDRPVKASQYDFINRVRKNNI 1137

Query: 1109 SMQFLEELSQKVGGEALG 1126
            + QFLEELS KV   + G
Sbjct: 1138 TPQFLEELSGKVVPPSSG 1155

 Score =  117 bits (293), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 95/173 (54%), Gaps = 25/173 (14%)

Query: 64  SMDDLKPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNH 123
           S +++KPL K T+LN QNLSQYIN K                        NI D S    
Sbjct: 74  SSNEIKPLIKNTTLNTQNLSQYINSK------------------------NIPDHSRSQS 109

Query: 124 NRSASVQXXXXXXXXXXXXXXXXXXXXXXQSTNFSGSTPSVFSQGSYANLSKYMDSNGRL 183
            +S+S                        Q TN S S  SV SQGSY+NLSK+M  +G+L
Sbjct: 110 IQSSSKYSYSSRRASSQTNPSVTGYKLDRQYTNQS-SAVSVLSQGSYSNLSKFMTHDGKL 168

Query: 184 NLDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQ 236
           NL+MPTD  EIE L++E+M KRNILQ+L   KQ ++M+YD  KKW+IVKQDLQ
Sbjct: 169 NLEMPTDPSEIEYLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQ 221

>KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON} 
          Length = 2028

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/669 (59%), Positives = 492/669 (73%), Gaps = 51/669 (7%)

Query: 1258 SLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLEKAFAAREIK 1317
            S++ KYPRPQKKLKQLHW+KLD +  SIWS++ AE+FADDLYEKGVL NLEKAFAARE+K
Sbjct: 1371 SIFEKYPRPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLYEKGVLSNLEKAFAAREVK 1430

Query: 1318 SLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFL 1377
            SL++KK +D  KI+FL+RD+SQQFGINLHMFG+L+V+ELV KILKC+R+V+N+PSVIEFL
Sbjct: 1431 SLSSKKGDD-SKITFLTRDVSQQFGINLHMFGNLSVEELVTKILKCDREVLNSPSVIEFL 1489

Query: 1378 SKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYW 1437
            SK E+ +VS+NLARNY+PY TDWEGVK +EDAKAPEK  + LQRADQ+Y+ LMVNLQ YW
Sbjct: 1490 SKQEVVEVSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNELQRADQLYMSLMVNLQPYW 1549

Query: 1438 PSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQ 1497
             SRMRA+KVIT+YE+EY EL+ KLR++D AV ++Q+S+NL N+ NVILAVGNYMND+SKQ
Sbjct: 1550 SSRMRALKVITTYEREYAELLEKLRKVDKAVGSLQQSENLKNVLNVILAVGNYMNDTSKQ 1609

Query: 1498 AQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQL 1557
            AQGFKL TLQRLTFIKD+TNSMTFLNYVEKI+R+NYP FN F+ EL+PVLDVVKIS++QL
Sbjct: 1610 AQGFKLATLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDFLNELQPVLDVVKISIDQL 1669

Query: 1558 VNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLT 1617
            V+DC EF+ S++NVERS+EIGNLSDSSKFHP D+V+ KVLPVLPEA KK+DLLTDEVKLT
Sbjct: 1670 VSDCQEFSGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPVLPEARKKADLLTDEVKLT 1729

Query: 1618 FMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMVX 1677
             +EF  LMQ +GEDS DKFA+NSFFKKFADFI EYKKA+ QN+ AEEE ++YERHK++V 
Sbjct: 1730 MLEFNNLMQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQNVAAEEEEQQYERHKKIVE 1789

Query: 1678 XXXXXXXXXXXNYMETGVSDSESAE-------AKGDNRGHMDKLLAQLKNAGPARSDPSS 1730
                         +E+   D+ + E          D R  MDKLL QLKNAG  ++DPSS
Sbjct: 1790 EQQRQGEEARKR-LESASPDATNGEDTTAVDDETKDRRAIMDKLLEQLKNAGTVKADPSS 1848

Query: 1731 ARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMILKSPTPKS 1790
            ARKRA+ R+KLL +KD+ S +L D++  D S++YSP T +    S+G   +I  SPTP  
Sbjct: 1849 ARKRALARRKLLGDKDAASALLHDIDTDDDSLVYSPDTKR---QSVG--HLIGGSPTP-- 1901

Query: 1791 KDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXXXXXXVITDRAKALLME 1850
             D L     + +  + T   DD +                         +TDRAKALLME
Sbjct: 1902 GDKLLGSTPTKELSSPTAGQDDED-------------------------VTDRAKALLME 1936

Query: 1851 LRGSQ-TPSKKNSHLDDQXXXXXXXXXXXXQTFGEESNSTP---SNRLTFVSDENSPTAT 1906
            LRG Q +P KKN+ LD+Q            +   E + + P    N+L+F   E   + T
Sbjct: 1937 LRGGQSSPMKKNAFLDEQ-----RERIRSRRRRNELAGTEPLRGGNKLSFFEAETETSET 1991

Query: 1907 EFVDADEDT 1915
               DAD DT
Sbjct: 1992 AH-DADNDT 1999

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/1114 (40%), Positives = 640/1114 (57%), Gaps = 106/1114 (9%)

Query: 69   KPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDG--SSP--NHN 124
            KPL+K+ ++N+QNLS Y +G +  + SD                    DG  +SP   H+
Sbjct: 152  KPLSKKATMNSQNLSHYTSG-VSATSSDG-------------------DGGMASPEYTHS 191

Query: 125  RSASVQXXXXXXXXXXXXXXXXXXXXXXQSTNFSGSTPSVFSQGSYANLSKYMDS--NGR 182
            R+ S Q                       +   S +  S+ SQGS + L     S  +G+
Sbjct: 192  RTQSGQTSRFSYTSPSRRSSSDAKLAKYHTAQSSQN--SIASQGSLSTLYNRFISPEDGK 249

Query: 183  LNLDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQXXXXXX 242
            L L+MP D  E+E L+E++MYKRNILQ L  DKQ ++MNYD KKKW+IVKQDLQ      
Sbjct: 250  LRLEMPDDPAEVELLYEDIMYKRNILQNLPTDKQLELMNYDVKKKWLIVKQDLQNERKKL 309

Query: 243  XXXXXXXXXXXXXXXXXX-----------------XXXXXXXXXXXVNTMDNNLRTIDTN 285
                                                          V T  N+  +I ++
Sbjct: 310  KTKTSSHQQTVQSAPFMNLQDTSSSASLPGQGFHDQQSVVSETSSRVPTT-NDAASILSS 368

Query: 286  ASNPRIHRKGQKSMSSLSNATTTA-PSGVNAEYSKIRSISESSDKTNIAPIHYVRKILSD 344
            A+    H   +K   +L+N   T  P+   AE     S + +SDKTN  PIHYV+KI++D
Sbjct: 369  ATPSLRHPSRRKQQYTLTNKQHTVYPANGTAERHASSSSTLASDKTNRLPIHYVKKIIAD 428

Query: 345  TLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELIEKEY 404
             LS++ELNDLWVTLRTEQLDWVDAFL++QGHIA+AN L++ +YKT+P  +LS  L++KE 
Sbjct: 429  QLSQDELNDLWVTLRTEQLDWVDAFLDNQGHIAMANVLMKSLYKTSPNVSLSGPLLDKEQ 488

Query: 405  GFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKMALEILVYIINKKNTQRF 464
             +FKCF+VL+ML QGL EFT H+L+ DT+A GLFS+R+ TRKMA EI V ++  KN  RF
Sbjct: 489  SYFKCFKVLSMLAQGLREFTDHRLITDTIARGLFSSRLPTRKMATEIFVCMLETKNQTRF 548

Query: 465  ESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIFQAFVISLESTLNGRGKMG 524
            ++VI SLD+ F++  N +M+  + +    F   +  +  K+ QA++ +++ TL+GRGKMG
Sbjct: 549  DAVITSLDQNFQIGSNAHMVNNLQKMPDYFIHLNLQSTLKVVQAWLFAIDQTLDGRGKMG 608

Query: 525  SKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTK 584
            S VGASD+FK   GEN++LEYC W L+F+NK C  S+ LNQR++LRTK EN G LR+M K
Sbjct: 609  SLVGASDEFKRIDGENSVLEYCQWTLVFVNKFCQSSNNLNQRMLLRTKLENAGFLRIMNK 668

Query: 585  LKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEK 644
            +KL+DYEK+  Q+E YE  KLDDFNSLLE ++  A I+MQ+P SL+ +LW+ C+GT++E 
Sbjct: 669  MKLLDYEKIRDQIEFYEAGKLDDFNSLLESQNKHANIDMQNPLSLLQNLWDACRGTDSEN 728

Query: 645  XXXXXXXXXXXXXXKLVDDKREPAKLSKQLKLMDSLMTNITAS---EVDEQTHMNLAIQR 701
                          +L+ + ++P +L+KQLKL+DSL+TN+ +S     DE+T M++ IQR
Sbjct: 729  LLVSLVQHLFLSSTRLIQNNKDPTQLAKQLKLIDSLVTNVGSSVSAVADEETTMSMTIQR 788

Query: 702  LYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQXXXXXXQRDNI 761
            L+DSMQTD+VARRAI+E+RTL+KK+EE+ AEK+ L +KLSKAE GLVG+      +RD I
Sbjct: 789  LFDSMQTDEVARRAIIESRTLTKKMEELQAEKDRLGDKLSKAEGGLVGELQRDIRERDAI 848

Query: 762  LTKSQRVTKQLQAXXXXXXXXXXXXXXXXXXXXXXILTIVNTNTDADASLNNS------- 814
            L K+QRV KQL+                       +LTI+N+    + + N S       
Sbjct: 849  LAKNQRVNKQLENELEELKRKTLMEKHEHEVELRKMLTIINSKASPNLAQNPSASVLKSH 908

Query: 815  ---------SDKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEK 865
                     S+++  IQK L+  L+RTKKD  ND KKFG++VQPNKRL++LR+++EDIE 
Sbjct: 909  DPKNKESLLSEQQSKIQKVLQDGLTRTKKDFTNDAKKFGMTVQPNKRLQLLRMKVEDIEN 968

Query: 866  EARELEMTNFSEHQKLSLESPAVLNXXXXXXXXXXXXXXXXXXXXXXNNRKRANAIKKQK 925
            EAR+LEMTNF++ +K +  +P +L                        N++  N  K + 
Sbjct: 969  EARQLEMTNFADIEKNA--TPVILTKGTKKKKSKKKLKTAQPDKKQRANQRNENQ-KIEA 1025

Query: 926  LLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEIDFDPND 985
            L +LR  L  IQ+E+ND+SKFNV++ VNELF E+K +AL RL+ LE K+     +F+ +D
Sbjct: 1026 LNKLRMALTAIQSESNDISKFNVEEHVNELFTERKFKALQRLRDLESKFNGLNTNFNIDD 1085

Query: 986  F----KQAQLDSNASYESLDPNFVTKKITDIDRIADELDAFXXXXXXXXXXXXXXXX--- 1038
                 ++A   ++  Y SLDP     K+ +I+R+ ++L                      
Sbjct: 1086 IIASTEKALTATDDGY-SLDPRRADNKLDEIERLTNDLSKLHDSMKEQEQATLQSDNSSE 1144

Query: 1039 -----------EKNYYESN-AVPTIGPQKGLIDGSSFLESLSEKYGTAQNTEGTSLSPLS 1086
                       E +  +S+ + PT+G         SFL SLS+KY T Q        P S
Sbjct: 1145 SSDSESVESDNEGSTVQSDVSEPTVG-------SGSFLASLSQKYETGQK------QPNS 1191

Query: 1087 PQNRIASLGEKSFMNRFKRKPSSMQFLEELSQKV 1120
            P     ++ +K+FM R KR   +  +L+ELS+K+
Sbjct: 1192 P----VTVNQKAFMTRLKRSSGAPLYLQELSKKI 1221

>SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1988

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/629 (59%), Positives = 462/629 (73%), Gaps = 40/629 (6%)

Query: 1243 MYRSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKG 1302
            MYR+   S +L +SPSL+ +YPRP+KKLKQLHW+K++D+  SIW  A AE++ADDLYE+G
Sbjct: 1290 MYRAATPSPLLPQSPSLFERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERG 1349

Query: 1303 VLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILK 1362
            VL  LEKAFAAREIK LAN++KEDL+K++FLSRD+SQQFGINLHM+ +L+V E+V KIL+
Sbjct: 1350 VLAQLEKAFAAREIKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILR 1409

Query: 1363 CNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRA 1422
            C++D + + SVI+FL KPEI +VS NLARN+APY T+WEGV  V++AK PEK    LQRA
Sbjct: 1410 CDKDFLGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRA 1469

Query: 1423 DQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFN 1482
            DQ+Y+++MVNLQ YW SRMRA+KVIT+YEKEY++L+TKLR ID AVS+IQ SDNL ++F 
Sbjct: 1470 DQLYLEMMVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDNLRSVFE 1529

Query: 1483 VILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEE 1542
            VILAVGNYMNDSSKQA GFKL TLQRLTFIKD  NSMTFLNYVEKIIRENY EFN F++E
Sbjct: 1530 VILAVGNYMNDSSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEFNSFLQE 1589

Query: 1543 LEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPE 1602
            LEPVLDVVKISVEQL  DC EF+Q+I+NVERS+E+GNLSDSSKFHP D+V+ KVLPVLPE
Sbjct: 1590 LEPVLDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKVLPVLPE 1649

Query: 1603 ATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKA 1662
            A K+SDLL+DEVKLT MEF+ LMQ FGED+ DKFA+NSFFKKFADFI EYKKA+A N+K 
Sbjct: 1650 ARKRSDLLSDEVKLTLMEFDGLMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQAHNIKM 1709

Query: 1663 EEEVRKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAE-----AKGDNRGHMDKLLAQ 1717
            EEE R YER K+MV               + GV D   AE     ++G+ R  MDKLL +
Sbjct: 1710 EEEERAYERRKKMVEEQHKRARLEAE---KGGVDDGSEAEGVTAVSRGE-RDVMDKLLEK 1765

Query: 1718 LKNAGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDG-----SIIYSP-TTDKV 1771
            LKNAGP +SDPSSARKRA+ RKKLL  K S++ ILD+    +      S++YSP TT K 
Sbjct: 1766 LKNAGPGKSDPSSARKRALARKKLLDGKRSSANILDNFEVDEAAPVNQSLVYSPETTLKA 1825

Query: 1772 VDTSLGEDEMILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXX 1831
             + +  E      SPTPK+            SR  ++              T +      
Sbjct: 1826 ANAAHAE------SPTPKA------------SRQGSVAGSGA-------TATPLLESPSK 1860

Query: 1832 XXXXXXXVITDRAKALLMELRGSQTPSKK 1860
                    + DRA+ LL ELRG ++  +K
Sbjct: 1861 QASAGPEDVADRARNLLKELRGPESEKRK 1889

 Score =  570 bits (1469), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 338/843 (40%), Positives = 485/843 (57%), Gaps = 66/843 (7%)

Query: 326  SSDKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRC 385
            S D  +++P +YVRKI+SD +S  +L DLWV+LRTEQLDWV  FL+ QG +AIAN L+R 
Sbjct: 293  SQDPLHLSPDYYVRKIISDKISTKQLKDLWVSLRTEQLDWVVGFLDAQGQVAIANVLLRF 352

Query: 386  IYKTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTR 445
             +K +P + L+DE ++KE+ FFKC + L  L +G  E  + KL++  +  GL S R+STR
Sbjct: 353  FHKESPDALLNDEALDKEFAFFKCLKTLLNLKEGANEAVRTKLVVSAITDGLLSLRISTR 412

Query: 446  KMALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQF-- 503
            ++A E+LV+I           VI  LD+   +S N+++   +       S  + D +   
Sbjct: 413  RIASEMLVFITQWDIPYGLNQVIGELDQESHVSSNVHLQARLLSANKRDSLLAQDHELDL 472

Query: 504  ------KIFQAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLC 557
                  K F+ ++  +E TL+GRGKMGS VGAS+DFK +GGENAILEY    L+ +N+LC
Sbjct: 473  TRDHASKKFEQWLFVVEYTLDGRGKMGSLVGASEDFKSAGGENAILEYGYLTLLLVNQLC 532

Query: 558  NFSDELNQRVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSS 617
            N   ++NQR +LR++F++ G  R+M KL+L++Y+K+  Q+  +ED   DD+N+++  KS 
Sbjct: 533  NTPADVNQRTLLRSRFKSCGLSRIMQKLELLNYDKIDEQLRIFEDRTADDYNTIMASKSI 592

Query: 618  SAQINMQDPTSLIGSLWEVCKGTENEKXXXXXXXXXXXXXXKLVDDKREPAKLSKQLKLM 677
            +  ++M++P SL+ +LWE  KGT  EK              K+ D+  +P + SKQLKL+
Sbjct: 593  NHNVDMENPLSLLQNLWESYKGTGAEKYLVSLVQHLFIASSKVQDEGDDPTEASKQLKLI 652

Query: 678  DSLMTNITASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLK 737
            DSL++N+T S +D ++  N AIQRLYDSMQTD+VARRAI+E R L++K EEV AE++YL 
Sbjct: 653  DSLVSNVTMSSIDTESSFNGAIQRLYDSMQTDEVARRAIMEARELTRKFEEVKAERDYLG 712

Query: 738  EKLSKAENGLVGQXXXXXXQRDNILTKSQRVTKQLQAXXXXXXXXXXXXXXXXXXXXXXI 797
            EKLSKAE GLVGQ      QRD IL K+QRVT+QLQA                      +
Sbjct: 713  EKLSKAEGGLVGQLQNELSQRDRILEKNQRVTEQLQADLEELKKKHLLEKHEHEVELRKL 772

