Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0B032508.256ON1215121555600.0
Kpol_392.108.256ON1226119620730.0
ZYRO0C01804g8.256ON1209119020070.0
Smik_12.1438.256ON1220119420060.0
SAKL0H17204g8.256ON1211120419810.0
Skud_12.1528.256ON1220119319400.0
Suva_10.1688.256ON1220119319370.0
YLR084C (RAX2)8.256ON1220119319020.0
NCAS0B049808.256ON1204119918870.0
TDEL0F038308.256ON1195118818830.0
NDAI0B023808.256ON1219119618800.0
KAFR0B026908.256ON1210120617530.0
KNAG0G020008.256ON1202121016260.0
TBLA0E043908.256ON1278111815890.0
KLTH0G13838g8.256ON1214120415620.0
KLLA0F18975g8.256ON1200120415590.0
Ecym_43158.256ON1212121415210.0
AGR095W8.256ON1201122114720.0
Kwal_56.235898.256ON1213122414441e-178
CAGL0L12144g8.256ON1156110913881e-171
YDR141C (DOP1)8.313ON169859745.8
TBLA0G004806.54ON531113736.7
KLLA0A04169g8.423ON77590737.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0B03250
         (1215 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....  2146   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   803   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   777   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   777   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   767   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   751   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   750   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   737   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   731   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   729   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   728   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   679   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   630   0.0  
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   616   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   606   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   605   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   590   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   571   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   560   e-178
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   539   e-171
YDR141C Chr4 complement(734901..739997) [5097 bp, 1698 aa] {ON} ...    33   5.8  
TBLA0G00480 Chr7 (97343..98938) [1596 bp, 531 aa] {ON} Anc_6.54 ...    33   6.7  
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    33   7.3  

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score = 2146 bits (5560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1085/1215 (89%), Positives = 1085/1215 (89%)

Query: 1    MSIISTIVRLVVXXXXXXXXXXXXXXXXXXXXXXQEFELPNLNFNNTSNSIQLLGDVENL 60
            MSIISTIVRLVV                      QEFELPNLNFNNTSNSIQLLGDVENL
Sbjct: 1    MSIISTIVRLVVLFSLANNATASSLSNILKLLNIQEFELPNLNFNNTSNSIQLLGDVENL 60

Query: 61   QFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSG 120
            QFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSG
Sbjct: 61   QFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSG 120

Query: 121  SGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSS 180
            SGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSS
Sbjct: 121  SGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSS 180

Query: 181  VISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLGXXXXXXXXXXXXXX 240
            VISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLG              
Sbjct: 181  VISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFS 240

Query: 241  XXXXXXXXXXXIQLEQQISLKYATWDAGTAYFDQNNFVCEAGSSEAWIVEGRSGNLQLNF 300
                       IQLEQQISLKYATWDAGTAYFDQNNFVCEAGSSEAWIVEGRSGNLQLNF
Sbjct: 241  NFTNSTENSSTIQLEQQISLKYATWDAGTAYFDQNNFVCEAGSSEAWIVEGRSGNLQLNF 300

Query: 301  PNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSS 360
            PNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSS
Sbjct: 301  PNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSS 360

Query: 361  GLETASSNSTSETRQRVFINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTAL 420
            GLETASSNSTSETRQRVFINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTAL
Sbjct: 361  GLETASSNSTSETRQRVFINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTAL 420

Query: 421  SGIELFQDSHTAYANNTLNQPGCDTEXXXXXXXXXXXDNGWYKGLDSDSYIAANYQSDSS 480
            SGIELFQDSHTAYANNTLNQPGCDTE           DNGWYKGLDSDSYIAANYQSDSS
Sbjct: 421  SGIELFQDSHTAYANNTLNQPGCDTESTSLFSSSVLSDNGWYKGLDSDSYIAANYQSDSS 480

Query: 481  PLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNN 540
            PLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNN
Sbjct: 481  PLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNN 540

Query: 541  NEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLK 600
            NEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLK
Sbjct: 541  NEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLK 600

Query: 601  STSLKLNGLFQYQLSNFTSDTKTKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTS 660
            STSLKLNGLFQYQLSNFTSDTKTKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTS
Sbjct: 601  STSLKLNGLFQYQLSNFTSDTKTKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTS 660

Query: 661  NIVQLQLNSDLELRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSS 720
            NIVQLQLNSDLELRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSS
Sbjct: 661  NIVQLQLNSDLELRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSS 720

Query: 721  FSQLGDNVTTFANFTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTL 780
            FSQLGDNVTTFANFTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTL
Sbjct: 721  FSQLGDNVTTFANFTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTL 780

