Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0B032608.255ON71471435910.0
Kpol_392.118.255ON67571022510.0
Suva_2.2688.255ON69572019670.0
NCAS0B038808.255ON70673219520.0
YDR108W (TRS85)8.255ON69871519440.0
Smik_4.3548.255ON69871919280.0
Skud_4.3698.255ON69871619200.0
TDEL0F038208.255ON68770818980.0
NDAI0J014108.255ON71673318930.0
CAGL0B01705g8.255ON67271918630.0
ZYRO0C01826g8.255ON69955017430.0
TBLA0E043808.255ON88981516190.0
KAFR0B055708.255ON66955215900.0
Kwal_56.235838.255ON70060513780.0
KLTH0G13860g8.255ON70859913721e-180
SAKL0H17226g8.255ON71961913561e-178
KNAG0H032708.255ON64857812811e-167
Ecym_43168.255ON62355710211e-129
AGR096C8.255ON62354610081e-127
KLLA0F18953g8.255ON6475679061e-112
TBLA0I005803.6ON51495733.3
CAGL0C04499g3.215ON27651714.6
CAGL0H09086g2.127ON23191714.9
KNAG0I006402.316ON113686716.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0B03260
         (714 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...  1387   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   871   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...   762   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   756   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...   753   0.0  
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...   747   0.0  
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...   744   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   735   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   733   0.0  
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   722   0.0  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   676   0.0  
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   628   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   617   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   535   0.0  
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   533   e-180
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   526   e-178
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   498   e-167
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   397   e-129
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   392   e-127
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   353   e-112
TBLA0I00580 Chr9 complement(102907..104451) [1545 bp, 514 aa] {O...    33   3.3  
CAGL0C04499g Chr3 complement(432406..433236) [831 bp, 276 aa] {O...    32   4.6  
CAGL0H09086g Chr8 complement(887366..888061) [696 bp, 231 aa] {O...    32   4.9  
KNAG0I00640 Chr9 (109522..112932) [3411 bp, 1136 aa] {ON} Anc_2....    32   6.6  

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score = 1387 bits (3591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/714 (94%), Positives = 673/714 (94%)

Query: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
           MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF
Sbjct: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120
           YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS
Sbjct: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120

Query: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKXXXXXXXXXXXXXLFQRDSTQSQFIRFTRP 180
           DQNVINPTNDPTVNNNYLDVDTKTDNLLPK             LFQRDSTQSQFIRFTRP
Sbjct: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKSSQTTRNRSRSNSLFQRDSTQSQFIRFTRP 180

Query: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240
           IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST
Sbjct: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240

Query: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300
           NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF
Sbjct: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300

Query: 301 VLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEML 360
           VLCYNG                  QLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEML
Sbjct: 301 VLCYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEML 360

Query: 361 YVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLF 420
           YVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLF
Sbjct: 361 YVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLF 420

Query: 421 RKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESL 480
           RKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESL
Sbjct: 421 RKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESL 480

Query: 481 LEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNSI 540
           LEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNSI
Sbjct: 481 LEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNSI 540

Query: 541 AESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACSQIM 600
           AESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACSQIM
Sbjct: 541 AESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACSQIM 600

Query: 601 IWERLSDCYNLRTDPRVKHKLRSNISTXXXXXXXXXXIKKQDVSSIVLKGLTRQRKASFF 660
           IWERLSDCYNLRTDPRVKHKLRSNIST          IKKQDVSSIVLKGLTRQRKASFF
Sbjct: 601 IWERLSDCYNLRTDPRVKHKLRSNISTSSVSEVSEEEIKKQDVSSIVLKGLTRQRKASFF 660

Query: 661 RLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNLLENSKK 714
           RLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNLLENSKK
Sbjct: 661 RLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNLLENSKK 714

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  871 bits (2251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/710 (61%), Positives = 515/710 (72%), Gaps = 46/710 (6%)

Query: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
           + F+YENYMNL++HLD+V+E VPQDISKRIVSNAIAPVITV +T ELD H+ + Y IDS 
Sbjct: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63

Query: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120
           Y L+RYFGGCISDRDQ+NEY+KK   E    A   VN   IEE +               
Sbjct: 64  YLLMRYFGGCISDRDQANEYVKKANVENT--AQEGVNDQIIEEQR--------------- 106

Query: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKXXXXXXXXXXXXXLFQRDSTQSQFIRFTRP 180
                        N+N L+        LPK             LFQRDSTQS +IRFT+P
Sbjct: 107 -------------NSNTLE--------LPKSERYSRSRSNS--LFQRDSTQSHYIRFTKP 143

Query: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240
           IEDL+ S  + DMLFDYH+LE++L  CL +++K T D+ DHK L+ SL+HRFFSSAISST
Sbjct: 144 IEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDHKALKMSLFHRFFSSAISST 203

Query: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300
             LSPYESFNHP++SL+A+DI+KGQNYE ARDLLI FKNQN  +  FP FMSTNDIL VF
Sbjct: 204 TYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQNNAVEEFPPFMSTNDILLVF 263

Query: 301 VLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEML 360
           +LCY+G                  QLFAE + +PLW+K +S+D+ V+LHQPAMSSLDEML
Sbjct: 264 LLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSHSEDVQVELHQPAMSSLDEML 323

Query: 361 YVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLF 420
           Y F+     +LPL LIN IYD +E L  DLMIPFMQRKI+FWEETILQP+KSLF G KLF
Sbjct: 324 YFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKISFWEETILQPRKSLFHGNKLF 383

Query: 421 RKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESL 480
           RKFM R S     Q N  +KD++GNEYF S+S  FLLRKLADWSMMISDFKTAY+T+E+L
Sbjct: 384 RKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRKLADWSMMISDFKTAYSTYETL 443

Query: 481 LEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNSI 540
           + D+E +PKYLASCLEWCA+ ILMGAQNIVT KMIKNDVNPLIERSLD Y  C++L  + 
Sbjct: 444 ISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDVNPLIERSLDTYEQCSILAQNS 503

Query: 541 AESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACSQIM 600
            E++E   +EPVRSYETRCML+TSELFLSL+DTWTSTPYALSNLETIL+ECKLG CSQIM
Sbjct: 504 LENDELL-SEPVRSYETRCMLLTSELFLSLNDTWTSTPYALSNLETILAECKLGICSQIM 562

Query: 601 IWERLSDCYNLRTDPRVKHKLRSNISTXXXXXXXXXXIKKQDVSSIVLKGLTRQRKASFF 660
           IWERLSDCYN+RTDPR++H++ +   T          ++  D   IV KGL R+RKA+FF
Sbjct: 563 IWERLSDCYNMRTDPRIRHRVET--VTKIENNEGGQQLQTDD---IVSKGLARKRKAAFF 617

Query: 661 RLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNLLE 710
           RLLAAKKWAEQ QWRQVSWCL D+  +Y D  F KR  LIYQKLK  L E
Sbjct: 618 RLLAAKKWAEQKQWRQVSWCLRDVEYIYDDLSFSKRPELIYQKLKDELNE 667

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/720 (54%), Positives = 480/720 (66%), Gaps = 54/720 (7%)

Query: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
           M F+YE+YMNL+FHLD   E VP +I+KRIVSNAIAPVITVT+T   D HI E Y +DS 
Sbjct: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60

Query: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120
           Y LLR+FGGC+SDRDQ+NE  K  +DEQ +                              
Sbjct: 61  YMLLRFFGGCVSDRDQANEG-KFEQDEQNA------------------------------ 89

Query: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKXXXXXXXXXXXXXLFQRDSTQSQFIRFTRP 180
                     P++ ++     +K  NL                LFQRDSTQSQ++RFTRP
Sbjct: 90  ---------SPSIESS-----SKNQNLGVPSALKRGSRSRSNSLFQRDSTQSQYVRFTRP 135

Query: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240
           + DL+ +  T DMLF+YH+LE+FL + LK+V   T + + H  L+KS+YH FFS AISST
Sbjct: 136 LGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLKKSIYHSFFSLAISST 195

Query: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300
           N LSPYE+FNHPI+SLIA+DI+ G+ YE ARDLL+ FKN N    +FPIFM+TN++LPVF
Sbjct: 196 NNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTESFPIFMNTNEMLPVF 255

Query: 301 VLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYSD--DITVKLHQPAMSSLDE 358
           +LCYN                   QLF E I +PLW   + D  +  ++LHQP MSSL+E
Sbjct: 256 LLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFVDVENSNIQLHQPVMSSLEE 315