Query: 798  LTIVNTNTDADASLNNS--------------SDKKHNIQKALETELSRTKKDLNNDVKK- 842
            LTI+N+     +++                 +D+K  IQKAL+  L +TKKDL  + K+ 
Sbjct: 773  LTILNSRPQGSSAVQEEEAGTASSSAPGVLHADRKLAIQKALQDRLQQTKKDLTKESKRL 832

Query: 843  ---FGISVQPNKRLRMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNXXXXXXXXX 899
                G +++PN+RL++LR +MEDIE EARELEMTNF++ Q+ ++E               
Sbjct: 833  GTTLGTTLEPNRRLKLLRSRMEDIENEARELEMTNFADIQRQTVEE-------------- 878

Query: 900  XXXXXXXXXXXXXNNRKRANAIKKQ-------KLLELRRDLAMIQAETNDVSKFNVDKRV 952
                             RA   KKQ       KL ELR+ LA +Q E+NDVSKFNV++R+
Sbjct: 879  -QTVVPALPPPAVPVLDRAPKAKKQVKEDQVRKLRELRQRLASVQKESNDVSKFNVEERI 937

Query: 953  NELFKEKKHEALNRLQMLEKKYKSFEIDFDPNDFKQAQLD----------SNASYESLDP 1002
            NELF +KK  AL+RL+ LE KYK F IDF  +    A L              ++ SLDP
Sbjct: 938  NELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSDAPPENHHAKDGQAHPSLDP 997

Query: 1003 NFVTKKITDIDRIADELDAFXXXXXXXXXXXXXXXXEKNYYESNAVPTIGPQKGLIDGSS 1062
              +++KI ++ +I DEL AF                ++   + +         G     S
Sbjct: 998  KHLSRKIEEMSKIVDELTAFKKEIENGPPSSSSSSSDEELEQDDRASI---HSGNASTGS 1054

Query: 1063 FLESLSEKYGTAQNTEGT--SLSPLSPQNRIASLG--EKSFMNRFKRKPSSMQFLEELSQ 1118
            FLE+LS+KYGT QN   T  S + +  ++     G   +SFM R K K  +  FL EL+Q
Sbjct: 1055 FLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRGYHRRSFMERVK-KSDAAPFLSELTQ 1113

Query: 1119 KVG 1121
            KV 
Sbjct: 1114 KVA 1116

 Score =  123 bits (309), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/211 (36%), Positives = 107/211 (50%), Gaps = 23/211 (10%)

Query: 26  LLHNLKKLXXXXXXXXXXXAINKSDISSPKSQLLTNKLSMDDLKPLNKRTSLNNQNLSQY 85
           L  NLKKL            I  SDISSPK  + T  +     KPL+K+T+LN QNLS Y
Sbjct: 27  LFSNLKKLTGSGNNANTSNKIEPSDISSPKI-VSTPAVPEFSGKPLSKQTTLNTQNLSSY 85

Query: 86  INGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSASVQXXXXXXXXXXXXXXX 145
           ++   P      S +    + + Y              +R +S                 
Sbjct: 86  VDMNTPHHNRSPSGMSGSPTKYSY--------------SRRSS--------QWSNGNNIG 123

Query: 146 XXXXXXXQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEELMYKR 205
                  Q TN S S+ S+FSQGS  NL+K+M ++G++ LD P++  EIE LF ELM+KR
Sbjct: 124 NGGRLSRQQTNQSLSSASIFSQGSMTNLTKFMGADGKVKLDRPSNPQEIEDLFAELMHKR 183

Query: 206 NILQALSPDKQRDIMNYDTKKKWMIVKQDLQ 236
           N  Q+L    Q+++MNYD  KKW++VKQDLQ
Sbjct: 184 NFFQSLPAAGQKELMNYDLDKKWLLVKQDLQ 214

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] {ON}
            YNL271C (BNI1) - contains formin homology domains;
            homologous to BNR1 (BNI1 related protein) [contig 118]
            FULL
          Length = 1968

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/661 (55%), Positives = 467/661 (70%), Gaps = 46/661 (6%)

Query: 1245 RSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVL 1304
            R+   S +L +SPSL+ +YPRP KKLKQLHW+K+DD+E SIW +A AEQFADDLYEKG+L
Sbjct: 1300 RTTTPSPMLPQSPSLFERYPRPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKGIL 1359

Query: 1305 HNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCN 1364
              LEKAFAAREIKSL ++KK+D DK++FLSRD+SQQFGINLHM+ SL+V+E+V KILKC+
Sbjct: 1360 SRLEKAFAAREIKSLTSRKKKDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILKCD 1419

Query: 1365 RDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQ 1424
            +D + TPSVIEFLSK EI +VS NLARN+APY TDWEG+ +V+DAK PEK    LQRAD+
Sbjct: 1420 KDFLTTPSVIEFLSKQEIVEVSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRADR 1479

Query: 1425 IYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVI 1484
            +Y++L VNLQ YW SRMRA+KVITSYEKEY++L+ KLR ID A  AIQ+S+NL N+ +VI
Sbjct: 1480 LYLELFVNLQGYWSSRMRALKVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLDVI 1539

Query: 1485 LAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELE 1544
            LAVGN+MNDSSKQAQGF+L TLQRLTFIKD  NSMTFLNYVEKI+RE YPEFN F++ELE
Sbjct: 1540 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKELE 1599

Query: 1545 PVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEAT 1604
            PV+  VKIS+EQ+  DC EF+QS++NVERS++IGNLSDSSKFHPLD+ + KVLPVLPEA 
Sbjct: 1600 PVVAAVKISIEQVSQDCKEFSQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPEAR 1659

Query: 1605 KKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEE 1664
            KK DLL DE+KLT +EF+ LM+ FGED+ DKF++NSFFKKFADF+ EYKKA+  N+K EE
Sbjct: 1660 KKGDLLMDEMKLTLLEFDNLMKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKLEE 1719

Query: 1665 EVRKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPA 1724
            E + YER K+MV                   +  ++  A GD R  MD+LL +LKNAGP 
Sbjct: 1720 EEKAYERRKKMVEEQQRRARESNEQENSVDGNADDNTAASGD-RDVMDRLLEKLKNAGPG 1778

Query: 1725 RSDPSSARKRAVMRKKLLSEKDSTSVILD--DLNAGDG-SIIYSPTTDKVVDTSLGEDEM 1781
            +SDPSSARKRA+ R+KLL    S S ILD  ++   +G S++YSP    + ++       
Sbjct: 1779 KSDPSSARKRAIARRKLLQGSSSNSTILDNFEIEKPEGKSLVYSPEQVTLSNS------- 1831

Query: 1782 ILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXXXXXXVIT 1841
            +  SPTP             + R    T  +V+    T+  +D               +T
Sbjct: 1832 VDHSPTPDV-----------RKREGQSTASEVQ----TSESSD---------------LT 1861

Query: 1842 DRAKALLMELRGSQTPSKKNSHLDDQXXXXXXXXXXXXQTFGEESNSTPSNRLTFVSDEN 1901
            DRA+ LL+ELRG ++PS++ S  D +                   NS   N L FV  E 
Sbjct: 1862 DRARNLLIELRGPESPSRRASSKDQRISKLRARRKNDGS-----GNSGSDNHLNFVGQEG 1916

Query: 1902 S 1902
            +
Sbjct: 1917 A 1917

 Score =  578 bits (1489), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 387/1113 (34%), Positives = 585/1113 (52%), Gaps = 110/1113 (9%)

Query: 46   INKSDISSPKSQLLTNKLSMDDL-----KPLNKRTSLNNQNLSQYINGKLPKSQSDSSHL 100
            ++ SDISSPK      K+++ D      KPL+K+++LN  NLS Y +  +  + + SS  
Sbjct: 49   VDISDISSPK------KINLPDTGEFSHKPLSKQSTLNIANLSAYTD--VASTHNRSSSA 100

Query: 101  GNVKSNHKYEINENIQDGSSPNHNRSASVQXXXXXXXXXXXXXXXXXXXXXXQSTNFSGS 160
             +  S  KY  +      SS N   + S +                      Q TN S S
Sbjct: 101  ASNSSPTKYSYSRRASQWSS-NGGTAPSTKLSR-------------------QQTNQSIS 140

Query: 161  TPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIM 220
            + S+FSQGS++NLSK++  +G + L+ P D  EIE LFEE++YKRN+ Q+L P  Q+++ 
Sbjct: 141  SASIFSQGSFSNLSKFVGPDGSIRLEKPRDPREIEELFEEVLYKRNVYQSLPPSAQKELN 200

Query: 221  NYDTKKKWMIVKQDLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNTMDNNLR 280
            NYD +KKW++V+QDLQ                                   ++ +     
Sbjct: 201  NYDLEKKWLMVRQDLQSEVKKFMNNKSVSKSPAAASTG-------------ISLIAPESP 247

Query: 281  TIDTNASNPRIHRKGQKSMSSLSNATTTAPSGVNAEYSKIRSISESSDKTNIAPIHYVRK 340
            +    ASN  I+     S  S +    T+     +      + + S D ++++P +YVRK
Sbjct: 248  STGHFASNSSINESLAGSSRSRAQNPGTSDQFYGSNNGTSSTTTLSQDPSHLSPDYYVRK 307

Query: 341  ILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELI 400
            I+ + +S   LNDLWV+LRTEQLDWV  FLE QG +AIAN +++  Y+ +P + L DE++
Sbjct: 308  IICNNISAKRLNDLWVSLRTEQLDWVVGFLEAQGQVAIANVILKTCYRESPDNLLGDEVL 367

Query: 401  EKEYGFFKCFRVLAMLDQGLYEFT---KHKLMMDTLAFGLFSTRVSTRKMALEILVYIIN 457
            +KE+ +FKC +    L +G  E       K+++  +  GL S RV+TR++A E+LV +  
Sbjct: 368  DKEFAYFKCLKTSLNLKEGADEAVLSNSAKIIISAIIEGLLSLRVATRRIASELLVSLSQ 427

Query: 458  KKNTQRFESVIMSLDRFFRLSENLNM-LKIITQFGGA----------FSRTSPDTQFKIF 506
                  F  V+ +LD+  R  +N+++  ++++Q               +  + D   + F
Sbjct: 428  WALPHGFTHVMNALDQESRFCDNVHLQARLLSQTSNKEIKNSLRSSLLADNNGDRIMRKF 487

Query: 507  QAFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQR 566
            + +++ +E TL+GRGKMGS VGAS+DF+ SGGENAI+EY    L+ +N LC    ++ QR
Sbjct: 488  EQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLVNHLCQTPVDVKQR 547

Query: 567  VVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDP 626
             +LR + +N G  R++ K+K ++YEK+  Q+  +ED   DDF++L     +   INMQDP
Sbjct: 548  TILRARLKNAGLPRILNKMKRLNYEKVDEQLAIFEDSTTDDFDTLYSQGPNGELINMQDP 607

Query: 627  TSLIGSLWEVCKGTENEKXXXXXXXXXXXXXXKLVDDKRE-PAKLSKQLKLMDSLMTNIT 685
             S+  +LW++CKGTE E+              +L    +E PA+ +KQLKL+D+L++N++
Sbjct: 608  VSMTQNLWDLCKGTEAEEHLMSLLQNLLISTGELGGTSKEDPAQRTKQLKLIDALVSNVS 667

Query: 686  ASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAEN 745
             + VD Q+  N AIQRLYD+MQTD++ARRAILE R   K+ EE+ AE+  LKEKLS AE 
Sbjct: 668  MASVDLQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKAERNNLKEKLSNAEG 727

Query: 746  GLVGQXXXXXXQRDNILTKSQRVTKQLQAXXXXXXXXXXXXXXXXXXXXXXILTIVNTNT 805
            GLVGQ      QRD+IL KSQRVT QLQ                        LT +N+  
Sbjct: 728  GLVGQLQEELKQRDHILEKSQRVTAQLQHELDESKKKLILAKHQHEVELRKTLTALNSK- 786

Query: 806  DADASLNNSS--------DKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLR 857
              D  L            ++   IQ+AL+ +L +T K++  +  + G+S++PNKRLR+LR
Sbjct: 787  GGDIQLTEDGGQPKPLKPERMLAIQRALQIKLEKTSKEITVESSRLGVSLEPNKRLRLLR 846

Query: 858  LQMEDIEKEARELEMTNFSEHQKLSLESPAVLNXXXXXXXXXXXXXXXXXXXXXXNNRKR 917
             +ME+IE +ARELEMTNFSE+++ + +   + +                           
Sbjct: 847  SRMEEIENQARELEMTNFSEYREDADKEIEMAHEGTHMYPSDVDVGTTQDSNL------- 899

Query: 918  ANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSF 977
                   KL +LRR LA +Q E+ND+SKFNV+ R +E+F ++K +AL+RL+ LE  Y  F
Sbjct: 900  -------KLEQLRRKLASLQNESNDISKFNVEGRFHEMFSDQKIQALDRLKKLENDYSGF 952

Query: 978  EIDFDPND---FKQAQLDSNASYESLDP----NFVTKKITDIDRIADELDAFXXXXXXXX 1030
             I++DP +    KQ Q        +LDP    N V +   + DR    +D+         
Sbjct: 953  GINYDPAESPSLKQEQGQDVNKSRTLDPKGPNNSVDESQLETDRANASIDS--------S 1004

Query: 1031 XXXXXXXXEKNYYESNAVPTIGPQKGLIDGSSFLESLSEKYGTAQNTEGTSLSPLSPQNR 1090
                    E  +   +    I        G SFLE LS+KYG  Q       S +  +N 
Sbjct: 1005 PASESLEEEDVHLTKSTTEEI--------GGSFLERLSQKYGKGQANLSNRNSVVGRENS 1056

Query: 1091 IASLG--EKSFMNRFKRKPSSMQFLEELSQKVG 1121
                G   KSFMNR K K  ++ +LEELS K G
Sbjct: 1057 YPGSGYHRKSFMNRVK-KSDNVPYLEELSGKFG 1088

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/539 (63%), Positives = 421/539 (78%), Gaps = 6/539 (1%)

Query: 1238 MGLNKMYRSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADD 1297
            +G +K Y  G  S +L +SPSL+ +YPRP+KKLKQLHW+K+DD + SIW +A AE+FADD
Sbjct: 1346 LGRSKTY-GGSPSPLLPQSPSLFERYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADD 1404

Query: 1298 LYEKGVLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELV 1357
            LYEKGVL  LEKAFAAREIKS   +KK++ +KI+FLSRDISQQFGINLHM+ SL V  +V
Sbjct: 1405 LYEKGVLSELEKAFAAREIKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVV 1464

Query: 1358 IKILKCNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVD 1417
             KILKC++D ++T S IEFLSKPEI +VS N+AR++APY TDWEGV  VEDAK+PEK   
Sbjct: 1465 SKILKCDKDFLSTQSAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPS 1524

Query: 1418 GLQRADQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNL 1477
             LQR+DQ+++ L+VNLQSYW SRMR +K+IT+YEK+Y +L+ KLR +D AV AIQKS+NL
Sbjct: 1525 ELQRSDQLFLNLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENL 1584

Query: 1478 TNLFNVILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFN 1537
             N+F+VILAVGNYMND+SKQAQGFKL+TLQRLTFIKD  NSMTFLNYVE+I+ +NYP FN
Sbjct: 1585 RNVFDVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFN 1644

Query: 1538 GFIEELEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVL 1597
             F++ELEPVL VVKIS+EQL NDCNEF  ++ NVERSLEIGNLSDSSKFHP D+V+ KVL
Sbjct: 1645 SFLQELEPVLQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVL 1704

Query: 1598 PVLPEATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARA 1657
            P+LPEA KK++LL DEV+L+ MEFE LM+ FGED+ DKFA+NSFFKKFADFI EYK+A+ 
Sbjct: 1705 PILPEARKKANLLADEVQLSLMEFENLMRMFGEDADDKFAKNSFFKKFADFILEYKRAQE 1764

Query: 1658 QNLKAEEEVRKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQ 1717
             N K +EE R YER K M+               ET  +   +  A GD+R  MDKLL +
Sbjct: 1765 FNRKIDEEERAYERRKLMIQEQQRRAKLVQEGD-ETTCARLSAISASGDDRDVMDKLLEK 1823

Query: 1718 LKNAGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSL 1776
            LKNAGP++ DPSSARKRA+ RKKL+  ++  S+IL+ L+  D   + S   D   DT L
Sbjct: 1824 LKNAGPSKGDPSSARKRALARKKLMGGREG-SIILEGLDVDD---LQSAAPDVQPDTPL 1878

 Score =  511 bits (1316), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 345/1019 (33%), Positives = 526/1019 (51%), Gaps = 118/1019 (11%)

Query: 46   INKSDISSPKSQLLTNKLSMDDLKPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKS 105
            I  SDISSPK   L + L +   KPLNK  ++N  NL Q ++G++ +++S +S       
Sbjct: 50   IATSDISSPKKVTLPSNLDLSGAKPLNKLNTINASNLPQ-VSGEVTQARS-ASGAALSSP 107

Query: 106  NHKYEINENIQDGSSPNHNRSASVQXXXXXXXXXXXXXXXXXXXXXXQSTNFSGSTPSVF 165
            +       + Q  SS   N     Q                      Q TN S      +
Sbjct: 108  SKYSYSKRSSQWASSKQANHPEHDQQYPQHLNHLFVQPHPHHSALTRQMTNQSN-----Y 162

Query: 166  SQGSYANLS---KYMDSNGRLNLDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIMNY 222
            S  SY +LS   K  D +G L L+ P D  EIE L++EL+ KRNI Q++S    R++M+Y
Sbjct: 163  SASSYTSLSLLHKATDIDGTLTLEKPEDPQEIEELYQELLQKRNIPQSVSVHGHRELMSY 222

Query: 223  DTKKKWMIVKQDLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNTMDNNLRTI 282
               KKW++VKQDLQ                                     T     R+I
Sbjct: 223  GIDKKWLMVKQDLQTEYKKMKNSMPPSSTVESIASSALAKSPGGSISSGSIT-----RSI 277