Query: 781  LLGNIVRSEYSNFNEPLKLYGNXXXXXXXXXXXIVPYAAVFLNDTANLYAYKDGENSKII 840
            LLGNIVRSEYSNFNEPLKLYGN           IVPYAAVFLNDTANLYAYKDGENSKII
Sbjct: 781  LLGNIVRSEYSNFNEPLKLYGNSSLESLTFSSSIVPYAAVFLNDTANLYAYKDGENSKII 840

Query: 841  YGNNMTTSLDFSGTXXXXXXXXXXXXXXXXXITNNGSSSLVISNISDGMSLASENLNNYG 900
            YGNNMTTSLDFSGT                 ITNNGSSSLVISNISDGMSLASENLNNYG
Sbjct: 841  YGNNMTTSLDFSGTLNKLSFSNNSSLLFANAITNNGSSSLVISNISDGMSLASENLNNYG 900

Query: 901  YITSMIDFNSNNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNS 960
            YITSMIDFNSNNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNS
Sbjct: 901  YITSMIDFNSNNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNS 960

Query: 961  DQILISGLFSAQNYSSITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIME 1020
            DQILISGLFSAQNYSSITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIME
Sbjct: 961  DQILISGLFSAQNYSSITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIME 1020

Query: 1021 YKSEKWNEISFPNTTSKYIESVEAVSIDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFR 1080
            YKSEKWNEISFPNTTSKYIESVEAVSIDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFR
Sbjct: 1021 YKSEKWNEISFPNTTSKYIESVEAVSIDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFR 1080

Query: 1081 AGDWKPYFSINNFQVNEDPAITLFENRDLSSLFNSKNSLPANIXXXXXXXXXXXXXXXXX 1140
            AGDWKPYFSINNFQVNEDPAITLFENRDLSSLFNSKNSLPANI                 
Sbjct: 1081 AGDWKPYFSINNFQVNEDPAITLFENRDLSSLFNSKNSLPANITSAETSSRSTVSSATAT 1140

Query: 1141 XXXNKIEGKHSKIDRXXXXXXXXXXXXXXXXXXXXXXXXIAYIFRDEQKYESIKPRIDGQ 1200
               NKIEGKHSKIDR                        IAYIFRDEQKYESIKPRIDGQ
Sbjct: 1141 TVVNKIEGKHSKIDRGFVVLIALALAVGTVALLGLFGVTIAYIFRDEQKYESIKPRIDGQ 1200

Query: 1201 EMLDTVPPEKLMKFI 1215
            EMLDTVPPEKLMKFI
Sbjct: 1201 EMLDTVPPEKLMKFI 1215

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1196 (39%), Positives = 693/1196 (57%), Gaps = 24/1196 (2%)

Query: 39   LPNLNFNNTSNSIQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLEV 98
            +P +NF NT+N IQ+L ++E L FY Y+GQQNFT   ++  S+T+ LIYYS+D LI+L  
Sbjct: 36   IPQINFGNTNNEIQILSNIEGLTFYQYQGQQNFTGSIDTN-SNTHGLIYYSNDTLIKLLE 94

Query: 99   GSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSILV 158
            GS++T I +I+P+ +D+F+LSGSG L G+ L  QLLYNL+ LSI P+F+  L NI SILV
Sbjct: 95   GSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILV 154

Query: 159  DEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNILF 218
            D++IVYFGG F+Y + ++ ++S+ISWN  +  V  LPF GFG +S VNSILKL++DN+LF
Sbjct: 155  DKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLF 214

Query: 219  VGMFDTLG-XXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDAGTAYFDQNNF 277
             G F TL                           ++LEQQISLKYA+W +         F
Sbjct: 215  FGDFSTLDDKSLLVSNITTYTQQNSTSSSSTETNLELEQQISLKYASWASLGDLKSSTQF 274

Query: 278  VCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMNL 337
            +C  G +EAW   G +G +  N     S SKIRI+N+   +D ++ FRIVT+PSNGIMNL
Sbjct: 275  ICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNL 334

Query: 338  TYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEFAF 397
            TY+DPLT ++KYCDAFCPL +S+ L+ +S N+T+      FIN N T++ WS  YQEFAF
Sbjct: 335  TYLDPLTSEVKYCDAFCPLYSSNALQASSENATTSASTSAFINGNKTNIGWSTDYQEFAF 394

Query: 398  INNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXXXXXXXXXX 457
            +N + V+AL +IA  SYG    LSG +L+Q+S++ +ANN+LN+P CD+            
Sbjct: 395  VNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFANNSLNEPACDSP-NTVIPSSYLS 453