Query: 359 MLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTK 418
           +L+  +     KL L LIN IYD L+ L  DLMIPFM+RKI+FWEETILQP+KSLF G K
Sbjct: 316 ILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWEETILQPRKSLFNGAK 375

Query: 419 LFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFE 478
            F+KFM +  +    Q N   KDNQGNEYFAS+S+ FL+RKLADWSMM+SDFKTAY+T+E
Sbjct: 376 FFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYE 435

Query: 479 SLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALL-L 537
           SL++D++ +PKYLASC+EWCAV +LMGAQ+IVT KMIKND+NPLIER+L  Y NC+ +  
Sbjct: 436 SLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENCSRMQR 495

Query: 538 NSIAESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACS 597
            +  E   S   EPVRSYETRCM++ SELFLSLSDTWTSTPYA+  LETIL ECKLG CS
Sbjct: 496 RNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCS 555

Query: 598 QIMIWERLSDCYNLRTDPRVKHKL----RSNISTXXXXXXXXXXIKKQDVSSIVLKGLTR 653
           QIM+WERLSDCYNLR DPRVKHK+    +S  +T                  I+ +GLTR
Sbjct: 556 QIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEYDTDHFTEEDILSEGLTR 615

Query: 654 QRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNLLENSK 713
           +RKA+FFRL+AAKKWAEQ QWRQVSWCL DI   Y D  F     LI   LK  L  NSK
Sbjct: 616 RRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHGNGLILSNLKNQL--NSK 673

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/732 (52%), Positives = 478/732 (65%), Gaps = 77/732 (10%)

Query: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
           M F+YE+YMNL+FHLD   E VP +I+KRIVSNAI+PVI VT+T ELD HI E Y IDS 
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120
           Y LLR+F GC+SDRDQ+NE  K  +D+                              + S
Sbjct: 61  YMLLRFFSGCVSDRDQANELEKSQKDK------------------------------ISS 90

Query: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKXXXXXXXXXXXXXLFQRDSTQSQFIRFTRP 180
           +  +  PT  P                LPK             LFQRDSTQSQ+IRFT+P
Sbjct: 91  NNTLTLPTTSP----------------LPKVRTRGRSRSNS--LFQRDSTQSQYIRFTKP 132

Query: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240
           + D++ +    DMLFDYH+LEI+L + L +++K T D+  ++ L+KS+YH FFS AISST
Sbjct: 133 LGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSIYHSFFSLAISST 192

Query: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300
             LSPYE FNHP+VSLIA+DI+ GQNY+  RDLL+ FKN N++ +NFPIFM+TND+LPV 
Sbjct: 193 TILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFPIFMNTNDMLPVV 252

Query: 301 VLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEML 360
           +LCY+                   QLF ECI +PLW   Y  D  V LHQP MSSL+EM+
Sbjct: 253 LLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQVHLHQPVMSSLEEMI 312

Query: 361 YVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLF 420
           Y     K   LP  LI  IY+ L+ L  +LMIPFM+RKI FW+ETILQP+KSLF G K  
Sbjct: 313 YFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETILQPRKSLFHGAKFL 372

Query: 421 RKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESL 480
           +KFM + ++T+  QEN+  KD QGNEYF S S+ FL+RKLADWSMM+SDFKTAY T+ESL
Sbjct: 373 KKFMTKTALTH--QENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLSDFKTAYATYESL 430

Query: 481 LEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNSI 540
             D+E +PKY ASCLEWCAV +LMGAQNIVT KM+KND+NPLIE++L  Y NCA +L   
Sbjct: 431 THDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALSTYENCATVL--- 487

Query: 541 AESEESPDTE----PVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGAC 596
            E+++    E    PVRSYETRCM++ SELFLSLSDTWTSTPYA+S LETIL ECKLGAC
Sbjct: 488 PETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAISYLETILVECKLGAC 547

Query: 597 SQIMIWERLSDCYNLRTDPRVKHKLRSNISTXXXXXXXXXX-----------IKKQDVSS 645
           SQIMIWERLSDCY LR DPR+KHK    I+                      + K+DVS+
Sbjct: 548 SQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDMQGHVMTPSPLTKEDVSN 607

Query: 646 ---------IVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKR 696
                    IV KG TR+RKA+FFRL+AAKKWAEQ +WRQVSWCL  I + Y       R
Sbjct: 608 DANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYSKIGLADR 667

Query: 697 ESLIYQKLKRNL 708
           + LI +K++  L
Sbjct: 668 DDLILKKIQNKL 679

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/715 (53%), Positives = 472/715 (66%), Gaps = 49/715 (6%)

Query: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
           M F+YE+YMNL+FHLD   E VP +I+KRI+SNAIAPVITVT+T   D HI E Y +DS 
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60

Query: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120
           Y LLR+FGGC+SDRDQ+NE                         KV  +E E        
Sbjct: 61  YMLLRFFGGCVSDRDQANE------------------------AKVGQHEHE-------- 88

Query: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKXXXXXXXXXXXXXLFQRDSTQSQFIRFTRP 180
               +   +D T      D   K  NL                LFQRDSTQSQ+IRFTRP
Sbjct: 89  ----VCDASDST------DSIPKNKNLEVPNLSKKGSRSRSNSLFQRDSTQSQYIRFTRP 138

Query: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240
           + DL+ +    DMLF+YH+LE+FL + LK+V   T + + H  L+KS+YH FFS AISST
Sbjct: 139 LGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHNLLKKSIYHSFFSLAISST 198

Query: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300
           N LSPYE+FNHPI+SLIA+DI+ G+ YE ARDLL+ FKN N    NFPIFM+TN++LPVF
Sbjct: 199 NNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNTENFPIFMNTNEMLPVF 258

Query: 301 VLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKR--YSDDITVKLHQPAMSSLDE 358
           +LCYN                   QLF E I + LW     Y ++  ++LHQP MSSL+E
Sbjct: 259 LLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDSFIYDENSVIQLHQPVMSSLEE 318

Query: 359 MLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTK 418
           +L+  Q      L L LIN IYD L+ L  DLMIPFM+RK++FWEETILQP+KSLF G K
Sbjct: 319 ILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAK 378

Query: 419 LFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFE 478
            F+KFM +  +    Q N   +D+QGNEYFAS+S+ FL+RKLADWSMM+SDFKTAY+T+E
Sbjct: 379 FFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYE 438

Query: 479 SLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLN 538
           SL++D++ +PKYLASC+EWCAV +LMGAQ+IVT KMIKND+NPLIER+L  Y NC+ +  
Sbjct: 439 SLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENCSRIQR 498

Query: 539 SIAESEESPD-TEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACS 597
              +   S D TEPVRSYETRCM++ SELFLSLS+TWTSTPYA+  LETIL ECKLG CS
Sbjct: 499 GKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPYAIQYLETILDECKLGPCS 558

Query: 598 QIMIWERLSDCYNLRTDPRVKHKL----RSNISTXXXXXXXXXXIKKQDVSSIVLKGLTR 653
           QIM+WERLSDCYNLR DPR+KH++    +    T                  I+ +GLTR
Sbjct: 559 QIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHKYSTDHFTDEDILSEGLTR 618

Query: 654 QRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNL 708
           +RKA+FFRL+AAKKWAEQ QWRQVSWCL DI   Y +  F     LI  KLK  L
Sbjct: 619 RRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLHGNGLILSKLKNQL 673

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/719 (53%), Positives = 479/719 (66%), Gaps = 57/719 (7%)

Query: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
           M F+YE+YMNL+FHLD   E VP +I+KRIVSNAIAPVITVT+T   D HI E Y +DS 
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60

Query: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120
           Y LLR+FGGC+SDRDQ+NE +K  +DE   H +   N +                E    
Sbjct: 61  YMLLRFFGGCVSDRDQANE-VKVGQDE---HQVGDTNASM---------------ESFSK 101

Query: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKXXXXXXXXXXXXXLFQRDSTQSQFIRFTRP 180
            +N+  P                    LPK             LFQRDSTQSQ+IRFTRP
Sbjct: 102 SKNLEVPN-------------------LPKKGSRSRSNS----LFQRDSTQSQYIRFTRP 138

Query: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240
           ++DL+ +  T DMLF+YH+LE+FL + LK+V   T + + H  L+KS+YH FFS AISST
Sbjct: 139 LDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHDLLKKSIYHSFFSLAISST 198

Query: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300
           N LSPYE+FNHPI+SLIA+DI+ G+ YE ARDLL+ FKN N    NFP+FM+TN++LPVF
Sbjct: 199 NNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNTENFPLFMNTNEMLPVF 258

Query: 301 VLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRY--SDDITVKLHQPAMSSLDE 358
           +LCYN                   QLF E + + LW   +  +++  ++LHQP MSSL+E
Sbjct: 259 LLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFIEANNSAIQLHQPVMSSLEE 318

Query: 359 MLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTK 418
           +L+  Q      L L LIN IYD L+ L  DLMIPFM+RK++FWEETILQP+KSLF G K
Sbjct: 319 ILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAK 378

Query: 419 LFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFE 478
            F+KFM +         N    DNQGNEYFAS+S+ FL+RKLADWSMM+SDFKTAY+T+E
Sbjct: 379 FFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYE 438

Query: 479 SLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLN 538
           SL++D++ +PKYLASC+EWCAV +LMGAQ IVT KMIKND+NPLIE++L  Y NC+ +  
Sbjct: 439 SLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDINPLIEKALATYENCSKIQR 498

Query: 539 SIAESEESPDT-EPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACS 597
           S +E   S +T EPVRSYETRCM++ SELFLSLSD WTSTPYA+  LETIL ECKLG C 
Sbjct: 499 SKSEKSSSSNTVEPVRSYETRCMILASELFLSLSDKWTSTPYAIQYLETILDECKLGPCC 558

Query: 598 QIMIWERLSDCYNLRTDPRVKHKLRSNISTXXXXXXXXXXIKKQDVSS--------IVLK 649
           QIMIWERLSDCY+LR DPR+KH+    +            ++  D +S        I+ +
Sbjct: 559 QIMIWERLSDCYSLRVDPRIKHR----VGAMKKGIRDTEDLRGGDGNSTDHFTDDDILSE 614

Query: 650 GLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNL 708
           GLTR+RKA+FFRL+AA+KWAEQ QWRQVSWCL DI  +Y D  F   + LI  KL   L
Sbjct: 615 GLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLNGDGLILSKLHNQL 673

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/716 (53%), Positives = 479/716 (66%), Gaps = 51/716 (7%)

Query: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
           M F+YE+YMNL+FHLD   E VP +I+KRIVSNAIAPVITVT+T   D HI E Y +DS 
Sbjct: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60

Query: 61  YTLLRYFGGCISDRDQSNE-YIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQ 119
           Y LLR+FGGC+SDRDQ+NE  +   E E             + +T V +       E L 
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHE-------------VSDTSVSM-------ESLS 100

Query: 120 SDQNVINPTNDPTVNNNYLDVDTKTDNLLPKXXXXXXXXXXXXXLFQRDSTQSQFIRFTR 179
            +QN+  P        N L   +++ +                 LFQRDSTQSQ+IRFTR
Sbjct: 101 KNQNLGVP--------NALKKGSRSRS---------------NSLFQRDSTQSQYIRFTR 137

Query: 180 PIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISS 239
           P+ DL+ +  T DMLF+YH+LE++L + LK+V + T +   H  L+KS+YH FFS AISS
Sbjct: 138 PLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHDLLKKSIYHSFFSLAISS 197

Query: 240 TNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPV 299
           TN LSPYE+FNHPI+SLIA+DI+ G+ YE ARDLL+ FKN N    NFPIFM+TN++LPV
Sbjct: 198 TNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNTENFPIFMNTNEMLPV 257

Query: 300 FVLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYSDD--ITVKLHQPAMSSLD 357
           F++CYN                   QLF E I +PLW + + DD   ++KLHQP MSSL+
Sbjct: 258 FLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESFIDDENSSIKLHQPVMSSLE 317

Query: 358 EMLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGT 417
           E+L+  Q      L L LIN IYD L+ L  DLMIPFM+RK++FWEETILQP+KSLF G 
Sbjct: 318 EILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGA 377

Query: 418 KLFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTF 477
           K F+KFM +       Q N   +D QGNEYF+S+S+ FL+RKLADWSMM+SDFKTAY+T+
Sbjct: 378 KFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKLADWSMMLSDFKTAYSTY 437

Query: 478 ESLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLL 537
           ESL++D++ +PKYLASC+EWCAV +LMGAQ+IVT KMIKND+NPLIER+L  Y  C+ + 
Sbjct: 438 ESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYEKCSQIQ 497

Query: 538 NSIA-ESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGAC 596
                E   S  TEPVRSYETRCM++ SELFLSLSDTWTSTPYA+  LETIL ECKLG C
Sbjct: 498 RHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPC 557

Query: 597 SQIMIWERLSDCYNLRTDPRVKHKL----RSNISTXXXXXXXXXXIKKQDVSSIVLKGLT 652
           SQIMIWERLSDCYNLR DPR+KH++    +S   T                  I+ +GLT
Sbjct: 558 SQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDEHYTDHFIEEDILSEGLT 617

Query: 653 RQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNL 708
           R+RKA+FFRL+AAKKWAEQ  WRQVSWCL DI   Y +  F      I  KLK  L
Sbjct: 618 RRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLHCNDSILSKLKSQL 673

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/708 (52%), Positives = 459/708 (64%), Gaps = 52/708 (7%)

Query: 3   FTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSFYT 62
            +YENYMNL+ HLD   + VP DI+KRIVSNAI+PVI VT+T ELD HI E + +DS Y 
Sbjct: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63

Query: 63  LLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQSDQ 122
           LLR+FG C+              D  ++H        +          D++ E+   S  
Sbjct: 64  LLRFFGDCVG-------------DRDQAHECTSAGSPS---------GDDRAEKSSSSTL 101

Query: 123 NVINPTNDPTVNNNYLDVDTKTDNLLPKXXXXXXXXXXXXXLFQRDSTQSQFIRFTRPIE 182
            V +  +    N+                            LFQRD+TQSQ+IRFTRP+ 
Sbjct: 102 AVASGPSRKRSNS----------------------------LFQRDATQSQYIRFTRPLR 133

Query: 183 DLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISSTNC 242
           DL+ S  T DMLFDYHTLE FL + L ++EK T D   HK L+KSLYHRFFS AISST  
Sbjct: 134 DLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSLYHRFFSLAISSTAY 193

Query: 243 LSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVFVL 302
           LSPYE+FNHP+VSLIA+DI  GQ YE ARDLL  FKN N T  NFP+F++TND+LPVF+L
Sbjct: 194 LSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPVFLNTNDVLPVFLL 253

Query: 303 CYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEMLYV 362
           CYNG                  QLF E I +PLW   Y     V LHQP M+SLDE+LY 
Sbjct: 254 CYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQVILHQPIMTSLDEVLYF 313

Query: 363 FQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLFRK 422
            +     +L L LIN IYD LEIL N LMIPFMQRKI+FWEETILQP++SLF G+K  ++
Sbjct: 314 LREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQPRRSLFHGSKFLKR 373

Query: 423 FMGRP-SMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESLL 481
           FM +  S TN  Q+    KD  G EYF S+S  FL+RKLADWSMM+SD+KTAY+T++SL 
Sbjct: 374 FMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMMLSDYKTAYSTYDSLS 433

Query: 482 EDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNSIA 541
            D+E YPKYLASCLEWC+V +LMGAQNIVT KM+K D++PLI+R+++ Y NCAL    ++
Sbjct: 434 HDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAVETYENCALYDTQLS 493

Query: 542 ESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACSQIMI 601
            S++S    PVRSYETRCM + SELFLSLSDTWTSTPYAL NLETIL+EC+LG CSQIMI
Sbjct: 494 GSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYALRNLETILAECRLGPCSQIMI 553

Query: 602 WERLSDCYNLRTDPRVKHKLRSN-ISTXXXXXXXXXXIKKQDVSSIVLKGLTRQRKASFF 660
           WERLS+CY  R D R++HK+    +S            K+   + IV +GLTR RKA+FF
Sbjct: 554 WERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDDSEKEHTHADIVTRGLTRMRKAAFF 613

Query: 661 RLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNL 708
           +L+AA KWAEQ QWRQ SWCL D  + Y    F  R+ L   KLK  L
Sbjct: 614 QLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKDLALAKLKETL 661

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/733 (52%), Positives = 489/733 (66%), Gaps = 66/733 (9%)

Query: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
           M F+YE+YMNL+FHLD   E+VP +I+KRIVSNAIAPVITVT+T +LD+HI E Y IDS 
Sbjct: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60