Query: 283  DTNASNPRIHRKGQKSMSSLSNATTTAPSGVNAEYSKIRSISESSDKTNIAPIHYVRKIL 342
              N++ P               A    P+ ++ ++                   YVRKI+
Sbjct: 278  SQNSAKPM--------------AVAYEPAHLSPDH-------------------YVRKII 304

Query: 343  SDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELIEK 402
            SD ++  ELNDLW++LRTE +DWV  F++ QG +AIAN L++ + + +       + +EK
Sbjct: 305  SDRVTAQELNDLWISLRTESIDWVIGFIDAQGQVAIANRLLKFVQRESLDILHDYDALEK 364

Query: 403  EYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKMALEILVYIINKKNTQ 462
            E  ++KC RVL  L +G+ E  K KL++ ++  GL S+R+STR++A E L+Y+++    +
Sbjct: 365  ENAYYKCLRVLTNLREGMQEALKSKLVISSVVEGLLSSRLSTRRVATETLLYMLSDDELK 424

Query: 463  RFES-------VIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKI----FQAFVI 511
              ++       ++++LD+  + + N+++   + +     S  +    F +     + ++ 
Sbjct: 425  TADTGQDAIFPLLVALDQESKFAANIHLRGRLHETNKRKSLPTGRADFHVVAKRLEQWLY 484

Query: 512  SLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRT 571
             +E TL+GRG+MGS VGASDD+K  GGEN +LEY L+++I +N LC+   ++ QR +LR+
Sbjct: 485  VIEYTLDGRGRMGSLVGASDDYK--GGENTVLEYLLYSMILLNLLCSNHPDVQQRNLLRS 542

Query: 572  KFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIG 631
            + ++ G  R++ K++L+ Y  +  +V  +ED  LDD+N L+   +  + ++M+DP +L  
Sbjct: 543  RLKSYGLARIIKKMELLKYPALENEVRKFEDATLDDYNLLMTSTTVDSAVDMKDPAALWQ 602

Query: 632  SLWEVCKGTENEKXXXXXXXXXXXXXXKLVDDKREPAKLSKQLKLMDSLMTNITASEVDE 691
              W   +GTE E                   + R+PA+  KQLKL+D+L+TN+T S +D 
Sbjct: 603  DFWTQHRGTEAEGHLLSLLQHLFLWSRAFA-EYRDPAESIKQLKLLDALVTNVTFSSIDT 661

Query: 692  QTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQX 751
            ++  N AIQRLYD+MQTD+VARRAILE+R L+KK EE+ AE++ L  KLS+A+NGLVGQ 
Sbjct: 662  ESGFNGAIQRLYDAMQTDEVARRAILESRELTKKYEEIKAERDNLASKLSQAQNGLVGQL 721

Query: 752  XXXXXQRDNILTKSQRVTKQLQAXXXXXXXXXXXXXXXXXXXXXXILTIVNTNTDAD--- 808
                 Q + IL KS RVT QL+                       +LTI+N+    +   
Sbjct: 722  QSEVEQLERILEKSNRVTDQLKGELHALKKKHLLEKHEHEVELRKMLTILNSKPHGENGG 781

Query: 809  -ASLNNSS------DKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQME 861
               +N S+      +KK  IQKAL+  L +T+KDL  D K+      PN+RL+MLR +M+
Sbjct: 782  SPEVNTSTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSKRLNTVPAPNRRLKMLRSKMD 841

Query: 862  DIEKEARELEMTNFSE-------HQKLSLESPAVLNXXXXXXXXXXXXXXXXXXXXXXNN 914
             IEKEAR LEMTNF++         +  L SP  +                         
Sbjct: 842  IIEKEARLLEMTNFADFKKEPEEENEPKLLSPPKIQRSL--------------------- 880

Query: 915  RKRANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKY 974
              R   +K  +L  LR+ LA+IQ E+N+VSKFNV++RVNELF EKK++AL+RL+ LE KY
Sbjct: 881  --RGEQVK--ELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKNKALDRLRDLENKY 936

Query: 975  KSFEIDF--DPN-----------DFKQAQLDSNASYESLDPNFVTKKITDIDRIADELD 1020
            K F IDF  DP            D     +D  +S   LDP  +  KI ++ +I D L+
Sbjct: 937  KGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESS-APLDPAHLDAKIEEMTKILDRLN 994

 Score = 49.7 bits (117), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 45/81 (55%), Gaps = 15/81 (18%)

Query: 1055 KGLIDGSSFLESLSEKYGTAQNTEGTSLSP------------LSPQNRIASLGE-KSFMN 1101
            + +I  +SFLE+LS+KYGT   +   S+S              + QN I S    KSF+N
Sbjct: 1080 EAIISNASFLETLSQKYGTGSQSGAASVSSSEHMRGVVNVKRRTSQNSINSGNHRKSFVN 1139

Query: 1102 RFKR--KPSSMQFLEELSQKV 1120
            R KR   P+S  FLEEL+QKV
Sbjct: 1140 RMKRTITPTSSNFLEELTQKV 1160

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1976

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/657 (56%), Positives = 465/657 (70%), Gaps = 44/657 (6%)

Query: 1245 RSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVL 1304
            +S   S +L +SPSL+ +YPRP KKLKQLHW+K+DD+E SIW  A AE+FADDLYEKGVL
Sbjct: 1317 KSATPSPMLPQSPSLFDRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVL 1376

Query: 1305 HNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCN 1364
              LEKAFAAREIKSLA++KK+D DK+SFLSRD+SQQFGINLHM+ SL+V+E+V KIL+C+
Sbjct: 1377 SRLEKAFAAREIKSLASRKKKDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKILRCD 1436

Query: 1365 RDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQ 1424
            RD ++TPSVI+FLSK EI +VS NLARN+APY  DWEGV  VE+AK PEK    LQRAD+
Sbjct: 1437 RDFLSTPSVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADR 1496

Query: 1425 IYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVI 1484
            +Y++L VNLQ+YW SRMRA+KVIT+YEK+Y++LV KL  ID A  +IQ+S+NL N+ +VI
Sbjct: 1497 LYLELFVNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVI 1556

Query: 1485 LAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELE 1544
            LAVGN+MNDSSKQAQGF+L TLQRLTFIKD  NSMTFLNYVEKIIRE YPEFN F++ELE
Sbjct: 1557 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELE 1616

Query: 1545 PVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEAT 1604
            PV+  VKIS+EQ+  DC EF+QS++NVERS++IGNLSD +KFHP D+V+ KVLP LPEA 
Sbjct: 1617 PVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEAR 1676

Query: 1605 KKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEE 1664
            KK DLL DE+KLT +EF+ LM+ FGED+ DKFA+NSFFKKFADF+ EYKKA+  NLK EE
Sbjct: 1677 KKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLKLEE 1736

Query: 1665 EVRKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAK-GDNRGHMDKLLAQLKNAGP 1723
            E R YER K++V                T  +  +S   +  ++R  MD+LL +LKNAGP
Sbjct: 1737 EERAYERRKKLVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGP 1796

Query: 1724 ARSDPSSARKRAVMRKKLLSEKDSTSVILD--DLNAGDG-SIIYSPTTDKVVDTSLGEDE 1780
            A+SDPSSARKRAV RK+LL    S S ILD  D+   DG S++YSP  +   +  L E +
Sbjct: 1797 AKSDPSSARKRAVARKRLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNS-SEVQLNEAD 1855

Query: 1781 MILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXXXXXXVI 1840
                SPTP+ +  +   N +  + +DT + D                            +
Sbjct: 1856 T---SPTPERR--VRDSNATSPASHDTGSSD----------------------------L 1882

Query: 1841 TDRAKALLMELRGSQTPSKKNSHLDDQXXXXXXXXXXXXQTFGEESNSTPSNRLTFV 1897
            TDRA+ LL+ELRG ++P  K S    +             + G E      NRL FV
Sbjct: 1883 TDRARNLLIELRGPESPGVKMSAQHQRLSKLRARRKNDSSSSGSE------NRLNFV 1933

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1116 (35%), Positives = 601/1116 (53%), Gaps = 102/1116 (9%)

Query: 49   SDISSPKSQLLTNKLSMDDL-----KPLNKRTSLNNQNLSQYIN--GKLPKSQSDSSHLG 101
            SDISSPK      K+++ D      KPL+K+++LN  +LS Y +  G   +S S++S   
Sbjct: 53   SDISSPK------KINLPDTGEFSHKPLSKQSTLNMASLSAYTDAVGAHNRSASNAS--- 103

Query: 102  NVKSNHKYEINENIQDGSSPNHNRSASVQXXXXXXXXXXXXXXXXXXXXXXQSTNFSGST 161
             V S  KY  +      S+ N   S S                        Q TN S S+
Sbjct: 104  -VGSPTKYSYSRRASQWSNNNSAVSGS--------------------KLSRQQTNQSMSS 142

Query: 162  PSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIMN 221
             S+FSQGS++NLSK++  +G + L+ P D  EIE LFEE++YKRN+ Q+L    QR++ N
Sbjct: 143  ASIFSQGSFSNLSKFVGPDGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNN 202

Query: 222  YDTKKKWMIVKQDLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNTMDNNLRT 281
            YD +KKW++V+QDLQ                                    ++   N   
Sbjct: 203  YDLEKKWLMVRQDLQSEVKKFMNSKNASKSSTVVGGSSSAVPDSPSASNFTSSTSPNGSF 262

Query: 282  IDTNASNPRIHRKGQKSMSSLSNATTTAPSGVNAEYSKIRSISESSDKTNIAPIHYVRKI 341
              T  S P+I      S SS++ +     S +        + + S D ++++P +YVRKI
Sbjct: 263  --TGLSRPKI------STSSVNTSEQFYSSNLGTS----STTTLSQDPSHLSPDYYVRKI 310

Query: 342  LSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELIE 401
            + + +S   LNDLWV+LRTEQLDWV  FLE QG +AIAN +++  Y+ +P + L DE+++
Sbjct: 311  ICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRESPDNLLGDEVLD 370

Query: 402  KEYGFFKCFRVLAMLDQGLYEFT---KHKLMMDTLAFGLFSTRVSTRKMALEILVYIINK 458
            KE+ +FKC +    L +G  E       ++++  +  GL S RV+TR++A E+L+ +   
Sbjct: 371  KEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRVASELLISLSQW 430

Query: 459  KNTQRFESVIMSLDRFFRLSENLNM-LKIITQFG------GAFSRTSPDTQ----FKIFQ 507
                 F  V+ +LD+  R  +N+++  ++ITQ        G+    +PD       + F+
Sbjct: 431  SLPHGFNHVMDALDQESRFCDNVHLQARLITQSASKDPKKGSSIAPTPDGDGDRVMRKFE 490

Query: 508  AFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRV 567
             +++ +E TL+GRGKMGS VGAS+DF+ SGGENAI+EY    L+ IN LC    ++ QR 
Sbjct: 491  QWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLCQTPVDVKQRT 550

Query: 568  VLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPT 627
            VLR + +N G  R++ K+KL++YEK+  Q+  ++D   DDF++L   +S+   ++M+DP 
Sbjct: 551  VLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQESTGEGVDMKDPV 610

Query: 628  SLIGSLWEVCKGTENEKXXXXXXXXXXXXXXKL-VDDKREPAKLSKQLKLMDSLMTNITA 686
            S+  +LW +CKGT+ E+              +L   +K +P + +KQLKL+D+L++N++ 
Sbjct: 611  SMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSM 670

Query: 687  SEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENG 746
            + VD Q+  N AIQRLYD+MQTD++ARRAILE R   K+ EE+ A+++ LKEKLS AE G
Sbjct: 671  ASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGG 730

Query: 747  LVGQXXXXXXQRDNILTKSQRVTKQLQAXXXXXXXXXXXXXXXXXXXXXXILTIVNTNTD 806
            LVGQ      QRD+IL KSQRV  QLQ                        LT +N+N +
Sbjct: 731  LVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFE 790

Query: 807  ADASLNNS----------SDKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRML 856
               ++ +            ++K  IQKAL+ +L +T K++N + K+ G+S++PNKRL++L
Sbjct: 791  GSHNMRDEKGSENPRPLRPERKLAIQKALQAKLEKTSKEINVESKRLGLSLEPNKRLKLL 850

Query: 857  RLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNXXXXXXXXXXXXXXXXXXXXXXNNRK 916
            R +MEDIE +ARELEMTNFS++QK  ++ P V N                       + +
Sbjct: 851  RSRMEDIENQARELEMTNFSDYQKDDIKEPEVSN--------------EDDHKAVSESEE 896

Query: 917  RANAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKS 976
            +A  I   KL ELR+ LA +Q E+ND+SKFNV+ R +E+F  +K  AL+RL+ LE  YK 
Sbjct: 897  KAQQISALKLEELRKKLASLQQESNDISKFNVEGRFHEMFSGQKSLALDRLKKLETDYKG 956

Query: 977  FEIDFDPND-FKQA----QLDSNASYESLDPNFVTKKITDIDRIADELD----AFXXXXX 1027
            F I+FDP+    QA     + S+    +LDP      + ++  I   LD    A      
Sbjct: 957  FGINFDPDSPLGQALAGKSVSSDDKARTLDPKEALNIVEEVSNILSGLDSSKAAEKSNET 1016

Query: 1028 XXXXXXXXXXXEKNYYESNAVPTIGPQKGLIDGSSFLESLSEKYGTAQNTEGTSLSPLSP 1087
                       E    + N           +  SSFLESLS+KYG AQN+     S    
Sbjct: 1017 PLRTATSSDSSEDEMDDKNGDKIAA--DSTLPTSSFLESLSQKYGGAQNSLSNRHSFAGG 1074

Query: 1088 QNRIASLG--EKSFMNRFKRKPSSMQFLEELSQKVG 1121
            +      G   KSFMNR KR   ++ +L ELS K+G
Sbjct: 1075 EINYPGSGYHRKSFMNRVKRT-GAVPYLGELSGKIG 1109

>Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON}
            similar to Ashbya gossypii AFR669W
          Length = 2091

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/556 (63%), Positives = 433/556 (77%), Gaps = 13/556 (2%)

Query: 1238 MGLNKMYRSGDGSQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADD 1297
            +G  K Y+    S +L +SPSL+ KYPRP+K+LKQLHW+K+DD + SIW +A AE+FADD
Sbjct: 1378 LGRTKKYKGSSPSPLLPQSPSLFEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADD 1437

Query: 1298 LYEKGVLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELV 1357
            LYE+GVL  LEKAFAAREIKSL ++KK D +K++FLSRDISQQFGINLHM+ SLTVD++V
Sbjct: 1438 LYERGVLTELEKAFAAREIKSLISRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIV 1496

Query: 1358 IKILKCNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVD 1417
             KILKC++D +NT S IEFLSK EI +VSIN+AR +APY TDWEGV  VE+AK PEK  +
Sbjct: 1497 TKILKCDKDFLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPN 1556

Query: 1418 GLQRADQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNL 1477
             LQRADQ+Y+ L+VNLQSYW SRMRA+K+IT+YEK+Y +L+ KLR +D AV AIQKS+NL
Sbjct: 1557 ELQRADQLYLDLIVNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENL 1616

Query: 1478 TNLFNVILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFN 1537
             N+F+VILAVGNYMNDSSKQAQGFKL+TLQRLTFIKD  NSMTFLNYVEKI+R NYP F+
Sbjct: 1617 RNVFDVILAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVRTNYPGFD 1676

Query: 1538 GFIEELEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVL 1597
             F++ELEPVL VVKIS+EQL NDC EF  ++ NVERSLEIGNLSDSSKFHP D+V+ KVL
Sbjct: 1677 VFLQELEPVLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPNDRVLAKVL 1736

Query: 1598 PVLPEATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARA 1657
            PVLPEA K+++LL DEV+L+ MEFE+LM+ FGEDS DKFA+NSFF+KFADFI EYK+A+ 
Sbjct: 1737 PVLPEARKRANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFILEYKRAQE 1796

Query: 1658 QNLKAEEEVRKYERHKQMVXXXXXXXXXXXXNYMETGVS------DSESAEAKGDNRGHM 1711
             N K EEE R YER K M+              ++T  S       + S  A GD+R  M
Sbjct: 1797 FNKKMEEEERAYERRKIMIEEQQKRARKNIQ--IDTSFSRRGSSLSTSSISASGDDRDVM 1854

Query: 1712 DKLLAQLKNAGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKV 1771
            D+LL +LKNAGP+++DPSSARKRA+ RKKL+  K S S+ILD L+  + + I S   D  
Sbjct: 1855 DRLLEKLKNAGPSKADPSSARKRALARKKLMDGKKSGSIILDGLDVEELANIQSDGLDDQ 1914

Query: 1772 VDTSLGEDEMILKSPT 1787
             D+    +  IL SPT
Sbjct: 1915 SDS----NPAILGSPT 1926

 Score =  515 bits (1327), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 322/844 (38%), Positives = 486/844 (57%), Gaps = 101/844 (11%)

Query: 173 LSKYMDSNGRLNLDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKWMIVK 232
           L K  DS+G L+L+ P    EIE L++EL+ KRNIL ++S    R++M YD  KKW++VK
Sbjct: 168 LQKITDSDGNLSLEKPKYPQEIEELYQELLQKRNILNSVSVHSHRELMGYDLDKKWLMVK 227

Query: 233 QDLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNTMDNNL--RTIDTNASNPR 290
           QDLQ                                   +  M NN+   T+    SN  
Sbjct: 228 QDLQAE---------------------------------LKRMKNNVPQSTVADPLSN-S 253

Query: 291 IHRKGQKSMSSLSNATTTAPSGVNAEYSKIRSISESSDKTNIAPIHYVRKILSDTLSKNE 350
           +H K  +   S SN +  + S  +A     + ++ S D ++++P HYVRKI+SD ++  E
Sbjct: 254 VHLKSPRGSFSSSNMSARSISQNSA-----KQLAVSYDPSHLSPDHYVRKIISDRITAYE 308