Query: 458  DNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESRSI 517
            +N WY+GL+S SYIA  Y     P P V FYP+I  +G++++ +YTPGC  DGTC  R I
Sbjct: 454  NNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGI 513

Query: 518  VNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAIIV 577
            VNVT+ D     ++ST LIYQNNNEMKYD++F G L  +P++TL +YS I  +    ++V
Sbjct: 514  VNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFLDYAPKVTLEYYSGINDENSPVVVV 573

Query: 578  ADRVDLTPTYINVDDIL--LDSNLKSTSLKLNGLFQYQLSNFTSDTKT---KVGNNSIHQ 632
            AD VDL P  I +D+ +  + S+ +   + LNG+FQYQLSNFTS       KV N S++ 
Sbjct: 574  ADNVDLVPINIELDETIGNVTSSTEELKVPLNGMFQYQLSNFTSSNNNSTLKVDNTSLNL 633

Query: 633  LALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETTRIENYS 692
              +S+F SSVSL G  +N ++ L GS + +  L L++   +R+T +V+ GGE T    Y+
Sbjct: 634  FPVSRFSSSVSLYGVEYNETLLLGGSIAGVYALSLSNYTNIRSTRIVETGGEVTGTGAYA 693

Query: 693  QGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANFTYEGSELLFFNNDYLYNV 752
             G++ FG +NIS+  +V +LS+NGTF SF  +  N+ TF+N T+  SE+L FNN+Y +N 
Sbjct: 694  GGVVLFGNFNISN-RIVSSLSYNGTFDSFGNVNSNIATFSNLTFGESEILAFNNEYFFNT 752

Query: 753  SSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLYGNXXXXXXXXXX 812
            S+ SYI+N +  + S+ + G+N   DTL  G I R+E+ N N    L GN          
Sbjct: 753  STSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITRNEFPNLNNSAVLTGNGTAQSLQLRN 812

Query: 813  XIVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGTXXXXXXXXXXXXXXXXXI 872
             I PY  V+LND+   Y Y    NS I++ N +  + +   +                 +
Sbjct: 813  GIQPYLGVYLNDSLTAYLYDSSSNSNILFSNGLQGNWNLPRSVSSAYYSDNETMFVGSSL 872

Query: 873  TNNGSSS-LVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSGNFTLDDVDCHGIC 931
            +N  S + L + N +    L +E  +    I S++ F  N+++LV G+FT  + +C  +C
Sbjct: 873  SNGDSGAELFVLNFTTMDLLYNETFDVNSSINSIVSFGRNSSLLVGGDFTAPNTNCSNLC 932

Query: 932  LYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSITLASLDIKGYNISV 991
            L N    +WS+F+N    G+I  ++  N  ++LISG +  +N S I+L  +D+       
Sbjct: 933  LLNLGNNQWSSFSNK-FDGTITGLEFANDSRLLISGSYRFENQSGISLGYIDLNNQEFKS 991

Query: 992  LSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPNT-TSKYIESVEAVS---- 1046
            L  DS+ +++SF ++  +I  W + TI  Y+ + W+    PNT +S  I++V+ VS    
Sbjct: 992  LLSDSQ-KVNSFNYNNGTIVAWDSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKLNN 1050

Query: 1047 --IDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSINNFQVNEDPAITLF 1104
                   S +   +++  +GE  S  YG + AM +   +W PY+    +        +LF
Sbjct: 1051 SLSTNNTSNNLNDELILVFGELYSEDYGFVQAMFYDFQNWIPYYITQPYSSLNTSKNSLF 1110

Query: 1105 ENRDLSSLFNSKNSL--PANIXXXXXXXXXXXXXXXXXXXXNKIEGKH--SKIDRXXXXX 1160
             N+D+S L+ S+  L  P +                       ++  +  SKI R     
Sbjct: 1111 MNKDISLLYESQVVLQNPNSTISISSTSSSSATTRSSSTSSTSLKNGNIESKIHRGYVVL 1170

Query: 1161 XXXXXXXXXXXXXXXXXXXIAYIFRDEQ-KYESIKPRIDGQEMLDTVPPEKLMKFI 1215
                               +AYIF D++ +Y  IKPRID  EMLDTVPPEKLMKFI
Sbjct: 1171 IGLALAIGTVAILGIFGVTMAYIFSDDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1190 (37%), Positives = 662/1190 (55%), Gaps = 26/1190 (2%)