Query: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120
           Y LLRYFGGC+SDRDQ+NE + K E                                   
Sbjct: 61  YMLLRYFGGCVSDRDQANELVGKQE----------------------------------- 85

Query: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKXXXXXXXXXXXXXLFQRDSTQSQFIRFTRP 180
             +V +PTN P+   + L V +                     LFQRDSTQSQ+IRFT+P
Sbjct: 86  -LDVTHPTN-PSNPVSSLIVPSGQQQ---PPLKARRGRSRSNSLFQRDSTQSQYIRFTKP 140

Query: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240
           I+D++    + DMLFDYH+LEI+L   L+++   T +   ++ L+ S+YH FFS AISST
Sbjct: 141 IDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTPYELLKNSIYHNFFSLAISST 200

Query: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300
             LSPYE+FNHPIVSLIA+DI+ GQ Y+  RDLL+ FKN NTT  NFPIFM+TND+LP+F
Sbjct: 201 TQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNLNTTTPNFPIFMNTNDMLPIF 260

Query: 301 VLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEML 360
           +LCY+                   QLF E + +PLW+++Y  DI V LHQP MSSL+EM+
Sbjct: 261 LLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQYEIDIKVDLHQPIMSSLEEMI 320

Query: 361 YVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLF 420
           Y  QT  + KL ++LIN IY+ L+ L  DLM+PFM+RK+ FWEETILQP++SLF G K  
Sbjct: 321 YFLQTPFSAKLSISLINSIYNILDSLIYDLMLPFMKRKLLFWEETILQPRRSLFHGAKFL 380

Query: 421 RKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESL 480
           +KFM + +  NG QENI  KD++GNEYFA +S   L+RKLADWSMMISDFKTAY+T+ESL
Sbjct: 381 KKFMTKNN--NGPQENILTKDSEGNEYFAFSSTELLMRKLADWSMMISDFKTAYSTYESL 438

Query: 481 LEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLL--N 538
             D++ +PKYLASCLEWCA  +LMGAQ+IVT KMIKND+NPLIER+L  Y NCA+ L  +
Sbjct: 439 SRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPLIERALQTYENCAITLIQD 498

Query: 539 SIAESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACSQ 598
           +  +       EP+RSYETRCM++ SELFLSLSDTWTSTPYA++ LETIL+ECKLG CSQ
Sbjct: 499 TTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYAITYLETILTECKLGPCSQ 558

Query: 599 IMIWERLSDCYNLRTDPRVKHKLR--------------SNISTXXXXXXXXXXIKKQDVS 644
           I IWERLSDCY LR DPR+++K+                 +              + D+ 
Sbjct: 559 IQIWERLSDCYKLRIDPRIRYKINDTATTTTTVTTTTADKVVATPSTDKPKTIQWESDLE 618

Query: 645 S-------IVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRE 697
           S       I+ KG TR+RK++FFRL+AAKKWAEQ QWRQV+WCL D+  +Y  T  GKR+
Sbjct: 619 SKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAWCLKDMESIYDATDLGKRD 678

Query: 698 SLIYQKLKRNLLE 710
            LI  KL RNLL+
Sbjct: 679 DLIVAKL-RNLLD 690

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/719 (50%), Positives = 474/719 (65%), Gaps = 63/719 (8%)

Query: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
           M F+YE+YMNLI+HLD  +E VP DI+KR+VSNA+APVITVT+TV LD HI E YGIDS 
Sbjct: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60

Query: 61  YTLLRYFGGCISDRDQSNEY------IKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKM 114
           Y LLR+FGGC+SDRDQ+NE       +K TE+  ++       LT   +T+V+ N +   
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNS-- 118

Query: 115 EEELQSDQNVINPTNDPTVNNNYLDVDTKTDNLLPKXXXXXXXXXXXXXLFQRDSTQSQF 174
                                                            L+QRD+TQSQ+
Sbjct: 119 -------------------------------------------------LYQRDATQSQY 129

Query: 175 IRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFS 234
           +RFT+P+ DL+ +    DMLFDYH+LE++L   L +V+K  +  I H  L+ S+YH FF+
Sbjct: 130 VRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLKTSIYHSFFA 189

Query: 235 SAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTN 294
            AISST+ LSP+E FNHPIVSL+AIDIT+ ++YE A + L  FK+ N  I +FP F++TN
Sbjct: 190 LAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIPSFPSFINTN 249

Query: 295 DILPVFVLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYSDDITVKLHQPAMS 354
           DILPVF+LCYN                   QLF E I +PLW   ++D++ V LHQP MS
Sbjct: 250 DILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLVVSLHQPVMS 309

Query: 355 SLDEMLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLF 414
           S++E+++  Q     KLPL L+N IYDQ++++  DLM PFM+RK+TFWEETIL P+KSLF
Sbjct: 310 SIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEETILTPRKSLF 369

Query: 415 QGTKLFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAY 474
            G K F+KFM + S     Q N  +K+N G+ Y +STS  FL+RKLADWSMM+SDFKTAY
Sbjct: 370 HGAKFFKKFMNK-STQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMMVSDFKTAY 428

Query: 475 TTFESLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCA 534
           TT+ESL +D E  PKYLASC EWCAV +LMGAQNIVT KM+KN++NP IER+L  Y  CA
Sbjct: 429 TTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERALGAYELCA 488

Query: 535 LLLNSIAESEESPD-TEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKL 593
              N+  +  +S D + PVRSYETRCM + SELFLSLSDTWTSTP+A++ LETIL+ECKL
Sbjct: 489 TESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLETILNECKL 548

Query: 594 GACSQIMIWERLSDCYNLRTDPRVKHKLRSNISTXXXXXXXXXXIKKQDV---SSIVLKG 650
           G  S+IMIWERLSDCY +R DPR+KH++  N+             K  DV     I+ KG
Sbjct: 549 GPLSEIMIWERLSDCYGMRIDPRIKHRI-GNLELLQKKEENMDDPKNADVFTTEDILSKG 607

Query: 651 LTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNLL 709
           LTR RKA+ F+L+AA+KW EQ QWR++SWCL+D+   Y D     +E+L+Y +L+  L+
Sbjct: 608 LTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKENLLYTRLRNELI 666

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/550 (59%), Positives = 399/550 (72%), Gaps = 12/550 (2%)

Query: 164 LFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKT 223
           LFQRD TQSQ++RFTRPI+DL+ S  + DMLFDYH+LE+FL + L++VE+YT D+   + 
Sbjct: 141 LFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVFLENTLRLVEEYTDDNTPFEL 200

Query: 224 LQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTT 283
           L+KSLYH+FFS AISST  LSPYE+FNHP+VSLIAIDI+ GQ YE ARDLLI FKN N T
Sbjct: 201 LKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISAGQGYEEARDLLIKFKNLNHT 260

Query: 284 INNFPIFMSTNDILPVFVLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYSDD 343
           + NFPIFMST DILPVF+LCYN                   QLF E + +PLW + YSD 
Sbjct: 261 VENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLKKQLFVESLLLPLWKRSYSDH 320

Query: 344 ITVKLHQPAMSSLDEMLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWE 403
             V+LHQP MSSL+EMLY  Q+    +LPL LIN+ Y+ LE L  DLM+PFM+RKI+FWE
Sbjct: 321 GEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNILEKLVKDLMVPFMKRKISFWE 380

Query: 404 ETILQPKKSLFQGTKLFRKFMGRPSMTNGRQENIPI---KDNQGNEYFASTSNVFLLRKL 460
           ETILQP+KSLF G   F+K M + S  NG   + PI   KD  GNEYF ++S  FL+RKL
Sbjct: 381 ETILQPRKSLFHGANFFKKLMSKNS--NGSNNHQPISLGKDKNGNEYFVASSTEFLMRKL 438

Query: 461 ADWSMMISDFKTAYTTFESLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVN 520
           ADWSMM+SDFKTAY+T+ESL+ D+E +PKYLASC EWCAV +LMGAQNIVT KMIKND++
Sbjct: 439 ADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSVLMGAQNIVTVKMIKNDID 498

Query: 521 PLIERSLDVYGNCALLLNSIAESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYA 580
           PLI+R+L+ Y NCA   +S  E        PVRSYETRCM + SELFLSLSDTWTSTPYA
Sbjct: 499 PLIQRALETYENCAADEDSTGEELYV----PVRSYETRCMFLASELFLSLSDTWTSTPYA 554