Query: 351 LNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIYKTAPGSNLSDELIEKEYGFFKCF 410
           LNDLWV+LRTE +DWV  F++ QG +AIAN LI+   + +  S L  +L+EKE  ++KC 
Sbjct: 309 LNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRESLESLLDSDLLEKETAYYKCL 368

Query: 411 RVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKMALEILVYIIN----KKNTQRFES 466
           RVL  L +G+      KL++  +  GL S R++TR++A E L+Y++     K     F++
Sbjct: 369 RVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDELKTADTDFDA 428

Query: 467 ---VIMSLDRFFRLSENLNMLKIITQFGGAFS----RTSPDTQFKIFQAFVISLESTLNG 519
              V+ +LD+  + S ++++   + +     S    R       K  + ++  LE TL+G
Sbjct: 429 IFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLHVIAKKIEQWLYVLEYTLDG 488

Query: 520 RGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGL 579
           RG+MGS VGAS+D+K   GEN +LEY L+++I IN LC+   +L+QR +LR++ ++ G  
Sbjct: 489 RGRMGSLVGASEDYK--NGENTVLEYLLYSMILINLLCSSHPDLHQRNLLRSRLKSYGLS 546

Query: 580 RVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKG 639
           RV+ K++L+ Y  +  +V  +ED  LDD+NSL+   +  + ++M+DP SL  + W   KG
Sbjct: 547 RVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWNNFWTRHKG 606

Query: 640 TENEKXXXXXXXXXXXXXXKLVDDKREPAKLSKQLKLMDSLMTNITASEVDEQTHMNLAI 699
           TE+E               K   +  +PA+ SKQLKL+D+L++N+T S +D ++  N AI
Sbjct: 607 TESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSNVTFSSIDTESGFNGAI 666

Query: 700 QRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQXXXXXXQRD 759
           QRLYD+MQTD+VARRAILE+R L+KK EE+ AE+++L+ KL++A++GLVGQ      Q  
Sbjct: 667 QRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQAQDGLVGQLQGEVQQLQ 726

Query: 760 NILTKSQRVTKQLQAXXXXXXXXXXXXXXXXXXXXXXILTIVNTNTDADAS--------L 811
            IL KS RVT QL+A                      +LTI+N+  + DAS        +
Sbjct: 727 RILEKSNRVTDQLKADLHDLKKKHLLEKHEHEVELRKMLTILNSKPN-DASNDAVSPDGI 785

Query: 812 NNSS------DKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEK 865
           NN +      +KK  IQKAL+  L +T+KDL  D ++FG    PN+RL+MLR +M+DIEK
Sbjct: 786 NNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRSKMDDIEK 845

Query: 866 EARELEMTNFSEHQKLS-------LESPAVLNXXXXXXXXXXXXXXXXXXXXXXNNRKRA 918
           EA  LEMTNF+E +K +       L+SP  +                          +  
Sbjct: 846 EALMLEMTNFAEFKKETKVEDLPRLQSPPKI-------------------------ERNV 880

Query: 919 NAIKKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFE 978
            + K ++L  LR+ LA+IQ E+N++SKFNV++RVNELF EKK +AL+RL+ LE+KY+SF 
Sbjct: 881 RSEKVKELAALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFG 940

Query: 979 IDFD 982
           IDF+
Sbjct: 941 IDFN 944

 Score = 40.4 bits (93), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 13/73 (17%)

Query: 1061 SSFLESLSEKYGTAQN-----------TEGTSLSPLSPQNRIASLGEKSFMNRFKRK--P 1107
            +SFLESLS+KYGT  N           +  ++        R +    KSF+NR K+   P
Sbjct: 1109 TSFLESLSQKYGTGTNLQPAEDGAKRLSSSSAFRAGDSSQRNSGYHRKSFVNRMKKNSTP 1168

Query: 1108 SSMQFLEELSQKV 1120
             S  F++E+SQK+
Sbjct: 1169 KSSSFVDEVSQKM 1181

>KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] {ON}
            similar to uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1842

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/604 (55%), Positives = 435/604 (72%), Gaps = 48/604 (7%)

Query: 1250 SQILNESPSLYSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLEK 1309
            S +L +SPSL+ +YPRP+KKLKQLHW+K+D++  SIW +A AE+ ADDL+E+GVL  LEK
Sbjct: 1216 SPLLPQSPSLFERYPRPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVLSQLEK 1275

Query: 1310 AFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMN 1369
            AFAARE KSL  K KE  +KI+FLSRD+SQQFGINLHMF +L V ++V K++KC+R+ ++
Sbjct: 1276 AFAARETKSLKGKSKEANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCDREFLS 1335

Query: 1370 TPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQL 1429
            TPSVIEFLSKP I +V+ NLAR + PY TDWEGV  V+DAK PEK  + LQRADQ+YV+ 
Sbjct: 1336 TPSVIEFLSKPTIIEVTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQLYVEF 1395

Query: 1430 MVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGN 1489
            M+NLQ YW SRMRAI +IT+YEK+Y++LVTKLR+ID AV  I++S++L ++F+VILAVGN
Sbjct: 1396 MINLQPYWGSRMRAITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVILAVGN 1455

Query: 1490 YMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLDV 1549
            YMNDSSKQAQGFKL+TLQRLTFIKD  NSMTFLNYVEKIIRENYPE++ F+EELEP+  V
Sbjct: 1456 YMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELEPIFSV 1515

Query: 1550 VKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDL 1609
             KIS+EQLV DC EF+QS++NVERS+EIGNLSD SKFHPLD+V+ KV+PVLPEA KK+DL
Sbjct: 1516 TKISIEQLVTDCKEFSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEARKKADL 1575

Query: 1610 LTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKY 1669
            L+DE+KL+ +EFE LM+KFGED+ DKF++NSFF+KFADFI E+KKA+  N+K EEE R Y
Sbjct: 1576 LSDEIKLSLLEFENLMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEEEERAY 1635

Query: 1670 ERHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPARSDPS 1729
            ER K+M+                  +S S+      D+R  ++KLL +LKNA P++ DPS
Sbjct: 1636 ERRKKMIEDQQRKQQEADSKATAKNLSTSQEP---SDDRDDIEKLLDKLKNAAPSKGDPS 1692

Query: 1730 SARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMILKSPTPK 1789
            S RKRA+ RKKLL  K   S I D++           T D  ++  + ++  + +SPT K
Sbjct: 1693 STRKRALARKKLLDGKSGAS-IFDNI-----------TADSTIEAFVEQNRTLTESPTAK 1740

Query: 1790 SKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITXXXXXXXXXXXXVITDRAKALLM 1849
               +L    +   S+ D                                   DRA+ LL+
Sbjct: 1741 KSASLPETESLSSSKQDP---------------------------------ADRARNLLL 1767

Query: 1850 ELRG 1853
            ELRG
Sbjct: 1768 ELRG 1771

 Score =  538 bits (1385), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 385/1151 (33%), Positives = 590/1151 (51%), Gaps = 167/1151 (14%)

Query: 26   LLHNLKKLXXXXXXXXXXXAINKSD-ISSPKSQLLTNKL----SMDDLKPLNKRTSLNNQ 80
            L  NLKKL           +  + + ISSPK    T  L     +   KPLNK +SLN  
Sbjct: 29   LFSNLKKLATGGNHGSSQPSQTRKELISSPKRVFTTASLESATPIGGSKPLNKISSLNTH 88

Query: 81   NLSQYINGKLPKSQSDSSHLGNVKSNHKYEINENIQDGSSPNHNRSASVQXXXXXXXXXX 140
            NLS Y       S+S S+ L    + + Y    +    SS N +  +S            
Sbjct: 89   NLSHYTMDPEANSRSQSASLLTSPTKYSYSRRSSQLTRSSTNKSIISSSAVSV------- 141

Query: 141  XXXXXXXXXXXXQSTNFSGSTPSVFSQGSYANLSKYMDSNGRLNLDMPTDTHEIESLFEE 200
                                     S  S + L++++ ++G L LD P +  EI  LF +
Sbjct: 142  -------------------------SSNSTSILNRFLTNDGTLKLDRPENPEEINGLFMD 176

Query: 201  LMYKRNILQALSPDKQRDIMNYDTKKKWMIVKQDLQXXXXXXXXXXXXXXXXXXXXXXXX 260
            L+ KRN+  ++S   Q+D++NY  +KKW++VKQDLQ                        
Sbjct: 177  LLIKRNVFDSVSSQDQKDMLNYPIEKKWLMVKQDLQSEFKRL------------------ 218

Query: 261  XXXXXXXXXXXVNTMDNNLRTIDTNASNPRIHRKGQKSMSSLSNATTTAPSGVNAEYSKI 320
                                     ++ PR      ++M  L   T+T  S +N +Y  +
Sbjct: 219  ------------------------KSTKPRFSANDTQNM--LKRKTST--SKLNTQYEGM 250

Query: 321  RSISESS----DKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHI 376
               +ES       ++  P +YVR+I+S  +   ELNDLWV+LRTE LDWV +FLE QG +
Sbjct: 251  LHTNESQGSLLSPSHFPPEYYVRQIISKKIKNKELNDLWVSLRTEPLDWVISFLEAQGQV 310

Query: 377  AIANNLIRCIYK--TAPGSNLSD-ELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTL 433
            AIAN +I  +++  T   + ++D + +E+E   FKC RVL  + + L E     L+ + L
Sbjct: 311  AIANLIITSMHQDTTDNQNAVTDPQFLERETALFKCLRVLLNIRECLEEAVNSTLVTNAL 370

Query: 434  AFGLFSTRVSTRKMALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQ---F 490
              GL ST++ TR++A E L+Y++ K   + F+S    LD F  + E+LN    + Q    
Sbjct: 371  VEGLLSTKIPTRRLATETLIYLVTKD--EDFKSRTAGLDCFSLVMESLNHETSLVQNIHM 428

Query: 491  GGAFS---RTSPDTQ------FKIFQAFVISLESTLNGRGKMGSKVGASDDFKVSGGENA 541
               FS    T P++        KI Q ++  +E TL+GRGKMGS VGASD+++ + GEN+
Sbjct: 429  KAKFSTNDSTDPESNPQLYQVCKILQQWLYVVEQTLDGRGKMGSLVGASDEYRNNTGENS 488

Query: 542  ILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYE 601
            I EY + +++ I++LC  ++++ +R ++RT+ ++ G  R++ K++L+DY  ++  +  +E
Sbjct: 489  IYEYLVDSIVLIDQLCLNNEDVKKRHMMRTQLKSFGLNRILQKMQLLDYPPLSTMLLQFE 548

Query: 602  DHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEKXXXXXXXXXXXXXXKLV 661
            D  +DD+NSL++ +  +  ++M DP S++  L    KGTE E               K  
Sbjct: 549  DAAIDDYNSLIDSQKFTENVDMDDPVSILQKLTSSFKGTEAESYLLSMLQNLFLSSNKNA 608

Query: 662  DDKREPAKLSKQLKLMDSLMTNITASEVDEQTHMNLAIQRLYDSMQTDDVARRAILETRT 721
             +  +P K  +QLKL+DSL++N+  + +D +++ N+AIQRLYDSMQTD++ARRAILE+R 
Sbjct: 609  QESDDPGKNVQQLKLIDSLISNVAITTLDSESNFNVAIQRLYDSMQTDEIARRAILESRE 668

Query: 722  LSKKLEEVTAEKEYLKEKLSKAENGLVGQXXXXXXQRDNILTKSQRVTKQLQAXXXXXXX 781
            L+KKLEEV AE++YL +K+SKAENGLVGQ      +RD IL K+QRVT+QLQ+       
Sbjct: 669  LTKKLEEVKAERDYLNDKISKAENGLVGQLQKELAERDLILDKTQRVTEQLQSELEELKK 728

Query: 782  XXXXXXXXXXXXXXXILTIVNTNTDAD----ASLNN-----SSDKKHNIQKALETELSRT 832
                           +LTIVN+ T  D    +++ N     + ++K  IQ  L+  L +T
Sbjct: 729  RHLLEKHEHEIELRKMLTIVNSKTSDDLESGSTVQNDPKPLNPERKTAIQNVLQRSLQKT 788

Query: 833  KKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEKEARELEMTNFSEHQKLSLESPAVLNXX 892
            ++DL N+ ++ G +V    RL++LR +MEDIE +ARELEMTNF++ +             
Sbjct: 789  EQDLLNESRRLGTAVGSKSRLKLLRSKMEDIENQARELEMTNFADVKP------------ 836

Query: 893  XXXXXXXXXXXXXXXXXXXXNNRKRANAIKKQ---KLLELRRDLAMIQAETNDVSKFNVD 949
                                 N+K    +K Q   KL ELR+ LA+IQ E+ND++KFN++
Sbjct: 837  -------------------KQNQKFKEQVKGQQATKLAELRKKLAIIQNESNDITKFNIE 877

Query: 950  KRVNELFKEKKHEALNRLQMLEKKYKSFEIDF-DPNDFKQAQLDSNASYESLDPNFVTKK 1008
             RVNELF++KK  AL+RL+ LE KY  F IDF D  + K+    S+    SLDP  V +K
Sbjct: 878  ARVNELFQDKKLAALDRLKDLENKYNGFHIDFADDPELKELLTQSSNGGPSLDPTIVQRK 937

Query: 1009 ITDIDRIADELDAFXXXXXXXXXXXXXXXXEKNYYESNAVPTIGPQKG--------LIDG 1060
            + +++ I DEL+A                   +   +++    G  +         + +G
Sbjct: 938  VEEMNSIIDELNALKEEMKNRPKTGSSSSSSSSLSSASSSSEDGSSQSQASHGSDIVSNG 997

Query: 1061 SSFLESLSEKYGTAQNTE-GTSLSPLSPQNRIASLG--EKSFMNRFKR---KPSSMQ--- 1111
            SSFLESLS+KY T Q T   T+   +  + R    G   KSF+NR K     P++     
Sbjct: 998  SSFLESLSQKYSTGQQTATSTNGGRVGRETRYPGSGYHRKSFLNRLKNTTVNPTATSEHL 1057

Query: 1112 --FLEELSQKV 1120
              FL EL  KV
Sbjct: 1058 PPFLTELKSKV 1068

>SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1335

 Score =  331 bits (848), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 174/458 (37%), Positives = 285/458 (62%), Gaps = 23/458 (5%)

Query: 1269 KLKQLHWDKLDDSEGSIWSSAMAEQFADD-LYEKGVLHNLEKAFAAREI---KSLANKKK 1324
            KL+Q+HWD ++D   + WS     +     L E GV   +E+ F  ++    K    K  
Sbjct: 859  KLRQIHWDNIEDIRETFWSEEEERKEKSKELQELGVFEEIEELFRIKQPVPKKPNVAKTS 918

Query: 1325 EDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSKPEITD 1384
            ++L K+SFLSRD++QQFGINLHMF + TV ELV+K+L C  +V+   SV+EF +K ++T+
Sbjct: 919  QNLKKVSFLSRDLAQQFGINLHMFSNYTVHELVLKVLHCENEVVKNQSVLEFFNKEDLTN 978

Query: 1385 VSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPSRMRAI 1444
            +S ++ +N+ PY T+      V   + P K V  L+RAD+I+++L  NL+SYW +RMR +
Sbjct: 979  ISQSVKKNFEPYSTN------VLTGEGPTKDVSELERADRIFLELCYNLRSYWRARMRCL 1032

Query: 1445 KVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQGFKLN 1504
             ++ +YEK+Y +++ KL++ID A  AI+ S  L  L  +I+ +GNYMN+  +QA+G KL+
Sbjct: 1033 LILLTYEKDYYDILYKLQKIDDATRAIRNSKRLKELLFIIVEIGNYMNN--RQARGIKLS 1090

Query: 1505 TLQRLTFIKDSTNS-MTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQLVNDCNE 1563
            +L +L F+K STN+ M+FL+Y+E+I+R  Y +  G I++L  +  + K++V+Q+  DC E
Sbjct: 1091 SLGKLAFVKASTNNNMSFLHYIERILRTKYMDLYGVIDDLSKISHLGKLTVDQVELDCRE 1150

Query: 1564 FTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFMEFEA 1623
            F + I N+ERS + G+LS +  FHP D +++K    +P A +K  LL D+ KLT  + E 
Sbjct: 1151 FNERIDNMERSFKTGDLSKTQNFHPEDLIVSKTKHKIPIAKRKRSLLMDQCKLTMHDLEK 1210

Query: 1624 LMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMVXXXXXXX 1683
            LM   GE+  D  A+N+FF+ F DF++ +KKA  +N++ EE  R YE+ K+++       
Sbjct: 1211 LMTYCGEEPKDHNAKNTFFQNFIDFVSLFKKAARENIEKEEVERIYEQRKKLLEIKERS- 1269

Query: 1684 XXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNA 1721
                      G  +S++++   +N   +D L+ +L+  
Sbjct: 1270 ---------CGNMESQNSDESAENNDTVDVLIHKLRGV 1298

 Score = 44.3 bits (103), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 97/224 (43%), Gaps = 36/224 (16%)

Query: 539 ENAILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTKLK-----LMD---- 589
           +  + +YCL  L  IN +   +    ++ +L  KF+  G  R+  K K     L+D    
Sbjct: 314 QQQLTDYCLSTLFLINSIIQVTTSYREKELLIKKFKECGIHRMFYKTKDFGSGLLDDEIR 373

Query: 590 -YEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEKXXXX 648
            Y+++  +V      +L  F  +         I     T L   L+++ +G         
Sbjct: 374 KYKEVEEEVITRSSPELPTFLDISYGSILKTLILETRSTPLEHPLYQLLEGVLQ------ 427

Query: 649 XXXXXXXXXXKLVDDKREPAKLSKQLKLMDSLMTNITASEVDE------QTHMNLAIQRL 702
                       +   R  ++  K  KL  S++  +     D       ++ +  ++ ++
Sbjct: 428 ------------ISVTRTSSESIKLFKLFHSILCYLKDHTFDSDSGEGPESALKTSLNQM 475

Query: 703 YDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKE--KLSKAE 744
            DS+Q+D++ARRA+ E  +L + ++++TAE E LKE  K++K E
Sbjct: 476 MDSLQSDEIARRAMKELNSLQETVDQLTAEVESLKEERKVTKGE 519

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar to
            Ashbya gossypii AGL364C
          Length = 1306

 Score =  309 bits (792), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 174/428 (40%), Positives = 262/428 (61%), Gaps = 22/428 (5%)

Query: 1249 GSQILNESPSLYSKYPRPQK-KLKQLHWDKLDDSEGSIWSSAMAE-QFADDLYEKGVLHN 1306
            GS   ++ PSL S     QK KLKQ+HWDK+DD   ++WS        + +L   GV   
Sbjct: 798  GSLYASQIPSLTS----CQKVKLKQIHWDKIDDISKTVWSDDKERVSVSSELANFGVFKE 853

Query: 1307 LEKAF-----AAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKIL 1361
            +E+ F     A +   ++   +     K++ LS D++QQFGINL++F + +V+ELV K+L
Sbjct: 854  IEELFKIVPAAPKVGNTMFTAQNTRNGKVTLLSNDLAQQFGINLYIFSNYSVEELVEKVL 913

Query: 1362 KCNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQR 1421
             C+ +VM   SVIEF SK +I  +  ++ R +APY T++           PEK    L R
Sbjct: 914  LCDTEVMKNQSVIEFFSKDDINHIPQSIQRMFAPYETNYL------TGDKPEKDSRSLDR 967

Query: 1422 ADQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLF 1481
            AD+IY++L  NL+SYW  R + +  + +YEK+Y +++ KL+RID   +AI+ S  L  L 
Sbjct: 968  ADRIYLELFYNLRSYWAPRAKYLLALLTYEKDYYDILYKLQRIDDGTTAIKTSKRLKPLL 1027

Query: 1482 NVILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDST-NSMTFLNYVEKIIRENYPEFNGFI 1540
             +I+ VGNYMN+  KQA G +L++L +L F K S  N+++F++ +E I+R NYP+ +GF+
Sbjct: 1028 FIIIEVGNYMNN--KQALGIQLSSLNKLAFTKTSKDNNLSFIHVIESIVRLNYPDLHGFV 1085

Query: 1541 EELEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVL 1600
             +LE +LDV  I V+ +  +  EF + I  +ERSL +G LSDSSKFHP DK +      +
Sbjct: 1086 NDLEKILDVSNIIVQHVQQEAQEFYEKISTLERSLRVGVLSDSSKFHPKDKFLINTESNI 1145

Query: 1601 PEATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNL 1660
              A KK+DLL  +  LT  EF+ LM  +GED  + F++N+FF+KF DF   +KKA  +N+
Sbjct: 1146 SHAMKKADLLKQQCTLTMGEFDKLMVFWGEDPNNVFSKNTFFQKFLDFALLFKKANKENI 1205

Query: 1661 KAEEEVRK 1668
              E EVR+
Sbjct: 1206 --EREVRR 1211

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] {ON}
            similar to uniprot|P40450 Saccharomyces cerevisiae
            YIL159w BNR1
          Length = 1294

 Score =  308 bits (788), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 178/504 (35%), Positives = 289/504 (57%), Gaps = 34/504 (6%)

Query: 1261 SKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLEKAF----AAREI 1316
            S  P+   +LKQ+HW+K+DD  G++W         D L ++GV   +EK F      ++ 
Sbjct: 813  SSTPKSTIRLKQIHWEKVDDVGGTLWEDVSGIPL-DHLKDEGVFSQIEKYFKILEPVKKT 871

Query: 1317 KSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEF 1376
            K LA  + +   KISFL+RDI+QQFGINLHM+  L+V+E V K+LKC  D++   SV+ F
Sbjct: 872  KVLAENENKP-TKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGF 930

Query: 1377 LSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSY 1436
             +K ++T +   L R +APY T++     + D  +PEK    L+RAD IY++L  NL+SY
Sbjct: 931  FTKEDLTQIPSGLERKFAPYSTNY-----LTD-DSPEKDPRELERADHIYLELFYNLRSY 984

Query: 1437 WPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSK 1496
            W +R   + V+T+YE++Y +L+ KL +ID A+  +  S  +  L  +I  +GNYMN  S 
Sbjct: 985  WSARSHCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGS- 1043

Query: 1497 QAQGFKLNTLQRLTFIKDST-NSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVE 1555
               G KLN+L +L+F+K S+  +++FL++VE+++RE++P+   F E++  V D+ K+++E
Sbjct: 1044 -VTGIKLNSLPKLSFVKSSSEKNISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLE 1102

Query: 1556 QLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVK 1615
             +  +C EF + + +V  SL  G LSD +K HP D + TK+   +  A  KS+LL ++ +
Sbjct: 1103 HVELECEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHE 1162

Query: 1616 LTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQM 1675
            LT      LM+ +GE+  DK ++N+FF  F +F   +KK   +N++ EE  R YE+ K +
Sbjct: 1163 LTKRSLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAKENIEREEVTRLYEQRKHL 1222

Query: 1676 VXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPARSDPSSARK-- 1733
                           +E      E  E   D    +D L+ +L++A      P   R+  
Sbjct: 1223 ---------------LEQRNKKIEEQEHSDDEINAVDDLITKLRDAKKQHPAPLRRRRST 1267

Query: 1734 RAVMRKKLLSEK--DSTSVILDDL 1755
            +AV+ +K   E   + T  +L D+
Sbjct: 1268 KAVLNEKRAGEPLLERTQALLSDI 1291

 Score = 37.4 bits (85), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 86/196 (43%), Gaps = 13/196 (6%)

Query: 542 ILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLR-VMTKLKLMDYEKMTVQVENY 600
           ++EYC   +  +N +        ++  +   FEN+     ++T ++ +D E  + Q++ Y
Sbjct: 266 LVEYCTLFMFMVNSIIEGYQSFEKKSAIIASFENVEKFTPLITLIENLDDENTSTQIKKY 325

Query: 601 EDHKLDDFNSLLEMKSSSAQINMQDPTSLIGSLWEVCKGTENEKXXXXXXXXXXXXXXKL 660
            D KL+       M  +S   ++ +  S    L ++   T+N                ++
Sbjct: 326 RDVKLEI------MTRNSCVPSILEDVSYSQVLTDLVIQTKN-TALESGLGNLFTLVFQV 378

Query: 661 VDDKR--EPAKLSKQLKLMDSLMTNITASE---VDEQTHMNLAIQRLYDSMQTDDVARRA 715
           +  K+  E  K  K + L+   +  +   E    +       AI  L D++Q++D+ RRA
Sbjct: 379 IHTKKLNECIKFLKLIALLVPYLNKVLTVEDSLENPDYFFKDAITTLVDNLQSEDLTRRA 438

Query: 716 ILETRTLSKKLEEVTA 731
           ++E +TL K + E+ +
Sbjct: 439 MVEIKTLEKNITELNS 454

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1283

 Score =  306 bits (785), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 164/477 (34%), Positives = 290/477 (60%), Gaps = 34/477 (7%)

Query: 1264 PRPQ-KKLKQLHWDKLDDSEGSIWSSAMAEQ-FADDLYEKGVLHNLEKAFAAREIKSLAN 1321
            P+P+ K LKQ+HWDK++D   ++W+         +DL EKGV + +   F   E K++  
Sbjct: 796  PKPEVKPLKQIHWDKIEDISDTLWNEPTTRSDLKEDLNEKGVFNEIVNLF---EQKAVRM 852

Query: 1322 KKKEDL------DKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIE 1375
            KKK ++      +K+S LSRD++QQFGINLHMF S +V++L+IK+L+C+ D++   SV+E
Sbjct: 853  KKKSNVTASKKNEKVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKNHSVLE 912

Query: 1376 FLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQS 1435
            F +K +   +  ++ R++ PY +DW+        KAP++ V  L+RAD+IY+++  N++ 
Sbjct: 913  FFNKDDFETIPQSIIRSFEPYASDWKT------GKAPKEDVSKLERADRIYLEMFYNMRY 966

Query: 1436 YWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSS 1495
            YW  R  ++ +  +YEK+Y +++ +L++ID   S I+ S+ L   F +++ +GN+MN+  
Sbjct: 967  YWKIRSSSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNFMNN-- 1024

Query: 1496 KQAQGFKLNTLQRLTFIK-DSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISV 1554
            K+ QG KL++L +L+ +K +S  +++FL+ +E+IIRE YP+   F  +L  + D+ KI++
Sbjct: 1025 KKTQGIKLSSLNKLSMVKTNSDKNLSFLHVIERIIREKYPDIYDFTRDLNRLSDLGKINI 1084

Query: 1555 EQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEV 1614
            E + ++ +E+ + IM ++ S E G LS + K HP DK   K+   LP A +K++LL ++ 
Sbjct: 1085 ESIESEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAELLHNQC 1144

Query: 1615 KLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQ 1674
            KLT  +F + M+  GED  +  A+N+FF+ F++F+  + K   +N + E   R +E+ +Q
Sbjct: 1145 KLTMNDFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVHEQRQQ 1204

Query: 1675 MVXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPARSDPSSA 1731
            ++               ET V  S   EA       +D L+ +L++  P ++ P S+
Sbjct: 1205 LLQKAST----------ETQVEKSADDEAADT----IDILIKKLRSVDPQQTIPGSS 1247

>TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1292

 Score =  304 bits (779), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 163/479 (34%), Positives = 278/479 (58%), Gaps = 29/479 (6%)

Query: 1265 RPQKKLKQLHWDKLDDSEGSIWSSA-MAEQFADDLYEKGVLHNLEKAFAARE--IKSLAN 1321
            +P++ LKQ+HW+KL+D E ++W+     ++   +L   G+   +E++F  +E  IK   N
Sbjct: 798  KPKEALKQIHWEKLNDIEETLWADQNQKDETMKELKRGGIFSQIEESFKVKERTIKQTKN 857

Query: 1322 K-KKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSKP 1380
            K K+E     SFL RD++QQFGINLHMF   + ++ V+K+L+C+ +++   + +EF ++ 
Sbjct: 858  KDKREKTPTKSFLPRDVAQQFGINLHMFSQYSPEQFVLKVLQCDNEIIQNSTALEFFTRE 917

Query: 1381 EITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPSR 1440
            ++ +V+ +L R + PY TD+      ED   P K    L R D+I+++L  NLQ YW  R
Sbjct: 918  DLVNVTQSLRRAFDPYSTDYLS----EDG--PSKDPAELDRPDRIFLELCYNLQYYWYER 971

Query: 1441 MRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQG 1500
               +  +T+YE++Y + + +L++ID  +  ++      ++  +I+ +GNYMN   + A+G
Sbjct: 972  SFCLFTLTTYERDYYDFIYRLQKIDDVIQKLRHGTRFKSILYIIVEIGNYMN--KRPAEG 1029

Query: 1501 FKLNTLQRLTFIKDSTNSMT-FLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQLVN 1559
             KL++L +L F+K S +  T FL+++E+IIR  YP+  GF ++L  V D+ KIS++ L  
Sbjct: 1030 IKLSSLNKLAFVKSSVDKNTSFLHFLERIIRVKYPDLYGFTDDLSKVEDIGKISLDHLEQ 1089

Query: 1560 DCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFM 1619
            +CNEF   I  V  +L+ G LSD S+ HP D ++ K+   +  A  KSDLL D+ KL  +
Sbjct: 1090 ECNEFRSKIDEVVHTLKEGKLSDHSRLHPKDLIVEKITYKIRRAKVKSDLLQDQFKLINI 1149

Query: 1620 EFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMVXXX 1679
            + + LM  FGED  D  A+NSFF+ F +F   +KK   +N++ E+  R YE+ K M+   
Sbjct: 1150 DLKKLMSHFGEDFNDSEAKNSFFQHFIEFSVNFKKCAKENIEREDSQRVYEQRKNMLESR 1209

Query: 1680 XXXXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPARSDPSSARKRAVMR 1738
                            + + +++ +G++   +D LLA+L+        P   R+R + R
Sbjct: 1210 QR-------------TASNHNSDLQGEDEDAVDVLLAKLRG---TEEKPGLVRRRKITR 1252

>NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717
          Length = 1314

 Score =  304 bits (778), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/479 (35%), Positives = 281/479 (58%), Gaps = 28/479 (5%)

Query: 1264 PRPQ----KKLKQLHWDKLDDSEGSIWSSAMA-EQFADDLYEKGVLHNLEKAFAAREIKS 1318
            P P+    KK+KQ+HW+K++D E + W +    E+   +L   G+   +E  F  + +  
Sbjct: 810  PVPKLSETKKIKQIHWEKIEDIENTFWDNEQEREETVTELRHMGIFKQIEDIFKMKNVSV 869

Query: 1319 LANKKK---EDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIE 1375
            +  KKK      + ISFLSRD++QQFGINLH+F  L+ DELV K+L+C+ D++   SV+E
Sbjct: 870  IMKKKKVVSSSTELISFLSRDLAQQFGINLHIFVQLSEDELVSKVLRCDDDILENVSVLE 929

Query: 1376 FLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQS 1435
            F  K E+T ++ +L R+  PY TD+   + V     P K+ D LQRAD+I+++L  NL+S
Sbjct: 930  FFCKEEMTHINPSLVRHLTPYSTDYMNPESV-----PTKNPDELQRADKIFLKLSFNLRS 984

Query: 1436 YWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSS 1495
            YW  R + + ++ +YEK+Y +L+ KL++ID A+  I  S+   NL  +I+ +GN+MN  +
Sbjct: 985  YWNERSQCLLLLCTYEKDYYDLLYKLQKIDDALQRIYHSERFKNLLYIIVEIGNFMN--T 1042

Query: 1496 KQAQGFKLNTLQRLTFIK-DSTNSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISV 1554
            +   G +L+ L +L FIK ++ N+++FL+Y+E++IR +Y +  GFI++L  V ++ KIS+
Sbjct: 1043 RPVSGIRLSALNKLAFIKSNNDNNVSFLHYIERVIRIHYADVYGFIDDLHKVEELGKISM 1102

Query: 1555 EQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEV 1614
            +Q+   C EF   I  +  ++  G LSD  K HP D+++ KV   +  A  K +LL D  
Sbjct: 1103 DQVALQCEEFCSKIDKMVFNITKGKLSDPLKLHPDDQILKKVKYKINRARTKGELLGDHF 1162

Query: 1615 KLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQ 1674
            KL+  +FE +M+ +GED  D  +++ FF+ F +F   +KK   +N++ EE  R Y + K+
Sbjct: 1163 KLSNNDFEKVMRYYGEDPTDVESKSVFFQTFVEFSTLFKKCAKENMEREEAERVYAQRKK 1222

Query: 1675 MVXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPARSDPSSARK 1733
            ++                    DS +    G+N   +D LLAQL+     + +P   RK
Sbjct: 1223 IMEASTRKDSDV----------DSGTDNIDGENTA-VDSLLAQLRGVD-KKPEPLRTRK 1269

>Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  302 bits (773), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 167/492 (33%), Positives = 277/492 (56%), Gaps = 42/492 (8%)

Query: 1264 PRPQKKLKQLHWDKLDDSEGSIWSSAMAEQ-FADDLYEKGVLHNLEKAFAAREIKSLANK 1322
            P P+++LKQ+HWD+++D + ++W  A   Q    +L   GV   +E  F  R    +A+K
Sbjct: 871  PSPERRLKQIHWDRVEDVKDTLWEDAFQRQETIRELQTDGVFSQIEDIFKMRSPAKIASK 930

Query: 1323 KKE---------------DLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDV 1367
                              +L K+SFLSRD++QQFGINLHMF  L+  E V+K+L C+ D+
Sbjct: 931  NNAGSSTALSSNNGKSLNELKKVSFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 990

Query: 1368 MNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYV 1427
            +   ++++F  K E+T++  +L   Y PY    EG           K+V  LQRAD+I++
Sbjct: 991  IQNVNILKFFCKEELTNIPKSLLNKYEPYSQGKEG-----------KAVSDLQRADRIFL 1039

Query: 1428 QLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAV 1487
            +L +NL+SYW  R + +  +++YE++Y +L+ KL++ID  +S +  S    NL  +I  +
Sbjct: 1040 ELCINLRSYWNVRSKNLLTLSTYERDYYDLLFKLQKIDDGISHLNLSPKFKNLMFIITEI 1099

Query: 1488 GNYMNDSSKQAQGFKLNTLQRLTFIKDSTN-SMTFLNYVEKIIRENYPEFNGFIEELEPV 1546
            GN+MN   K  +G KL +L +L F++ S + +M+FL+++EKIIR  YP+  GF+++L+ +
Sbjct: 1100 GNHMN--KKIVKGIKLKSLTKLAFVRSSVDQNMSFLHFIEKIIRIKYPDLYGFVDDLKKI 1157

Query: 1547 LDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKK 1606
             D+ KIS+E +  +C+EF   I N+    + G LS      P D+++ KV   +  A  K
Sbjct: 1158 EDLGKISLEHIELECHEFYNRIENLVTQFQTGKLSKEENLDPRDQIVKKVKFKINRAKIK 1217

Query: 1607 SDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEV 1666
            S+LL  + KLT ++   LM+ +GED  DK ++N FF+ F +F+  +KK   +N++ EE  
Sbjct: 1218 SELLMGQCKLTLIDLNKLMKYYGEDPSDKESKNDFFQPFIEFLAMFKKCAKENIEKEEME 1277