Query: 581 LSNLETILSECKLGACSQIMIWERLSDCYNLRTDPRVKHKLRSNISTXXXXXXXXXXIKK 640
           L++LETIL+EC+LG CS+IMIWERLSDCY  R DPR++HK  +  +             +
Sbjct: 555 LNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHKTSAQGAKAMTDELAP---DE 611

Query: 641 QDVSSIVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLI 700
           +    IV +GLTR+RKA+FFRL+AA KW EQ QW+Q  WCL +I E Y    F  RE LI
Sbjct: 612 ESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIEEAYAGLDFVNREDLI 671

Query: 701 YQKLKRNLLE 710
             +LKR + E
Sbjct: 672 LARLKRQMNE 681

 Score =  119 bits (299), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 51/80 (63%), Positives = 64/80 (80%)

Query: 1  MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
          M  +YENYMNL+FHLD   E VP DI++RIVSNA++PVITV++T ELD HI + Y +DS 
Sbjct: 1  MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 61 YTLLRYFGGCISDRDQSNEY 80
          Y  LR+FG C+SDRDQ+NEY
Sbjct: 61 YMFLRFFGDCVSDRDQANEY 80

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/815 (45%), Positives = 484/815 (59%), Gaps = 108/815 (13%)

Query: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
           M F+YENYMNL+FHLD+ +E +P DI+KRIV N+IAP+I+VTAT ELD H+ + Y IDS 
Sbjct: 1   MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60

Query: 61  YTLLRYFGGCISDRDQ----SNEYIKKTEDEQKSHAL---------------------NK 95
           Y LLRYFGGCISDRDQ     +++  + + + + HA                      N 
Sbjct: 61  YMLLRYFGGCISDRDQYHEPHHQHPNELDHKNELHAALISPDTSITETPDTSMDMLIDNS 120

Query: 96  VNLTTIEETKVKLNEDEKMEEELQSD--QNVINPTNDPTVNNNYLDVDTKTDNLLPKXXX 153
           +N  T EET +           L S   +N I   ++ T        +  T         
Sbjct: 121 MNTLTKEETIISTTTGTPTPTILASPTTENTITKPHNKTTTIKKNTKEHYTTTHNYTHHH 180

Query: 154 XXXXXXXXXXLFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEK 213
                     LFQRDSTQSQ+IRFT+PI DL+ +    D LFD+ +LE  L   LK++E 
Sbjct: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240

Query: 214 YTTDDIDHKTLQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDL 273
            TT D+ H  L+KSLYHRFFS  ++ST  L P+ESF+HPIVSL++ID+T  QNY+ A+++
Sbjct: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300

Query: 274 LIAFKNQNTTINNFPIFMSTNDILPVFVLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRM 333
           LI FKN ++   NFP++++ NDILPVF+LCY+                   QLF E I +
Sbjct: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360

Query: 334 PLW-DKRYSDDITVKLHQPAMSSLDEMLYVFQ------TSKTD-KLPLTLINLIYDQLEI 385
           PLW DK Y++D  VKLH+P MSS+DE LY  Q      +  TD KLPL+L+  IY+ +  
Sbjct: 361 PLWNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIAN 420

Query: 386 LTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLFRKFMGR---------------PSMT 430
           L+ +L+IPFMQRKI FW+ETILQP+KS+F+  KLF+ FM R                +  
Sbjct: 421 LSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRNSNVSSSTGTSSSEISNSI 479

Query: 431 NGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESLLEDIEMYPKY 490
           +    ++  KD+ G+EYF++ S  F LRKLADWSMM+SDFKTAYTT+ESL  D+E   KY
Sbjct: 480 SKHHHSLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKY 539

Query: 491 LASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVY-------GNCALLLNSI--- 540
           +ASCLEW AV ILMGAQNIVT KM+KNDV+PLIE +L+ Y        N  L  N+I   
Sbjct: 540 MASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINSL 599

Query: 541 -----------AESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILS 589
                      AE     +   +RSYE RCML+ SELFLSLSDTWTSTPYAL  LETILS
Sbjct: 600 NSRSSISSATKAEVSLIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPYALRYLETILS 659

Query: 590 ECKLGACSQIMIWERLSDCYNLRTDPRVKHKLR-SNI---STXXXXXXXXXXIK------ 639
           + KLG CSQ ++WERLS CY+LR DPR+K K   +NI   +           IK      
Sbjct: 660 DYKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKY 719

Query: 640 ----KQ-------------DVSS---------IVLKGLTRQRKASFFRLLAAKKWAEQHQ 673
               KQ             DV+S         I+  G TR+RKA+FF+L+AAKKW+EQ Q
Sbjct: 720 RNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRKAAFFKLIAAKKWSEQKQ 779

Query: 674 WRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNL 708
           WRQ+ WCL DI  +Y++  F  R+ LI  KLK  L
Sbjct: 780 WRQLDWCLKDIENVYKEVGFSDRKDLILIKLKDQL 814

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/552 (56%), Positives = 395/552 (71%), Gaps = 10/552 (1%)

Query: 164 LFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKT 223
           LFQRDSTQSQ+IRFTRP+ DL+      DMLFD+H+LE +L   L++VEK+T D   H+ 
Sbjct: 107 LFQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQL 166

Query: 224 LQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTT 283
           L+KSLYH FFS AISST  LSP+ESFNHPI+SLIA+DIT  Q+YE A+ LLI FKN + T
Sbjct: 167 LKKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNT 226

Query: 284 INNFPIFMSTNDILPVFVLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYSDD 343
           I+ FPI+++T D+LPVF+LCYN                   QLF E I +PLW   Y  +
Sbjct: 227 IDKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTE 286

Query: 344 ITVKLHQPAMSSLDEMLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWE 403
             +KLHQP MSSLDEM+Y  Q+ + + LP+ L N  YD LE L   L+IPFMQRKI FWE
Sbjct: 287 PFIKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWE 346

Query: 404 ETILQPKKSLFQGTKLFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADW 463
           ET+LQPKKS+F G+K  +K M R S ++ +Q+NI  KD+ GNEYFAS+S   LLRKLADW
Sbjct: 347 ETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADW 406

Query: 464 SMMISDFKTAYTTFESLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLI 523
           S+M+SDFKT Y T+E L  D+E++PKYLASCLEW AV +LMGAQNIVT KM+KND++PLI
Sbjct: 407 SIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLI 466

Query: 524 ERSLDVYGNCA----LLLNSIAESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPY 579
           +R+LD Y  CA    L    I  + ES   EPV SYETRC++++SELFLSLSDTWTSTPY
Sbjct: 467 DRALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCLILSSELFLSLSDTWTSTPY 526

Query: 580 ALSNLETILSECKLGACSQIMIWERLSDCYNLRTDPRVKHK---LRSNISTXXXXXXXXX 636
           A++ LE+IL E +LG CS+IMIWERLSDCY+LR DPR+K K   ++   +          
Sbjct: 527 AINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEHR 586

Query: 637 XIKKQD---VSSIVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVF 693
            +  QD    S+IV +GLTR+RKA+FFRLLAAK WAEQ QW+QV WCL++I+++Y     
Sbjct: 587 ILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGL 646

Query: 694 GKRESLIYQKLK 705
             R+ LI  +L+
Sbjct: 647 VNRDDLILTRLR 658

 Score =  119 bits (297), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 51/79 (64%), Positives = 67/79 (84%)

Query: 1  MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
          + F+YE+YMNL+FHL+   EN+P +I++RIVS+AIAPVITVT+T ELD HI + Y IDS 
Sbjct: 2  INFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSL 61

Query: 61 YTLLRYFGGCISDRDQSNE 79
          Y LLR+FGGC+SDRDQ++E
Sbjct: 62 YMLLRFFGGCVSDRDQASE 80

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/605 (46%), Positives = 370/605 (61%), Gaps = 62/605 (10%)

Query: 164 LFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKT 223
           LFQR +  SQF+RFTRP+ D++ +  T D+LFDYH+LE+FL   L++V+  T+ D  H  
Sbjct: 99  LFQRQA--SQFLRFTRPLSDIIGTRETRDLLFDYHSLEVFLQKYLELVDVKTSPDTPHTL 156

Query: 224 LQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTT 283
           LQ S+YH+FF++AISST  LSPYE FNHP+ SL+A+DI++ + YE ARDLL+ FKN +  
Sbjct: 157 LQHSIYHKFFTTAISSTAHLSPYECFNHPVCSLLALDISQNEGYEDARDLLVTFKNMHNK 216