Query: 1667 RKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPARS 1726
            R YE+ K ++            N    G  ++E  E   D    +D L+++L+     + 
Sbjct: 1278 RVYEQRKSLL------EMRTNNNKKSNGNDENEGEEVNTD---AVDLLISKLRE---VKK 1325

Query: 1727 DPSSARKRAVMR 1738
            DP   R+R   R
Sbjct: 1326 DPEPLRRRKSTR 1337

 Score = 34.3 bits (77), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 55/104 (52%), Gaps = 26/104 (25%)

Query: 659 KLVDDKREPAKLSKQLKLMDSLMTNIT-------ASEVDEQTHMNLA----------IQR 701
           K++D K+  ++  K LKL++SL+  +         S  DE  +++LA          + +
Sbjct: 458 KILDSKKPYSESIKLLKLINSLLFYLIDSFQAPICSSFDE--NLDLAQNVDSVFQDSVNK 515

Query: 702 LYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAEN 745
           L DS+Q++++ARRA+ E   L+ K+ +       L EKL+  EN
Sbjct: 516 LLDSLQSNEIARRAVTEIDDLNNKILD-------LNEKLNLVEN 552

>Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to
            Ashbya gossypii AFR301C - AGL364C
          Length = 1454

 Score =  302 bits (773), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 159/418 (38%), Positives = 256/418 (61%), Gaps = 15/418 (3%)

Query: 1266 PQKKLKQLHWDKLDDSEGSIWS-SAMAEQFADDLYEKGVLHNLEKAFAAREIK-----SL 1319
            P+ KLKQ+HWDK+DD + ++W   +     + +L   G+   +++ F           + 
Sbjct: 958  PKLKLKQIHWDKIDDIKETVWCDQSQRVSKSTELASFGIFQEIDELFQLNPTSPAIANAT 1017

Query: 1320 ANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSK 1379
            AN  K    K+S LSR+++Q+FGINLH+F   TV+EL  K+L C+ +V+   SVIEF  K
Sbjct: 1018 ANLLKAKSTKVSLLSRELAQEFGINLHIFSHYTVEELTSKVLNCDNEVLKNQSVIEFFCK 1077

Query: 1380 PEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPS 1439
             EI ++  ++ + +APY  ++         + P++  + L RAD+IY++L  NL+SYW +
Sbjct: 1078 EEINNIPKSVQQLFAPYSANYI------TGEQPDRDPNELDRADRIYLELFYNLRSYWGA 1131

Query: 1440 RMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQ 1499
            R + + VI +++K+Y +++ KL RID A  A+Q S  L  LF +I+ +GNYMN   +   
Sbjct: 1132 RSKYLLVILTFDKDYFDILHKLERIDDATKALQNSAKLKELFFIIVEIGNYMNQ--RPVA 1189

Query: 1500 GFKLNTLQRLTFIKDST-NSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQLV 1558
            G +L++L +L F K ST N+M+F++ +E+I+R  YP  + F+E L+ +L+V  I V+ + 
Sbjct: 1190 GIQLSSLNKLAFTKTSTDNNMSFIHVIERIVRRKYPSIHDFVEGLDKILEVQNIIVQHVQ 1249

Query: 1559 NDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLTF 1618
             + +EF   I ++ER   IG LSD S+FHP DK + K    +  A KK+DLL D+  LT 
Sbjct: 1250 QEAHEFCDRIAHLERLTTIGILSDPSRFHPEDKFMLKTESKILLAKKKADLLKDQCTLTM 1309

Query: 1619 MEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMV 1676
             +FE LM  +GE+  +  ++NSFFKKF DFI  ++KA  +N + EE  R YE+ ++ +
Sbjct: 1310 SDFEKLMVYWGENPNNTNSKNSFFKKFIDFITLFRKAGKENSEREEMTRIYEKRRRAL 1367

>Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  301 bits (770), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 166/495 (33%), Positives = 278/495 (56%), Gaps = 55/495 (11%)

Query: 1264 PRP-QKKLKQLHWDKLDDSEGSIWSSAMAEQ-FADDLYEKGVLHNLEKAFAAREIKSLAN 1321
            P P +K+LKQ+HWDK++D + ++W   +  Q     L   G+   +E  F  +    +AN
Sbjct: 870  PVPTEKRLKQIHWDKVEDIKDTLWEDGLQRQETIRGLQTDGIFSQIEDIFKMKSPTKIAN 929

Query: 1322 K---------------KKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRD 1366
            K                  +L KISFLSRD++QQFGINLHMF  L+  E V+K+LKC+ D
Sbjct: 930  KTSAISSTVLSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLKCDND 989

Query: 1367 VMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIY 1426
            ++   ++++F  K E+ ++  +L   Y PY     G           K+   LQRAD+I+
Sbjct: 990  IVQNVNILKFFCKEELVNIPKSLLNKYEPYSRGENG-----------KAASDLQRADRIF 1038

Query: 1427 VQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILA 1486
            ++L +NL+ YW  R +++  +++YE++Y +L+ KL+ ID  +S + +SD   NL  +I  
Sbjct: 1039 LELCINLRFYWNVRSKSLLTLSTYERDYYDLIFKLQNIDDGISHLNRSDKFKNLMFIITE 1098

Query: 1487 VGNYMNDSSKQAQGFKLNTLQRLTFIKDSTN-SMTFLNYVEKIIRENYPEFNGFIEELEP 1545
            +GN+MN   +  +G KL +L +L F++ ST+ +M+FL+++EKIIR  YP+  GF+++L+ 
Sbjct: 1099 IGNHMN--KRIVKGIKLKSLTKLVFVRSSTDQTMSFLHFIEKIIRIKYPDIYGFVDDLKK 1156

Query: 1546 VLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATK 1605
            V D+ KIS+E +  +C+EF   I N+    + G LS+     P D+++ KV   +  A  
Sbjct: 1157 VEDLGKISLEHIEIECHEFHNKIENLVTQFQTGKLSNEENLDPRDQIVKKVKFKINRARI 1216

Query: 1606 KSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEE 1665
            KS+LL D+ KLT ++   LM+ +GED  DK ++N FF+ F +F+  +KK   +N++ EE 
Sbjct: 1217 KSELLMDQCKLTLIDLNKLMRYYGEDPNDKESKNEFFQPFIEFLTMFKKCAKENIEKEEM 1276

Query: 1666 VRKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGH------MDKLLAQLK 1719
             R YE+ K               N +E   + ++  +   +N G       +D L+++L+
Sbjct: 1277 ERVYEQRK---------------NLLEMRTNGNKKCDGNDENEGEEVNTDAVDLLISKLR 1321

Query: 1720 NAGPARSDPSSARKR 1734
                 + DP   R+R
Sbjct: 1322 E---VKKDPEPLRRR 1333

 Score = 40.8 bits (94), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 24/103 (23%)

Query: 659 KLVDDKREPAKLSKQLKLMDSLM----------------TNITASEVDEQTHMNLAIQRL 702
           K++D +R  ++  K LKLM+SL+                 NI ++E  +    + ++ +L
Sbjct: 457 KILDSQRPYSESIKLLKLMNSLLFYLIDSFQVPTNPSFDENIESAENADSVFQD-SVNKL 515

Query: 703 YDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAEN 745
            DS+Q+D++ARRA+ E   L+KK+        +L EKL   EN
Sbjct: 516 LDSLQSDEIARRAVTEIDDLNKKI-------SHLNEKLDLVEN 551

>AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1655

 Score =  302 bits (774), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 165/436 (37%), Positives = 266/436 (61%), Gaps = 28/436 (6%)

Query: 1256 SPSLYSKYPRPQK---KLKQLHWDKLDDSEGSIWSSAMAE-QFADDLYEKGVLHNLEKAF 1311
            +P++ ++ P P     KLKQ+HWDK+++ + ++W         + +L   G+   +E+ F
Sbjct: 1149 APTMLTQQPSPPSTRIKLKQIHWDKIENIKETVWCDEQQRVSKSSELESLGIFKEIEELF 1208

Query: 1312 AAREIK----SLANKK----KEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKC 1363
               EIK    +LAN      K    +IS LSR+++Q+FGINLH+F   TV+ELV K+L C
Sbjct: 1209 ---EIKPASTNLANATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKVLSC 1265

Query: 1364 NRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRAD 1423
            + +VM    V+EF  K E  +V  ++ R + PY T++         + PEK    L+RAD
Sbjct: 1266 DSEVMKNQGVLEFFCKEEANNVPQSIQRLFGPYETNYL------TGERPEKDPAELERAD 1319

Query: 1424 QIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNV 1483
            +IY++L  NL+SYW +R   + VI+++E++Y +++ KL+RID A  AIQ S+ L  LF +
Sbjct: 1320 RIYLELFYNLRSYWAARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFFI 1379

Query: 1484 ILAVGNYMNDSSKQAQGFKLNTLQRLTF---IKDSTNSMTFLNYVEKIIRENYPEFNGFI 1540
            I+ +GNYMN   K  QG +L++L +L F   IKD  N+++F++ +E+I+R  YP  + F+
Sbjct: 1380 IVEIGNYMNQ--KPVQGIQLSSLNKLAFTKTIKD--NNLSFIHVLERIVRTRYPSVHDFV 1435

Query: 1541 EELEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVL 1600
            E +  +  V  I V+ +  + +EF   I N++RSL  G LSD SKFHP D+ + +    L
Sbjct: 1436 EGINSITGVANIIVQHVQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTKL 1495

Query: 1601 PEATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNL 1660
             +A KK+ LL D+  LT  +FE LM  +GE+  +  ++N+FF+KF DFI  ++KA  +N 
Sbjct: 1496 AQAKKKARLLRDQCSLTISDFEKLMLYWGENPANPNSKNTFFQKFIDFILLFRKAAKENT 1555

Query: 1661 KAEEEVRKYERHKQMV 1676
            + EE  R YE+ ++++
Sbjct: 1556 EREELDRTYEKRRRLL 1571

>AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1260

 Score =  297 bits (760), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 161/420 (38%), Positives = 256/420 (60%), Gaps = 31/420 (7%)

Query: 1264 PRPQK-KLKQLHWDKLDDSEGSIW--------SSAMAEQFADDLYEKGVLHNLEKAF--- 1311
            P  Q+ KLKQ+HWDK+D+ + ++W        +S   E F       GV   +E  F   
Sbjct: 765  PTSQRVKLKQIHWDKIDNIKETVWNEHNERISTSTKLETF-------GVFKEIEDLFKVV 817

Query: 1312 --AAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMN 1369
                +   S +  +     KI  LS D++Q FGINLH+F   + +EL+  +L C+ +++ 
Sbjct: 818  PATPKTASSNSPTQTTRNGKIRLLSNDLAQLFGINLHIFSHYSTEELIDMVLLCHAEILQ 877

Query: 1370 TPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQL 1429
               VIEF SK +I  +  +  R +APY T++         K P+K    L+RAD+IY++L
Sbjct: 878  NQRVIEFFSKDDINHIPQSTQRMFAPYETNYL------TGKTPDKDPAVLERADRIYLEL 931

Query: 1430 MVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGN 1489
              NL+SYW +R + + V+ +YE++Y +++ KL+RID A  AI+ S  L  LF +I+ +GN
Sbjct: 932  FYNLRSYWAARSKYLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLKQLFFIIIEIGN 991

Query: 1490 YMNDSSKQAQGFKLNTLQRLTFIKDST-NSMTFLNYVEKIIRENYPEFNGFIEELEPVLD 1548
            YMN+  KQA G +L+++ +L F K S  N+++F++ +E+IIR  YPE + F E+LE V D
Sbjct: 992  YMNN--KQALGIQLSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELHNFAEDLEKVQD 1049

Query: 1549 VVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSD 1608
            +  I V+ +  +  EF + I N+ERSL +G LSDSS+FHP D+ ++K    +  A KK++
Sbjct: 1050 MANIIVQHVQQEAQEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTASSIQHARKKAE 1109

Query: 1609 LLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRK 1668
            LL D+  LT  +FE L+  +GED+ D  ++N+FF+KF DF+  +KKA  +N++  EE+R+
Sbjct: 1110 LLIDQSTLTMGDFEKLVSYWGEDTKDIQSRNTFFQKFLDFVALFKKASKENIE-REEIRR 1168

>KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1389

 Score =  298 bits (762), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 164/414 (39%), Positives = 258/414 (62%), Gaps = 16/414 (3%)

Query: 1269 KLKQLHWDKLDDSEGSIWSSAMAEQ-FADDLYEKGVLHNLEKAFAAREIKSLANKKKEDL 1327
            KLKQ+HWDKL+D   +IWS     Q  A  L   G L  + + F  R  +SL  K K + 
Sbjct: 920  KLKQIHWDKLEDVSETIWSQEGERQDAARHLESSGFLDEIAELF--RVNQSLPIKAKSET 977

Query: 1328 ----DKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSKPEIT 1383
                DK+S L RD++QQFGINLHMF +L+VDE V K+L C+RDV+N  SV+EF ++ +++
Sbjct: 978  SSGKDKVSILPRDLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDLS 1037

Query: 1384 DVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPSRMRA 1443
             +  ++A    PY TD +        +AP    + L+RAD+I+++L  NL+SYW  R   
Sbjct: 1038 IIPRSIASKLEPYATDHQ------PNEAPLLDREKLERADRIFLELCYNLRSYWRPRSLC 1091

Query: 1444 IKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQGFKL 1503
            +  +++YEK+Y +L+ KL+R+D A++ I+ S  L +   +I+ +GNYMN   KQA G +L
Sbjct: 1092 LLTLSTYEKDYFDLIYKLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMN--RKQAGGIRL 1149

Query: 1504 NTLQRLTFIKDSTN-SMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQLVNDCN 1562
            ++LQ+LTF+K S + +M+ L+ VE+ +R       GF+E+L  VLD+  + V Q+  D +
Sbjct: 1150 SSLQKLTFVKSSKDKNMSLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDFH 1209

Query: 1563 EFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFMEFE 1622
            E+TQ I  V++SLE G LS    FHP D+++ KV P +  AT+K+ LL ++  LT    E
Sbjct: 1210 EYTQRISGVKQSLEQGRLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRALE 1269

Query: 1623 ALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMV 1676
             LM+ +GED  +  ++N FF+ F +F++++KK   +N + E   R Y + K+++
Sbjct: 1270 NLMKLYGEDPSNIDSKNEFFQHFINFVSQFKKVAKENEEKEAVERIYIQRKELL 1323

>YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,
            nucleates the formation of linear actin filaments,
            involved in cell processes such as budding and mitotic
            spindle orientation which require the formation of
            polarized actin cables, functionally redundant with BNI1
          Length = 1375

 Score =  296 bits (758), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 160/490 (32%), Positives = 282/490 (57%), Gaps = 42/490 (8%)

Query: 1262 KYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQ-FADDLYEKGVLHNLEKAFAAREIKSLA 1320
            K P  +K+LKQ+HWDK++D + ++W      Q    +L   G+   +E  F  +    +A
Sbjct: 870  KPPPTEKRLKQIHWDKVEDIKDTLWEDTFQRQETIKELQTDGIFSQIEDIFKMKSPTKIA 929

Query: 1321 NKK---------------KEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNR 1365
            NK+                 +L KISFLSRD++QQFGINLHMF  L+  E V+K+L C+ 
Sbjct: 930  NKRNAESSIALSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDN 989

Query: 1366 DVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQI 1425
            D++   ++++F  K E+ ++  ++   Y PY    +G           K+V  LQRAD+I
Sbjct: 990  DIVQNVNILKFFCKEELVNIPKSMLNKYEPYSQGKDG-----------KAVSDLQRADRI 1038

Query: 1426 YVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVIL 1485
            +++L +NL+ YW +R +++  +++YE++Y +L+ KL++ID A+S + +S    +L  +I 
Sbjct: 1039 FLELCINLRFYWNARSKSLLTLSTYERDYYDLIFKLQKIDDAISHLNRSPKFKSLMFIIT 1098

Query: 1486 AVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTN-SMTFLNYVEKIIRENYPEFNGFIEELE 1544
             +GN+MN   +  +G KL +L +L F++ S + +++FL+++EK+IR  YP+  GF+++L+
Sbjct: 1099 EIGNHMN--KRIVKGIKLKSLTKLAFVRSSIDQNVSFLHFIEKVIRIKYPDIYGFVDDLK 1156

Query: 1545 PVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEAT 1604
             + D+ KIS+E + ++C+EF + I ++    ++G LS      P D++I KV   +  A 
Sbjct: 1157 NIEDLGKISLEHVESECHEFHKKIEDLVTQFQVGKLSKEENLDPRDQIIKKVKFKINRAK 1216

Query: 1605 KKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEE 1664
             KS+LL  + KLT ++   LM+ +GED  DK ++N FF+ F +F+  +KK   +N++ EE
Sbjct: 1217 TKSELLIGQCKLTLIDLNKLMKYYGEDPKDKESKNEFFQPFIEFLAMFKKCAKENIEKEE 1276

Query: 1665 EVRKYERHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPA 1724
              R YE+ K ++            N    G   S+  + +  NR  +D L+++L+     
Sbjct: 1277 MERVYEQRKSLL------DMRTSSNKKSNG---SDENDGEKVNRDAVDLLISKLRE---V 1324

Query: 1725 RSDPSSARKR 1734
            + DP   R+R
Sbjct: 1325 KKDPEPLRRR 1334

 Score = 35.8 bits (81), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 54/102 (52%), Gaps = 22/102 (21%)

Query: 659 KLVDDKREPAKLSKQLKLMDSLM----------TNITASEVDEQTH-----MNLAIQRLY 703
           K++D ++  ++  K LKL++SL+          TN +  E  E           ++ +L 
Sbjct: 457 KILDSQKPYSESIKLLKLINSLLFYLIDSFQVSTNPSFDETLESAENVDYVFQDSVNKLL 516