Query: 284 INNFPIFMSTNDILPVFVLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYS-- 341
             +FP F++ NDILPVF+LCY                    QLF E + +P W   ++  
Sbjct: 217 TPHFPSFINVNDILPVFLLCYEEGSREQFETCQSLAKMMKKQLFVESLLLPCWSVNFTAK 276

Query: 342 DDITVKLHQPAMSSLDEMLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITF 401
           D  T  LHQP MSSL+E ++         LPL  I  IYD+L  L ++LMIPFM+RKI+F
Sbjct: 277 DTPTRVLHQPIMSSLEETMFSMLKDSAFDLPLPFIEHIYDRLTKLVDELMIPFMKRKISF 336

Query: 402 WEETILQPKKSLFQGTKLFRKFMGR---PSMTNGRQENIPIKDNQGNEYFASTSNVFLLR 458
           WEE+ILQP++S+F  +K FRK + +   PS  N    +      QG  YFA+TSN  LLR
Sbjct: 337 WEESILQPRRSIFPNSKFFRKLISKAPTPSTNNDSATH----SEQGLAYFAATSNELLLR 392

Query: 459 KLADWSMMISDFKTAYTTFESLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKND 518
           KLADWS M+SDFKTAY+T+E L +D E +P+YLA CLEWCA+ +LMGAQ+IVT KMIKND
Sbjct: 393 KLADWSFMLSDFKTAYSTYELLSKDFEQHPEYLAPCLEWCALSVLMGAQSIVTVKMIKND 452

Query: 519 VNPLIERSLDVYGNCA--------LL---------------LNSIAESEE---------- 545
           ++PLI R+L  Y  CA        LL                 +I+ S +          
Sbjct: 453 IDPLITRALKSYELCASKAKERNGLLKSKLQNRDHDKSLNGFETISNSHDDRVSGTTDFE 512

Query: 546 --SPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACSQIMIWE 603
             S  ++  +SYETRCML+ +ELFLSLSDTWT+TPYA+  LETIL +C +GA S+I+IWE
Sbjct: 513 ISSTPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDQCTVGALSEIVIWE 572

Query: 604 RLSDCYNLRTDPRVKHKL----------------RSNISTXXXXXXXXXXIKKQDVSSIV 647
           RL+ CY LR DPRVK +L                 S  S             K   S I 
Sbjct: 573 RLAYCYALRVDPRVKSRLTASEIQSSDQNEKLDEESEGSDNDSGDESQVCQHKMSQSCIA 632

Query: 648 LKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRN 707
             GLTR+RKA+ FRL+A KKW E  QWRQ  W   D+  MY   VF  RE LI +KL++ 
Sbjct: 633 SSGLTRKRKATLFRLIATKKWTESKQWRQACWSFQDLEVMYSHLVFANREDLILKKLEKR 692

Query: 708 LLENS 712
           + ++S
Sbjct: 693 IAQHS 697

 Score =  115 bits (288), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 68/95 (71%)

Query: 1  MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
          M  +YE YMNL+ HLD   E VP +IS++IVSNA++PV+TVT++  LD HI E YG+DS 
Sbjct: 1  MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 61 YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNK 95
          Y LLRYFG CISDRDQ++   +   +  KS A ++
Sbjct: 61 YMLLRYFGDCISDRDQADSEQESGVEPNKSRARSR 95

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  533 bits (1372), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 284/599 (47%), Positives = 370/599 (61%), Gaps = 54/599 (9%)

Query: 164 LFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKT 223
           LFQR +  S ++RFTRP+ DL+    + D+LFDYH+LE+FL   L +VE  TT D  H  
Sbjct: 99  LFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTL 156

Query: 224 LQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTT 283
           LQ S+YH+FF++AISST  LSPYESFNHP+ SL+A+DI+K Q YE ARDLLIAFKN + T
Sbjct: 157 LQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNT 216

Query: 284 INNFPIFMSTNDILPVFVLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYSDD 343
             +FP F++ NDILPVF+LCY                    QLF E + +P W +  +  
Sbjct: 217 TPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAG 276

Query: 344 ITVK--LHQPAMSSLDEMLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITF 401
            +    LHQP MSSL+E +Y      T  LPL+LIN IYD+L  L ++LMIPFM+RKI+F
Sbjct: 277 ASPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISF 336

Query: 402 WEETILQPKKSLFQGTKLFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLA 461
           W+E+ILQP+KS+F  +K FRK + +        ++      QG  YFA+TSN F+LRKLA
Sbjct: 337 WDESILQPRKSIFPNSKFFRKLISKTPAPPPASDSA-THSQQGVAYFAATSNEFILRKLA 395

Query: 462 DWSMMISDFKTAYTTFESLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNP 521
           DWS M+SDFK AY+T+E L +D E  P+YLASCLEWCA+ +LMGAQ+IVT KMIKND++P
Sbjct: 396 DWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDP 455

Query: 522 LIERSLDVY---------GNCALLLNSIAESEES-------PDT-----------EPV-- 552
           LI R+L  Y          N  L  +++A+  E        P T           E V  
Sbjct: 456 LINRALKSYELSARKAKEKNAQLKSSALAKKAEKDSKSATLPSTVSDEHSGQELDEGVSS 515

Query: 553 ------RSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACSQIMIWERLS 606
                 +SYETRCML+ +ELFLSLSDTWT+TPYA+  LETIL EC LG+ S+I++WERL+
Sbjct: 516 APSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERLA 575

Query: 607 DCYNLRTDPRVKHKLRSNISTXXXXXXXXXXIKKQDVSS--------------IVLKGLT 652
            CY LR DPRVK KL S               +  D S               +   GL 
Sbjct: 576 YCYALRVDPRVKGKLPSLDGQSGQNEKRGEESEGSDESDDETQKYDHKISQNCMASLGLA 635

Query: 653 RQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNLLEN 711
           R+RK++ FRL+A KKW E  QWRQ  W L DI  +Y +  F  R+ LI +KL++ + E+
Sbjct: 636 RRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIHEH 694

 Score =  109 bits (273), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 46/77 (59%), Positives = 59/77 (76%)

Query: 1  MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
          M  ++  YMNL FHLD   E VP +IS++IVS+A++PV+TVT+T  LD HI E YG+DS 
Sbjct: 1  MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 61 YTLLRYFGGCISDRDQS 77
          Y LLRYFG C+SDRDQ+
Sbjct: 61 YMLLRYFGDCVSDRDQA 77

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  526 bits (1356), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 281/619 (45%), Positives = 373/619 (60%), Gaps = 82/619 (13%)

Query: 164 LFQRDSTQSQFIRFTRPIEDLL-YSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHK 222
           LFQR+S  S F+RFTRP+ DL+        MLFDYH+LE+FL   L++V+   + +  H+
Sbjct: 95  LFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHR 152

Query: 223 TLQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNT 282
            L+ S+YH+FF++AISST  LSPYESFNHP++SL+A+DI++G  YE ARDLLI FKN N+
Sbjct: 153 LLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNS 212

Query: 283 ---TINNFPIFMSTNDILPVFVLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKR 339
              +  +FP F++ NDILPVF+LCYN                   QLF E I +PLW  R
Sbjct: 213 ATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLW--R 270

Query: 340 YSDDITVK-----LHQPAMSSLDEMLYVFQTSKTDK----------------LPLTLINL 378
            S+D   +     LH P MSSL+EMLY        K                LPL L+  
Sbjct: 271 DSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVET 330

Query: 379 IYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLFRKFMGR--PSMTNGRQEN 436
           IYD+L +L  +LMIPFM+RKI+FWEETILQP+KS+F   K  R+F+ +  P+       +
Sbjct: 331 IYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPINS 390

Query: 437 IPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESLLEDIEMYPKYLASCLE 496
                 Q + +F ++SN FLLRKLADWS M+SD++TAY T+++L +D+E + +YLA CLE
Sbjct: 391 KSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLE 450

Query: 497 WCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNS--IAESEESPDTEPVRS 554
           WCAV +LMGAQ+IVT KMIKND++PLI +SL  Y  CA  L S  +AE++   D++P +S
Sbjct: 451 WCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQS 510

Query: 555 YETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACSQIMIWERLSDCYNLRTD 614
           YETRCML+++ELFLSLSDTWT+TPYA+  LETIL  C LG  SQ+++WE+L+ CY LR D
Sbjct: 511 YETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVD 570