Query: 704 DSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAEN 745
           DS+Q+D++ARRA+ E       ++++ A+  +L EKL+  EN
Sbjct: 517 DSLQSDEIARRAVTE-------IDDLNAKISHLNEKLNLVEN 551

>Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] {ON}
            (35789..38224,38226..40265) [4476 nt, 1492 aa]
          Length = 1491

 Score =  293 bits (749), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 153/420 (36%), Positives = 256/420 (60%), Gaps = 15/420 (3%)

Query: 1264 PRPQ--KKLKQLHWDKLDDSEGSIWSSAMA-EQFADDLYEKGVLHNLEKAFAAREI---K 1317
            P+PQ  K LKQ+HWDK+++ + +IW   +   +   +L    + + +E +F  +E+   K
Sbjct: 993  PKPQHVKNLKQIHWDKVENIDNTIWKYNLENREILKELEYGSIFNQVEDSFKIKEVVIKK 1052

Query: 1318 SLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFL 1377
            S   K KE  +  SFLSRD++QQFGINLHM+ + T  E +  +L C+ +V+   SV+EF 
Sbjct: 1053 SKTEKNKEKSNLKSFLSRDLAQQFGINLHMYSNYTEKEFLDLVLSCSDEVIKNISVLEFF 1112

Query: 1378 SKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYW 1437
             K ++ ++  +++RNYAPY  D+         + P K    L+RAD+++++L  NL+ YW
Sbjct: 1113 CKEDLINIPGSISRNYAPYSRDYLS------GEEPVKDSSELERADKLFLELCYNLRYYW 1166

Query: 1438 PSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQ 1497
              R + + ++ +YE++Y +LV KL++ID A+  +  S    +   ++L +GNYMN   K 
Sbjct: 1167 ADRSQCLLLLYTYERDYYDLVFKLQKIDDAIQRLLNSQRFRDFLYIVLEIGNYMN--KKT 1224

Query: 1498 AQGFKLNTLQRLTFIKDSTNS-MTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQ 1556
             +G K+++L +L FIK S+N+ ++FL+++EK+IR  YPE  GFI++L  V D+ K+++E 
Sbjct: 1225 VEGVKISSLSKLAFIKSSSNNNISFLHFIEKLIRTRYPEVYGFIDDLTKVEDLGKVTLEH 1284

Query: 1557 LVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKL 1616
            +  +C+EF   + +V  S+  G LS S K HP D ++ KV   +  A  KS+LL D+  L
Sbjct: 1285 IGTECDEFCAKVNSVVYSVTNGKLSKSEKLHPNDSILKKVKYKVSRAKTKSELLKDQYNL 1344

Query: 1617 TFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMV 1676
            T  +   L+  +GED  DK + +SFF    +F++ +KK   +N++ EE  R YE+ K M+
Sbjct: 1345 TKHDVTKLLVYYGEDPKDKDSNDSFFSNILEFLSVFKKCAKENIEREESERVYEQRKNML 1404

 Score = 34.7 bits (78), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 33/53 (62%)

Query: 698 AIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQ 750
           +I  L D +Q+D++ARRA+ E ++L + ++ + +E   LKE+    +  L+ Q
Sbjct: 510 SINELMDRLQSDEIARRAMNEMKSLEQIIDNLQSEISSLKEERQLDKGELIAQ 562

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1424

 Score =  292 bits (747), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 151/420 (35%), Positives = 255/420 (60%), Gaps = 18/420 (4%)

Query: 1265 RPQKKLKQLHWDKLDDSEGSIWS-SAMAEQFADDLYEKGVLHNLEKAFAARE--IKSLAN 1321
            +P++ LKQ+HW+K+DD E ++W  +   E+   +L   G+   ++  F  +   +K + N
Sbjct: 848  KPKQSLKQIHWEKIDDVEKTVWEDNEQREETVKELEISGIFEKVQTTFQLKNSTVKKVKN 907

Query: 1322 ----KKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFL 1377
                KK   L   SFLSRD++QQFGINLHM+    V+E V+K+L+C+ D++   SV+EF 
Sbjct: 908  DNSTKKTTQLK--SFLSRDLAQQFGINLHMYSQYPVEEFVLKVLRCDNDILQNVSVLEFF 965

Query: 1378 SKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYW 1437
            +  E+T++  +L+R++APY  D++      + K+P    + L+R D+I+++L  NL+SYW
Sbjct: 966  NNEELTNIPASLSRSFAPYSADFQ------ENKSPTVDPNELERPDRIFLELCYNLRSYW 1019

Query: 1438 PSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQ 1497
              R + + +  +YE++Y +LV KL+ ID A+  I+ +  L  L  +I+ +GNYMN   K 
Sbjct: 1020 RERSKCLLIFATYERDYYDLVYKLQNIDDAIQKIKNAFRLKQLLYIIMEIGNYMN--KKN 1077

Query: 1498 AQGFKLNTLQRLTFIKDST-NSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQ 1556
              G +LN+L +L+F+K S  N+++FL+++EK++R  YP+   F ++L     +  IS + 
Sbjct: 1078 VSGIRLNSLSKLSFVKSSVDNNLSFLHFIEKVVRVKYPDIYHFTDDLNKAEALGYISFDH 1137

Query: 1557 LVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKL 1616
            + ++C E+   + +V R    G LS  S  HP D+++ KV   +  A  KS LL D+ KL
Sbjct: 1138 IQSECEEYCSKVNSVVRMTTEGILSQQSNLHPKDEIMRKVKYKINRAKTKSQLLWDQYKL 1197

Query: 1617 TFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMV 1676
               + + LM+ FGE+  DK A+NSFF  F +F   +KK   +N++ EE  R YE+ K+++
Sbjct: 1198 ISADLDKLMKYFGENPMDKEAKNSFFANFGEFSVVFKKCAKENIEKEEAYRVYEQRKKLL 1257

>KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1367

 Score =  291 bits (745), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 166/491 (33%), Positives = 275/491 (56%), Gaps = 40/491 (8%)

Query: 1265 RPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADD----LYEKGVLHNLEKAFAAREI---- 1316
            +P KKLKQ+HWDK++D E +IW +   E+   D    L   GVL  +E  F  +E     
Sbjct: 867  KPVKKLKQIHWDKVEDIEDTIWHN---EEIRRDTLKHLQHDGVLKEIESTFKIKEAGPIA 923

Query: 1317 -KSLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIE 1375
             KS A +       +SFLSRD++Q FGINLHMF +L+VDE V K+L C+ D++    V+E
Sbjct: 924  KKSCATEGSASKKSVSFLSRDLAQAFGINLHMFSNLSVDEFVKKVLGCDNDIIKNVPVLE 983

Query: 1376 FLSKPEITDVSINLARNYAPYITDW----EGVKHVEDAKAPEKSVDGLQRADQIYVQLMV 1431
            F ++ E+  +S +  R YAPY   +    +   H      P      L+R D+I+++L  
Sbjct: 984  FFNREELGAISSSTLRKYAPYCVQYFPEPDASNHTTFEPLPP-----LERGDEIFLKLCY 1038

Query: 1432 NLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYM 1491
             L+ YW  R   + V+ +YEK+Y ++V KL++++ A+  +++S  L N   +I+ +GNYM
Sbjct: 1039 VLRDYWSVRSHCLLVVCTYEKDYYDIVYKLQKLEDAMRRLKESTALQNFLYIIIEIGNYM 1098

Query: 1492 NDSSKQAQGFKLNTLQRLTFIKDSTN-SMTFLNYVEKIIRENYPEFNGFIEELEPVLDVV 1550
            N  +K A G K+++L +L FIK S N +++FL+Y+E++IR  YP+   F+ +L+ V D+ 
Sbjct: 1099 N--TKAASGVKISSLNKLVFIKSSDNKNLSFLHYIERLIRTKYPDIYRFVHDLKTVEDLG 1156

Query: 1551 KISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLL 1610
            K++++QL  +C+E+   I  +  +++ G LSD +K +P D V+ K+      A  K+ LL
Sbjct: 1157 KLTLDQLELECSEYIGKIRKMGHAVKKGPLSDPAKLYPGDMVLKKIRFKAQRANSKAQLL 1216

Query: 1611 TDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYE 1670
              ++KL+  +   LM+ +GED  D   +N FF  FA+F+  +KK   +N++ EE  R YE
Sbjct: 1217 ESQMKLSSNDMNQLMKYYGEDPKDATTKNHFFTSFAEFLQLFKKCSRENIEREEMDRVYE 1276

Query: 1671 RHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGH---------MDKLLAQLKNA 1721
            + ++++               ++G  +S +A+A G N            +DKLL +L+  
Sbjct: 1277 QRRKLLEDKQSSRS-------KSGKGNSAAADAAGGNEDDDENEDEEDAVDKLLDKLREV 1329

Query: 1722 GPARSDPSSAR 1732
                  P   R
Sbjct: 1330 AKPVGKPRERR 1340

>Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W
            (BNR1) - involved in actin filament organization [contig
            159] FULL
          Length = 1389

 Score =  285 bits (729), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 151/414 (36%), Positives = 251/414 (60%), Gaps = 14/414 (3%)

Query: 1268 KKLKQLHWDKLDDSEGSIWSSAMAEQ-FADDLYEKGVLHNLEKAF---AAREIKSLANKK 1323
            ++LKQ+HWDK++D + +IW+        A  L E G+L  +   F    +   K+   + 
Sbjct: 919  QRLKQIHWDKIEDVKETIWNEEEGRHNVALHLEESGILDEISDLFKITPSAPTKANTGRL 978

Query: 1324 KEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSKPEIT 1383
             E+   ++ L RD++QQFGINLHMF +L+V++ V+K+L C+R ++   SV+EF ++ ++ 
Sbjct: 979  NEE-GPLAILPRDLAQQFGINLHMFSNLSVEDFVLKVLHCDRQIITNQSVLEFFARDDLV 1037

Query: 1384 DVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPSRMRA 1443
            ++  +L+  + PY +D+         K P K    L+RAD+I++ L  NL+SYW  R   
Sbjct: 1038 NIPHSLSLKFEPYSSDFRL------GKGPLKDSSKLERADRIFLALCYNLRSYWRQRSIC 1091

Query: 1444 IKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQGFKL 1503
            +  + +YEK+Y +++ KL+R+D A++ I+ S  L +   +I+ +GNYMN   KQA G KL
Sbjct: 1092 LLTLLTYEKDYFDIMYKLQRVDDAITMIKSSHKLKDALMMIVEIGNYMN--RKQAPGIKL 1149

Query: 1504 NTLQRLTFIKDSTN-SMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQLVNDCN 1562
            ++LQ+L F+K S + +++FL+ VE+ +R       GF++EL  VLD+  + V Q+  D  
Sbjct: 1150 SSLQKLAFVKSSKDKNVSFLHVVERFLRVKCKATYGFVDELSKVLDLGNLVVGQVEQDFQ 1209

Query: 1563 EFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFMEFE 1622
            E+ + I  V++SL+ G LSDS  FHP D+++ KV P +  A +K+ LL ++ KLT    E
Sbjct: 1210 EYLKRIDAVKQSLDCGRLSDSESFHPEDRLLIKVGPKMAGAARKATLLQNQFKLTMRALE 1269

Query: 1623 ALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMV 1676
             LM+ +GED      +N FF  F  FI ++KKA  +N++ EE  R Y   K+++
Sbjct: 1270 NLMRLYGEDHKSVDCRNDFFHHFIQFIIQFKKAAKENIENEEVERIYNHRKELL 1323

 Score = 33.9 bits (76), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 44/215 (20%), Positives = 93/215 (43%), Gaps = 19/215 (8%)

Query: 544 EYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYE-D 602
           +YCL +L  IN +   +  + +++     F+ L  L +    +LM       Q+E++E D
Sbjct: 348 DYCLTSLFLINSILQITSSVAEKLAY---FKRLKELNIHRLFQLMH------QLEHHEID 398

Query: 603 HKLDDFNSLLE--MKSSSAQINMQDPTSLIGSLWEVCKGTENEKXXXXXXXXXXXXXXKL 660
            ++D + SL E  ++ ++ +       S    L  +   T                   L
Sbjct: 399 GEIDKYKSLEEEVIQKTNPEFPQLLNVSYGKFLTNIIHQTHQNPLEHCMHQLFETLSKTL 458

Query: 661 VDDKREPAKLSKQLKLMDSLMTNITASEVDEQ-----THMNLAIQRLYDSMQTDDVARRA 715
           V   R  +   K L L  S++  +      E+     + +N+++  L D +Q+D++A+RA
Sbjct: 459 V--ARTMSDNLKVLTLFHSVIDYLKEYSYGEENINIDSVVNISLNHLVDGLQSDEIAKRA 516

Query: 716 ILETRTLSKKLEEVTAEKEYLKEKLSKAENGLVGQ 750
           + E     K++E + +E   L++     + G++ +
Sbjct: 517 MSELELAQKEIENLESEIRALRKDKEITKGGVLSE 551

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score =  275 bits (703), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 145/415 (34%), Positives = 248/415 (59%), Gaps = 12/415 (2%)

Query: 1267 QKKLKQLHWDKLDDSEGSIWSSAMAEQ-FADDLYEKGVLHNLEKAFAAREI---KSLANK 1322
            +KKLKQ+HWDK+++ + ++W  A   Q    +L   G+   ++  F+ +++      A  
Sbjct: 856  KKKLKQIHWDKIENVKNTLWDHADGRQDTILELEHAGIFEKVQGMFSVQDLVVKPKRAVN 915

Query: 1323 KKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSKPEI 1382
             +E    +SFLSRD SQQ  INLH+F  LT  E++ K+L C+ D +   SV+EF  K E+
Sbjct: 916  VRESNKLLSFLSRDFSQQLAINLHIFAQLTEKEVLQKVLACDNDTIQNVSVLEFFCKDEM 975

Query: 1383 TDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPSRMR 1442
             ++     R++ PY  D+     +  ++ P K+ D L+RAD++++ L  NL+ YW  R +
Sbjct: 976  VNIGSARIRHFTPYSADY-----LNASEQPAKNPDELERADKLFLYLPFNLRRYWAERSQ 1030

Query: 1443 AIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQGFK 1502
             + VI++YE+EY +++  L++ID A+  I+ S+       +I+ +GNYMN  +K  +G +
Sbjct: 1031 CLLVISTYEREYYDMLYNLQKIDDALQNIRHSEKFKTFLYIIIELGNYMN--TKAVEGIR 1088

Query: 1503 LNTLQRLTFIKDSTN-SMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQLVNDC 1561
            LN+L +L FIK + N + +FL++VEK++R +YP+  GFI +L  V D+ KI+++Q+   C
Sbjct: 1089 LNSLTKLAFIKSNDNKNFSFLHFVEKMLRIHYPDVYGFINDLNKVEDLGKITIDQVQLQC 1148

Query: 1562 NEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFMEF 1621
             E+   I  +  S+  G LSD ++ HP D+++ KV   +  A  KS+LL  + KLT  +F
Sbjct: 1149 EEYCTKIERIAHSVTKGKLSDPTQLHPDDQILRKVKYKVTRAKTKSELLQAQFKLTNNDF 1208

Query: 1622 EALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMV 1676
               M  +GED  D   + +FF +F +F + ++K   +N++ EE  R YE+ K++ 
Sbjct: 1209 RKSMLYYGEDPDDTDNKINFFNQFVEFSSLFRKCARENIEKEEADRAYEQRKKIA 1263

>Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (REAL)
          Length = 1375

 Score =  273 bits (698), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 139/421 (33%), Positives = 247/421 (58%), Gaps = 26/421 (6%)

Query: 1269 KLKQLHWDKLDDSEGSIWSSAMAEQ-FADDLYEKGVLHNLEKAFAAREIKSLANKKKEDL 1327
            +LKQ+HWDK+++ + ++W      Q    +L   G+   +E  F  ++   +A+KK  + 
Sbjct: 881  RLKQIHWDKVEEIKDTLWEDTTQRQETLKELQTDGIFSQIEDIFKMKDPVKIASKKNGNS 940

Query: 1328 -----------DKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEF 1376
                         +SFLSRD++QQFGINLHMF  ++  E V K+L C+ +++   ++++F
Sbjct: 941  STSISSNNGKSSNVSFLSRDLAQQFGINLHMFSQVSDMEFVKKVLNCDNNIIMNVNILKF 1000

Query: 1377 LSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSY 1436
              K E+  +  ++   Y PY     G           KSV  LQRAD+I+++L +NL+SY
Sbjct: 1001 FCKEELVSIPKSMLSKYEPYSQGKGG-----------KSVSDLQRADRIFLELCINLRSY 1049

Query: 1437 WPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSK 1496
            W +R +++  +++YE++Y +L+ KL++ID  +  + +S    +L  +I  +GN+MN   K
Sbjct: 1050 WNARSKSLLTLSTYERDYYDLIFKLQKIDDGILQLNRSVKFKSLMFIITEIGNHMN--KK 1107

Query: 1497 QAQGFKLNTLQRLTFIKDSTN-SMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVE 1555
              +G KL +L +L F++ S + +++FL+++EK+IR  YP+  GF+++L+ + D+ K+S+E
Sbjct: 1108 MVKGIKLKSLTKLAFVRSSADQNLSFLHFIEKVIRTKYPDIYGFVDDLKRIEDLGKVSLE 1167

Query: 1556 QLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVK 1615
             +  +C EF   +       + G LS+     P D+++ KV   +  A  KSDLL D+ K
Sbjct: 1168 HVELECREFQNKVEYAVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAKTKSDLLVDQCK 1227

Query: 1616 LTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQM 1675
            LT ++   LM+ +GED  DK ++N FF+ F +F+  +KK   +N++ EE  R YE+ K +
Sbjct: 1228 LTLIDLSKLMKYYGEDPNDKESKNEFFQPFIEFLAMFKKCAKENIEKEEMERVYEQRKNL 1287

Query: 1676 V 1676
            +
Sbjct: 1288 L 1288

 Score = 36.6 bits (83), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 56/104 (53%), Gaps = 22/104 (21%)

Query: 659 KLVDDKREPAKLSKQLKLMDSLMTNITAS-------EVDE-----QTHMNL------AIQ 700
           K++D +R  ++  K L+L++SL+  +  S         DE     Q   N+      +I 
Sbjct: 459 KILDSQRPYSESIKLLRLINSLLFYLIDSFQVPLNASFDEALDQPQNTQNVDSVFQDSID 518

Query: 701 RLYDSMQTDDVARRAILETRTLSKKL----EEVTAEKEYLKEKL 740
           +L DS+Q+DD+ARRA++E   L+ K+    E ++  + Y K++L
Sbjct: 519 KLLDSLQSDDIARRAVIEIDDLNCKISTLNERISLVENYSKDQL 562

>KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5.717
            YIL159W
          Length = 1324

 Score =  271 bits (694), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 145/415 (34%), Positives = 242/415 (58%), Gaps = 27/415 (6%)

Query: 1269 KLKQLHWDKLDDSEGSIWS-SAMAEQFADDLYEKGVLHNLEKAFAAREIK------SLAN 1321
            +LKQ+HW+K++D E ++W  SA  E+ A +L   G+   +   F  + IK      + A+
Sbjct: 852  RLKQIHWEKVEDIESTLWHDSARREETAKELKLDGIFDQVMDTFQVKNIKMKKRDTTTAS 911

Query: 1322 KKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSKPE 1381
            KK+      + L R+++QQFGINLHMF SL  DE V K+L+CN D+++  SV+EF +K E
Sbjct: 912  KKQNG----TLLPRNLAQQFGINLHMFSSLGTDEFVEKVLECNSDIVSNVSVLEFFNKEE 967

Query: 1382 ITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPSRM 1441
            +T +  +L + + PY  +              KS   L+RAD+I+ +L   L SYW  R 
Sbjct: 968  LTSIPTSLIQKFTPYAENI-------------KSKFELERADRIFFELCFQLHSYWRERS 1014

Query: 1442 RAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQGF 1501
              + ++ +YEK+Y +L+ KL+++D  +  +  S    +   +I+ +GNYMN   K   G 
Sbjct: 1015 NCLLILNTYEKDYYDLMYKLKKVDDGIQRLLSSSKFRDFLYIIIEIGNYMN--KKTVNGI 1072

Query: 1502 KLNTLQRLTFIKDST-NSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQLVND 1560
            ++ +L +L F+K S  N+++FL+++EKIIR  YP+   FI EL  + D+ K+S++QL  D
Sbjct: 1073 RIGSLNKLVFVKSSLDNNVSFLHFIEKIIRVKYPDIYSFINELRIIQDLGKLSIDQLEYD 1132

Query: 1561 CNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFME 1620
              EF   I  +   LE G LS + +  P D+++ K    +  A  KS+L+  ++KL   +
Sbjct: 1133 SQEFCSKINKMSNDLEKGKLSKADRIDPRDQLLKKTKYKVLRAKSKSELMRHQLKLLGHD 1192

Query: 1621 FEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQM 1675
            +  +M+ FGED+ D+ ++N+FF    +FI  +KK   +N++ EE  R YE+ ++M
Sbjct: 1193 YAKIMRYFGEDASDRDSKNAFFTNIFEFIQVFKKCSKENIEKEEMERVYEQRQKM 1247

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
            YIL159W
          Length = 1642

 Score =  273 bits (697), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 161/493 (32%), Positives = 267/493 (54%), Gaps = 44/493 (8%)

Query: 1265 RPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVLHNLE------KAFAAREIKS 1318
            +  KKLKQ+HW ++++   +IW         D+  ++G+   LE      +  ++ ++K 
Sbjct: 1138 KEDKKLKQIHWIRVNEVAETIW--------KDNDRDRGIFMELECVGVFDRVKSSFKLKD 1189

Query: 1319 LANKKKEDLDKI-------SFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTP 1371
            +  KK  D  K        SFLSRD++QQFGINLH+F S  V EL+ K+L+C+ D+    
Sbjct: 1190 VIKKKNTDEAKTKDKQQLKSFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNI 1249

Query: 1372 SVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMV 1431
            +++EF +K E T +S ++ARNYAPY  D++            K    L+RAD+I+++L  
Sbjct: 1250 TILEFFNKEEFTHISGSVARNYAPYGVDYQT------NNEATKDASELERADRIFLELFY 1303

Query: 1432 NLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYM 1491
            NL++YW  R + + ++ +YEK+Y +L+ KL+RID AV  +  S        ++L +GN+M
Sbjct: 1304 NLRAYWAERSQCLLLLHTYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFM 1363

Query: 1492 NDSSKQAQGFKLNTLQRLTFIKDS-TNSMTFLNYVEKIIRENYPEFNGFIEELEPVLDVV 1550
            N   K A+G  +++L +L FIK S  N+++FL+++EK IR  +PE  GFI++L  V ++ 
Sbjct: 1364 N--KKPAEGILISSLTKLVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELG 1421

Query: 1551 KISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLL 1610
             +S++ +  +C EF   +     ++  G LS     HP D+++ KV   + +A  KS+ L
Sbjct: 1422 NVSLDHITMECKEFCTHVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFL 1481

Query: 1611 TDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYE 1670
             D+  LT      +++ +GED  D+ +++ FFK  A+F   +KK   +N+  EE  R YE
Sbjct: 1482 RDQQILTNHSIVKVLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYE 1541

Query: 1671 RHKQMVXXXXXXXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPARSDPSS 1730
            + K M+                    D    E   +N   +DKLL +L+      + P  
Sbjct: 1542 QRKYMLDNKLQK---------NNSSGDDSDLEKNTENDDAVDKLLLKLRG---VENKPEP 1589

Query: 1731 ARKRAVMRKKLLS 1743
             R+R     KLLS
Sbjct: 1590 LRRRR--STKLLS 1600

>TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1451

 Score =  259 bits (661), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 147/480 (30%), Positives = 264/480 (55%), Gaps = 27/480 (5%)

Query: 1266 PQKKLKQLHWDKLDDSEGSIWSSAMAE-QFADDLYEKGVLHNLEKAFAARE-IKSLANKK 1323
            P K +KQ+HW+K+  +  S+W           +L   G+   +E  F +++ +    N K
Sbjct: 966  PTKNMKQIHWEKVSRTGASLWEDDDQRLSIIKELEHTGIFSEVEDIFYSKDAVIKRRNPK 1025

Query: 1324 KEDLDKI-SFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFLSKPEI 1382
             +  +K+ + L R+++QQFGINLHMF  ++  +L  K+L+C+  +    SVIEF +  ++
Sbjct: 1026 DQTQNKVLTLLPRELAQQFGINLHMFSQISPQDLFEKVLQCDISINQNLSVIEFFNNEDL 1085

Query: 1383 TDVSINLARNYAPYITDWEGVKHVEDAKAPEKSVDGLQRADQIYVQLMVNLQSYWPSRMR 1442
            T++  N+ R + PY  D++          P K +  L R D I++ L  NL+SYW  R +
Sbjct: 1086 TNIPSNICRTFEPYSIDYKT-----PGSKPTKDISELSRVDHIFLLLCYNLRSYWKERSQ 1140

Query: 1443 AIKVITSYEKEYTELVTKLRRIDSAVSAIQKSDNLTNLFNVILAVGNYMNDSSKQAQGFK 1502
             + ++ +YEK+Y +L+ KL R+D A++AI+ S  L ++  +I+A+GN+MN   K   G +
Sbjct: 1141 CLLMLLTYEKDYYDLMFKLERLDEAINAIKNSQRLKSVLYIIVAIGNFMN--KKGVDGIR 1198

Query: 1503 LNTLQRLTFIKDSTNS-MTFLNYVEKIIRENYPEFNGFIEELEPVLDVVKISVEQLVNDC 1561
            L++L +LT+IK ++ S  +FL+++E++IR  YPE   F  +L  V ++  ++++ L  + 
Sbjct: 1199 LSSLNKLTYIKSNSESKASFLHFIERLIRVRYPELYYFTSDLRKVENLGNVTLDHLQLEY 1258

Query: 1562 NEFTQSIMNVERSLEIGNLSDSSKFHPLDKVITKVLPVLPEATKKSDLLTDEVKLTFMEF 1621
            ++ +  I  V RS++ G LS+    HP D ++ KV   +  A  K  +L D+  LT ++ 
Sbjct: 1259 DDLSSKINTVHRSIQKGQLSNKKNLHPQDNILDKVKYKVIRAANKRTILQDKFTLTNIDL 1318

Query: 1622 EALMQKFGEDSGDKFAQNSFFKKFADFINEYKKARAQNLKAEEEVRKYERHKQMVXXXXX 1681
            E L+  FGED  D   + +FFK  ++F+  ++K   +N++ EE  R YE+ +Q++     
Sbjct: 1319 EKLLVYFGEDPDDMNNKITFFKSISEFLTLFRKCAKENIEKEEADRVYEQRRQLLDSKIQ 1378

Query: 1682 XXXXXXXNYMETGVSDSESAEAKGDNRGHMDKLLAQLKNAGPARSDPSSARKRAVMRKKL 1741
                           DS   E + D +  +D+LL +L+        P++A +R    K+L
Sbjct: 1379 AQW------------DSSMDEIEEDQQDAVDQLLKKLRGV----EQPTTAVRRRKSSKRL 1422

>KLTH0H11968g Chr8 complement(1023447..1024880) [1434 bp, 477 aa] {ON}
            similar to uniprot|P53980 Saccharomyces cerevisiae
            YNL011C Hypothetical ORF
          Length = 477

 Score = 36.2 bits (82), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 1260 YSKYPRPQKKLKQLHWDKLDDSEGSIWSSAMAEQFADDLYEKGVL 1304
            Y+ Y  P+ KL QLH+DKLD SE  +  + +   F  + Y + VL
Sbjct: 280  YAGYIHPELKLSQLHFDKLDISEDQLLPAPVRRIFYINPYGEEVL 324

>KAFR0A05570 Chr1 (1112905..1116576) [3672 bp, 1223 aa] {ON}
           Anc_4.315 YLR436C
          Length = 1223

 Score = 35.8 bits (81), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 542 ILEYCLWALIFINKLCNFSDELNQRVVLRTKFENLGGLRVMTKLKLMDYEKMT 594
           ++ +C+W +IFI    +F D  +  V L T    +G +R++TKL    Y+ ++
Sbjct: 136 LIRFCIWQIIFITNSLDFKDSNSLNVQLETV---IGSVRILTKLIPAYYDHLS 185

>Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D - TyB
            Gag-Pol protein [contig 416] FULL
          Length = 542

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 7/100 (7%)

Query: 1723 PARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMI 1782
            P    P      + ++KKL  E+     IL       GS+IY P+T +VVDT   ++  +
Sbjct: 388  PRFGQPCMVHDYSALKKKL-KERSIPGYILHKSETSYGSLIYIPSTGRVVDT---QNYNL 443

Query: 1783 LKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAE 1822
            +++    S +  ETD+  D   +DT TVD    ++D + E
Sbjct: 444  IEN---HSNELPETDSELDIDNSDTETVDTDVSDSDNDDE 480

>ADL116C Chr4 complement(481043..482350) [1308 bp, 435 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL042C
          Length = 435

 Score = 34.7 bits (78), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 35/69 (50%)

Query: 807 ADASLNNSSDKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQMEDIEKE 866
           A A + N +   ++ +K +E  + R+ +DL   ++ FG  + P+   RM        EK+
Sbjct: 308 ARAHIENHTPSNYSAEKPIEVTIVRSYEDLEIRIRDFGGGIPPDVEDRMFDYSYTTSEKD 367

Query: 867 ARELEMTNF 875
           A++  M+ +
Sbjct: 368 AKDTGMSAY 376

>Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON} YOR343C-B
            - TyB Gag-Pol protein [contig 457] FULL
          Length = 641

 Score = 34.7 bits (78), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 7/100 (7%)

Query: 1723 PARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMI 1782
            P    P      + ++KKL  E+     IL       GS+IY P+T +VVDT   ++  +
Sbjct: 453  PRFGQPCMVHDYSALKKKL-KERSIPGYILHKSETSYGSLIYIPSTGRVVDT---QNYNL 508

Query: 1783 LKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAE 1822
            +++    S +  ETD+  D   +DT TVD    ++D + E
Sbjct: 509  IEN---HSNELPETDSELDIDNSDTETVDTDVSDSDNDDE 545

>Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {ON}
            YPL060C-A - TyA Gag protein [contig 94] FULL
          Length = 478

 Score = 34.3 bits (77), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 7/100 (7%)

Query: 1723 PARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMI 1782
            P    P      + ++KKL  E+     IL       GS+IY P+T +VVDT   ++  +
Sbjct: 292  PRFGQPCMVHDYSALKKKL-KERSIPGYILHKSETSYGSLIYIPSTGRVVDT---QNYNL 347

Query: 1783 LKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAE 1822
            +++    S +  ETD+  D   +DT TVD    ++D + E
Sbjct: 348  IEN---HSNELPETDSELDIDNSDTETVDTDVSDSDNDDE 384

>Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON}
            YBL101W-B - TyB Gag-Pol protein [contig 696] FULL
          Length = 865

 Score = 34.3 bits (77), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 7/100 (7%)

Query: 1723 PARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMI 1782
            P    P      + ++KKL  E+     IL       GS+IY P+T +VVDT   ++  +
Sbjct: 388  PRFGQPCMVHDYSALKKKL-KERSIPGYILHKSETSYGSLIYIPSTGRVVDT---QNYNL 443

Query: 1783 LKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAE 1822
            +++    S +  ETD+  D   +DT TVD    ++D + E
Sbjct: 444  IEN---HSNELPETDSELDIDNSDTETVDTDVSDSDNDDE 480

>Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A - Ty
            ORF [contig 372] FULL
          Length = 734

 Score = 33.5 bits (75), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 7/100 (7%)

Query: 1723 PARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMI 1782
            P    P      + ++KKL  E+     IL       GS+IY P+T +VVDT   ++  +
Sbjct: 453  PRFGQPCMVHDYSALKKKL-KERSIPGYILHKSETSYGSLIYIPSTGRVVDT---QNYNL 508

Query: 1783 LKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAE 1822
            +++    S +  ETD+  D   +DT TVD    ++D + E
Sbjct: 509  IEN---HSNELPETDSELDIDNSDTETVDTDVSDSDNDDE 545

>Kwal_50.19418 s50 complement(1189..2235) [1047 bp, 348 aa] {ON}
            YPL060C-A - TyA Gag protein [contig 328] FULL
          Length = 348

 Score = 33.5 bits (75), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 7/100 (7%)

Query: 1723 PARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMI 1782
            P    P      + ++KKL  E+     IL       GS+IY P+T +VVDT   ++  +
Sbjct: 194  PRFGQPCMVHDYSALKKKL-KERSIPGYILHKSETSYGSLIYIPSTGRVVDT---QNYNL 249

Query: 1783 LKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAE 1822
            +++    S +  ETD+  D   +DT TVD    ++D + E
Sbjct: 250  IEN---HSNELPETDSELDIDNSDTETVDTDVSDSDNDDE 286

>NCAS0E00990 Chr5 complement(185805..187103) [1299 bp, 432 aa] {ON} 
          Length = 432

 Score = 33.1 bits (74), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 85/198 (42%), Gaps = 37/198 (18%)

Query: 1267 QKKLKQLHWDKLDDSEGSIW---------SSAMAEQFADDLYEKGVLHNLEKAFAAREIK 1317
             K  K++  +K+ D E  IW            M  ++ +D++E   LH L       E+ 
Sbjct: 134  HKTPKKIKAEKIKDVEECIWDDLDEEDGNDPLMVSEYVNDIFEH--LHQL-------ELL 184

Query: 1318 SLANKKKEDLDKISFLSRDISQQFGINLHMFGSLTVDELVIKILKCNRDVMNTPSVIEFL 1377
            +L NK++    K    +RDI   + I +H    L  + L + I   +R          FL
Sbjct: 185  TLPNKEQIIKHKNITHNRDILINWLIKVHNKFGLLPETLYLAINLLDR----------FL 234

Query: 1378 SKPEITDVSINLARNYAPYI-TDWE-----GVKHVEDAKAPEKSVDGLQRADQIYVQ-LM 1430
            SK E+T   + L   Y  +I + +E      VKH         S+D +++ ++  ++ L 
Sbjct: 235  SKEEVTLNKLQLVGTYCLFIASKYEEIYSPSVKHFASETDGACSIDEIKKGEKFVLKALK 294

Query: 1431 VNLQSYWPSRMRAIKVIT 1448
             NL   +P+ M  ++ I+
Sbjct: 295  FNLN--YPNPMNFLRRIS 310

>Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {ON}
            YPL060C-A - TyA Gag protein [contig 345] FULL
          Length = 744

 Score = 33.1 bits (74), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 7/100 (7%)

Query: 1723 PARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKVVDTSLGEDEMI 1782
            P    P      + ++KKL  E+     IL       GS+IY P+T +VVDT   ++  +
Sbjct: 347  PRFGQPCMVHDYSALKKKL-KERSIPGYILHKSETSYGSLIYIPSTGRVVDT---QNYNL 402

Query: 1783 LKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAE 1822
            +++    S +  ETD+  D   +DT TVD    ++D + E
Sbjct: 403  IEN---HSNELPETDSELDIDNSDTETVDTDVSDSDNDDE 439

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 177,197,908
Number of extensions: 7570908
Number of successful extensions: 30899
Number of sequences better than 10.0: 155
Number of HSP's gapped: 31877
Number of HSP's successfully gapped: 225
Length of query: 1940
Length of database: 53,481,399
Length adjustment: 125
Effective length of query: 1815
Effective length of database: 39,148,149
Effective search space: 71053890435
Effective search space used: 71053890435
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 73 (32.7 bits)