Query: 615 PRV--------------------------KHKLRSNISTXXXXXXXXXXIKKQD------ 642
           PRV                          +H   S+ ST              D      
Sbjct: 571 PRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEAL 630

Query: 643 -----------------VSSIVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDIS 685
                               I L GLTR+RKA+FFRL+AA KW EQ QW+Q SW L D+ 
Sbjct: 631 SNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVD 690

Query: 686 EMYQDTVFGKRESLIYQKL 704
            +Y   VF  R+ LI ++L
Sbjct: 691 TVYSGLVFSYRKGLILERL 709

 Score =  104 bits (259), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 45/81 (55%), Positives = 63/81 (77%), Gaps = 2/81 (2%)

Query: 1  MTFTYENYMNLIFHLDKVHENVP--QDISKRIVSNAIAPVITVTATVELDSHISEEYGID 58
          MT +YENYMNL++H+D   E+V    +++K+IVSNA++PV+ VT+T  LDSH+ E YG+ 
Sbjct: 1  MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 59 SFYTLLRYFGGCISDRDQSNE 79
          S Y LLR+FG C++DRDQ NE
Sbjct: 61 SMYMLLRFFGDCVTDRDQENE 81

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  498 bits (1281), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 256/578 (44%), Positives = 357/578 (61%), Gaps = 74/578 (12%)

Query: 164 LFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDD----- 218
           LFQRD+TQSQFIRF +P+ DLL S      LFD  +LE +L   L  ++K T  D     
Sbjct: 99  LFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVE 158

Query: 219 -----------------IDHKTLQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDI 261
                            + HK L+ ++YH FF+ A+SST  +SP+E+FN P+++LIAID+
Sbjct: 159 QLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDV 218

Query: 262 TKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVFVLCYNGXXXXXXXXXXXXXXX 321
           ++GQ+YE+ RDL+  FKN N  + +FP+F++ NDILP+ VLCY+                
Sbjct: 219 SRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRK 278

Query: 322 XXXQLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEMLYVFQTSKTD------------ 369
               LF + I + LWD+     + V LH+P MSSLDE++  + ++ +             
Sbjct: 279 IKKCLFVDSIPLALWDEDPESPL-VPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSR 337

Query: 370 -KLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTK-LFRKFMGRP 427
             LPL +I  +Y  L++L ++++IPFM RK  +WEE ILQP+KS+F G+   F+KF+G+ 
Sbjct: 338 AALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKT 397

Query: 428 SMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESLLEDIEMY 487
           +           +D    ++F ++S   LLRKLADWS+M+SDFKTAY T++SL  D++  
Sbjct: 398 TTQ---------RDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNS 448

Query: 488 PKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNSIAESEESP 547
           P YLASCLEWCAV +L+GAQNIVT KMIK ++ PLIER++  Y                 
Sbjct: 449 PNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYRQ--------------- 493

Query: 548 DTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSEC-KLGACSQIMIWERLS 606
             +   SYETRCM++++ELFL+L DTWTSTPYA+  LETIL +C +LGACSQ+MIWERLS
Sbjct: 494 --QGRSSYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWERLS 551

Query: 607 DCYNLRTDPRVKHKLRSNISTXXXXXXXXXXIKKQDVSSIVLKGLTRQRKASFFRLLAAK 666
           DCY  RTDPRV   L +N S              Q  + I+ +G TR+RKA+FFRL+AAK
Sbjct: 552 DCYQSRTDPRVASALSTNTSPG----------SAQPGNEILAQGFTRKRKAAFFRLIAAK 601

Query: 667 KWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKL 704
           KWAEQ QWRQV WCL+DI ++Y  +    ++ L+  +L
Sbjct: 602 KWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRL 639

 Score =  107 bits (267), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%)

Query: 1  MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
          M F+YE+YMNL+ HL+   E VP DI++RIVS+A+APVITVT+++ LD HI E Y + S 
Sbjct: 1  MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 61 YTLLRYFGGCISDRDQSNEY 80
          Y L R FGGCISDRDQ  E+
Sbjct: 61 YLLFRLFGGCISDRDQLMEH 80

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  397 bits (1021), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 228/557 (40%), Positives = 331/557 (59%), Gaps = 37/557 (6%)

Query: 164 LFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKT 223
           LFQR+S  S++IRF  P+ D++  G    +  +++ LE  L   LK +E++T +D   + 
Sbjct: 96  LFQRNS--SRYIRFQTPLTDIISVGDNHQV--EFNDLEESLSEFLKDIEEHTVNDSPCEL 151

Query: 224 LQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTT 283
           L+ S++H+F +   S+T  LSPY SFNHPI++L+A+DIT+G+ YELAR+LL+ FKN   T
Sbjct: 152 LKHSIFHKFITMLSSTT--LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNT 209

Query: 284 INNFPIFMSTNDILPVFVLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYSDD 343
           ++ FP F++TND+LPVF+LC++                   QLF E + +P++      D
Sbjct: 210 LSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFTN--FRD 267

Query: 344 ITVKLHQPAMSSLDEMLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWE 403
            ++ LH P  +SL E LY      + KL   L+ LIYD +  +  DLMIPFM RKI+FW+
Sbjct: 268 RSIVLHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWD 327

Query: 404 ETILQPKKSLFQGTKLFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADW 463
           ETILQP+KS+F   KL ++F+ + S       ++P      + +F ++SN FLLRKLADW
Sbjct: 328 ETILQPRKSIFHSNKLLKRFISKSS--GSPTASMP---TSPDGHFLASSNEFLLRKLADW 382

Query: 464 SMMISDFKTAYTTFESLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLI 523
             M+SD+KTAY+ +E L+ D E YP Y++SC E+ A+ +LMGA +IVT KMIKND++PLI
Sbjct: 383 CFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLI 442

Query: 524 ERSLDVYGNCALLLNSIAESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSN 583
            + LD   N  + L+ I                 RCM+  +ELFLSLSDTWTS P+A+  
Sbjct: 443 MKYLDYAVNNIISLDQI-----------------RCMIYMTELFLSLSDTWTSAPFAIKY 485

Query: 584 LETILSE--CKLGACSQIMIWERLSDCYNLRTDPRVKHKLRSNISTXXXXXXXXXXI--K 639
           LE IL +   KLG   + +IWER+S  Y LR DPR+ H    + S           +   
Sbjct: 486 LEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRI-HADDDSTSDCDHDLEEELYLNPH 544

Query: 640 KQDVSSIVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESL 699
           K     I  +G TR RK + F+LLAAKKW +  Q RQ +W L   + +Y+D  F   E  
Sbjct: 545 KLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGT 604

Query: 700 IYQKLKRNLL--ENSKK 714
           +  +L   ++  ENS++
Sbjct: 605 LLSRLADAVVDSENSQR 621

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 55/79 (69%)

Query: 3  FTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSFYT 62
           +YE YMNL+ + D+  + VP++IS++++ NA++P I+V +T  L+ H+ E + I S Y 
Sbjct: 2  LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61

Query: 63 LLRYFGGCISDRDQSNEYI 81
          LLRYFG  I DRDQ ++ I
Sbjct: 62 LLRYFGDYIQDRDQLDDKI 80

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  392 bits (1008), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 216/546 (39%), Positives = 321/546 (58%), Gaps = 35/546 (6%)

Query: 164 LFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKT 223
           ++QR +  S+++RF RP+E+++ +        D+  LE  LG  L+ +E  TT++   + 
Sbjct: 89  VYQRQT--SRYVRFQRPLEEVIET--VEQQAVDFEDLEEALGQHLRDIEARTTNESPSEL 144

Query: 224 LQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTT 283
           L+ S++H+F +  + S+  LSPY + NHPI++L+A+D+T+G+ Y LAR+LL+ FKN  + 
Sbjct: 145 LKHSIFHKFIT--MLSSTALSPYHTVNHPIMALLALDVTQGEEYTLARELLVQFKNLPSK 202

Query: 284 INNFPIFMSTNDILPVFVLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYSDD 343
            + FP +++TND+LPVF+LC++                   QLF E + +P++    SD 
Sbjct: 203 SSKFPSYINTNDVLPVFILCFDESSSEQWETVQALQKAIKKQLFVESVPLPIFTNYESDP 262

Query: 344 ITVKLHQPAMSSLDEMLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWE 403
           +   LH P  +SL E +Y        +L   L+++IY+ +  +  DLMIPFM RKI+FW+
Sbjct: 263 VV--LHPPITNSLQEQVYDGSHPPLLRLCPQLVDVIYETINAMVEDLMIPFMNRKISFWD 320

Query: 404 ETILQPKKSLFQGTKLFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADW 463
           ETILQP+KS+F G K  ++FM +   TN          + G  YF ++SN FLLRKLADW
Sbjct: 321 ETILQPRKSIFHGNKFLKRFMNK---TNSSAAGTLSTSSDG--YFLASSNEFLLRKLADW 375

Query: 464 SMMISDFKTAYTTFESLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLI 523
           S M+SD+KTAY+ +  LL D E+YP+YL+SC E+ A+ +LMGA +IVTTKMIKND++PLI
Sbjct: 376 SFMLSDYKTAYSIYYILLRDFELYPQYLSSCQEFSALSLLMGAHSIVTTKMIKNDIDPLI 435

Query: 524 ERSLDVYGNCALLLNSIAESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSN 583
            + +D   +    LN +               + RC++  +ELFLSLSDTWTS P+A+  
Sbjct: 436 MKYMD---STVASLNYLG--------------KFRCLVYMAELFLSLSDTWTSAPFAIKY 478

Query: 584 LETILS--ECKLGACSQIMIWERLSDCYNLRTDPRVK---HKLRSNISTXXXXXXXXXXI 638
           LE IL   + KLG  S+ M+WER+S  Y LR DPR+      L  N              
Sbjct: 479 LELILQNEQLKLGPLSRTMLWERISYAYQLRIDPRIHTDDEYLSDNFMELTTEDDFCMNP 538

Query: 639 KKQDVSSIVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRES 698
            K     I   GLTR RK + FRLLAAKKW E    RQ +W L   +++Y++  F   + 
Sbjct: 539 NKLHHWRIHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQGAWSLKGCNKVYRNLGFANADG 598

Query: 699 LIYQKL 704
            +  +L
Sbjct: 599 TLLSRL 604

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 50/74 (67%)

Query: 3  FTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSFYT 62
           +YE YMNL+ + +   + VP +IS+R++ NA++P ++V +T  L++H++EE+   S Y 
Sbjct: 2  LSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLYM 61

Query: 63 LLRYFGGCISDRDQ 76
          LLRYF   + +R +
Sbjct: 62 LLRYFADYVRERGE 75

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  353 bits (906), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 209/567 (36%), Positives = 312/567 (55%), Gaps = 43/567 (7%)

Query: 164 LFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDD-IDHK 222
           LFQR +  S+ +RFTR +EDL+ S  + D +     ++ FL   L+ +E    ++    K
Sbjct: 101 LFQRQA--SECVRFTRSLEDLI-SIDSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSK 157

Query: 223 TLQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNT 282
            L+ S+YHRFF + +SS N LS Y SF+HP+V+L+ +DITKGQ YE AR++LI FKN N 
Sbjct: 158 LLKHSIYHRFFIT-LSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNN 215

Query: 283 TINNFPIFMSTNDILPVFVLCYNGXXXXXXXXXXXXXXXXXXQLFAECIRMPLWDKRYSD 342
           T+ NFP F++ NDILPVFVLCY+                   QLF E + + L+   + +
Sbjct: 216 TLENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTP-HDN 274

Query: 343 DITVKLHQPAMSSLDEMLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFW 402
             +  LH P   SL E ++      +  +P  L+  IYD +  +  ++MIPFM RK+ FW
Sbjct: 275 QKSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFW 334

Query: 403 EETILQPKKSLFQGTKLFRKFMG-RPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLA 461
           +ET+LQP+KS+FQ  K FR+F+  + +     + N P    +G+  F ++S  FLLRKLA
Sbjct: 335 DETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLA 394

Query: 462 DWSMMISDFKTAYTTFESLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNP 521
           DWS M+SDFK AY+ ++ L +D E YP+YLA CLE+  + +LMGAQNI+T K IK +V+P
Sbjct: 395 DWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDP 454

Query: 522 LIERSLDVYGNCALLLNSIAESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYAL 581
           L+ R+++ Y             ++  +   +R     C+L  S+L LSLSDTW S+P A+
Sbjct: 455 LMTRAIEQY-------------KKQDEKHSLRV--IHCILTFSDLLLSLSDTWVSSPLAV 499

Query: 582 SNLETILSECKLGACSQIMIWERLSDCYNLRTDPRVK-HKLRSNISTXXXXXXXXXXIKK 640
           + L  I     LG  + ++I ER++  Y +  D RV  H L                  K
Sbjct: 500 NYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAENSK 559

Query: 641 QDVSSIVL-------------------KGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCL 681
           +  + + +                   +GLTR RK S ++L+AAKKW E H+  Q  WC+
Sbjct: 560 KGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCI 619

Query: 682 NDISEMYQDTVFGKRESLIYQKLKRNL 708
              +  Y+     KR   ++ +L   L
Sbjct: 620 YHAAPAYEKLSLSKRPDGLFHRLSMEL 646

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 50/76 (65%)

Query: 1  MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60
          + F+YE YMNLI + +     +P +ISK+++ N ++P I V + +ELD+H+ + Y IDS 
Sbjct: 3  LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62

Query: 61 YTLLRYFGGCISDRDQ 76
            L RYFG  I DRDQ
Sbjct: 63 SMLFRYFGDYIQDRDQ 78

>TBLA0I00580 Chr9 complement(102907..104451) [1545 bp, 514 aa] {ON}
           Anc_3.6 YOL144W
          Length = 514

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 43/95 (45%), Gaps = 8/95 (8%)

Query: 48  DSHISEEYGIDSFYTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEE--TK 105
           D  I+EEYG  S Y L   FG   SDR+ SN+ + K+ D+ K     + +    E+  ++
Sbjct: 277 DEAINEEYGA-SDYELEHQFGDSDSDREVSNKNLNKSLDKPKEKKNGETSYNNYEDKTSR 335

Query: 106 VKLNEDEKMEEELQSDQNVINPTNDPTVNNNYLDV 140
            K N +E   E    D+  I     PT  N   D 
Sbjct: 336 HKKNTEEDSYEGEDEDKEFI-----PTFGNKQADT 365

>CAGL0C04499g Chr3 complement(432406..433236) [831 bp, 276 aa] {ON}
           highly similar to uniprot|P35182 Saccharomyces
           cerevisiae YDL006w PTC1
          Length = 276

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%)

Query: 477 FESLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSL 527
           F   +ED+  Y K  AS L+W    I  G   I  +K   ++++ +IE  L
Sbjct: 25  FRRTMEDVHTYVKNFASRLDWGYFAIFDGHAGIQASKWCGSNLHTIIENKL 75

>CAGL0H09086g Chr8 complement(887366..888061) [696 bp, 231 aa] {ON}
           some similarities with uniprot|P38833 Saccharomyces
           cerevisiae YHR127w HSN1
          Length = 231

 Score = 32.0 bits (71), Expect = 4.9,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 42/91 (46%), Gaps = 11/91 (12%)

Query: 58  DSFYTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEE 117
           D    LLR  G    D  +    +KK+    K++++ KV       TK K     K +++
Sbjct: 59  DDIGVLLRAAGNSPRDVVKGKREVKKSIRSAKANSV-KV------PTKPK-QSTSKAQKK 110

Query: 118 LQSDQNVINPTNDPTV---NNNYLDVDTKTD 145
           ++S  NVI PTN PT      N L + T TD
Sbjct: 111 MKSKPNVITPTNIPTFPVGTGNTLVISTNTD 141

>KNAG0I00640 Chr9 (109522..112932) [3411 bp, 1136 aa] {ON} Anc_2.316
           YGL151W
          Length = 1136

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 5/86 (5%)

Query: 396 QRKITFWEETILQPKKSLFQGTKLFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVF 455
           Q   + +  +I  P+   F  + LF   M  PS+ N +   +     +  + F    N++
Sbjct: 236 QEPSSIYSPSITSPQ---FISSPLFS--MKTPSLPNNKDGTVSTMKYKDMKLFRYYKNIW 290

Query: 456 LLRKLADWSMMISDFKTAYTTFESLL 481
           L  K+ +W M+ S+F + Y +  S L
Sbjct: 291 LNNKIMNWEMIGSEFLSKYNSISSTL 316

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,608,850
Number of extensions: 3269749
Number of successful extensions: 15633
Number of sequences better than 10.0: 88
Number of HSP's gapped: 16165
Number of HSP's successfully gapped: 111
Length of query: 714
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 597
Effective length of database: 40,065,477
Effective search space: 23919089769
Effective search space used: 23919089769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)