Query: 38   ELPNLNFNNTSN-SIQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQL 96
            ++P L+  ++ N +++LLGD ++L FY Y GQ+NFT   NS   S + LIYYS+D  +QL
Sbjct: 34   QVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNSSTDS-HGLIYYSNDTFLQL 92

Query: 97   EVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSI 156
              GSNDTDI++I+P+G+DSF+LSGSGH++GY L RQL YNLT LS KPIF + L  + SI
Sbjct: 93   ANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLTDLSFKPIFQEGLTEVNSI 152

Query: 157  LVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNI 216
            LVD+ +VYFGG FT+   SQ   SV+ WN   +    LPF GFG +S VNSI++L+ DNI
Sbjct: 153  LVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIGFGQNSTVNSIIRLDRDNI 212

Query: 217  LFVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDAGTAYFDQNN 276
            LF G F  L                          ++L   I L+ A W + ++ FD ++
Sbjct: 213  LFAGNFYEL--DDVKLLENHILGSNNSSSKSNWTDVELGLAIPLQNANWTSSSSQFDADD 270

Query: 277  FVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMN 336
            F+C     E+W+  G SG+L  + P   +P KIRIYN+   ++ VSLFRI+  P+ GI+N
Sbjct: 271  FICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNSPVEDNEVSLFRILAEPTKGILN 330

Query: 337  LTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEFA 396
            L+YVDP  G+L+YCDAFCPL N   LE ASSNS+S      F +NNTT + W   +QEFA
Sbjct: 331  LSYVDPEEGELRYCDAFCPLYNRQRLEEASSNSSSVENMTTFSDNNTTDIKWGRDFQEFA 390

Query: 397  FINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXXXXXXXXX 456
            F+NN+ +S++  +A  SYGS   LS  + FQ   + YANN+LNQP C             
Sbjct: 391  FVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYANNSLNQPACGK--MQSYSNATI 448

Query: 457  XDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESRS 516
             +N W +GL+  +Y++ +Y  D   +P V F+P IQ  G++SIK+YTPGCL DGTC  R+
Sbjct: 449  SNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNYSIKLYTPGCLGDGTCNQRA 508

Query: 517  IVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAII 576
            IVNVT+ D      LS+++IY+NNNE+KYDE+++G L  SP++TL ++S I P+  ++++
Sbjct: 509  IVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSPKVTLEYHSPIYPNNPTSVV 568

Query: 577  VADRVDLTPTYINVDDILLDSNLKSTS-LKLNGLFQYQLSNFTSD-TKTKVGNNSIHQLA 634
            VAD       YI+++    D   K    + LNG+FQYQ+SNFT + TK  +GN S+    
Sbjct: 569  VAD-------YISLEAKSFDHFEKHKKDITLNGIFQYQISNFTKNITKESIGNTSLDVFP 621

Query: 635  LSQFPSSVSLIGNTF-NNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETTRIENYSQ 693
            LS F ++ SL  + + N+++ LA S S   +++L+ +  + ++   +   +   I +YS 
Sbjct: 622  LSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDSSKSFNLASQVRGIGSYSD 681

Query: 694  GLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANFTYEGSELLFFNNDYLYNVS 753
            GL+ FG YN S    +  LSFNG+F+S+ ++  +V  F N   +G+ELL F+N++ YNVS
Sbjct: 682  GLILFGDYNSSQRQPLA-LSFNGSFNSYDKINRSVERFTNIDLKGTELLVFDNEFFYNVS 740

Query: 754  SESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLYGNXXXXXXXXXXX 813
            S+SY+ N T F+ SV + G N+N D +  G +  ++Y N   P+ L+ N           
Sbjct: 741  SQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGPVSLFQNGSAVSSNIKDN 800

Query: 814  IVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGTXXXXXXXXXXXXXXXXXIT 873
            I PY   +LNDT   YAYKDG +S+I++ N       ++ +                  +
Sbjct: 801  INPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGPWRWTNSIETMIYRNRDALLALGTSS 860

Query: 874  NNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSGNFTLDDVDCHGICLY 933
            +     L + N++    LA+E L+    + SMI F  N+T+L+ GNF+  D  C+G+CLY
Sbjct: 861  SPSLPQLSVLNLTTSEVLANETLDKGAEVNSMILFGKNSTLLIGGNFSFSDAHCNGLCLY 920

Query: 934  NYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSITLASLDIKGYNISVLS 993
            NY  K+WS FAN +I G + ++QL NS ++LI+G       S + L S++I G  +  L 
Sbjct: 921  NYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGSLRVNGTSDVNLVSVNITGQGMKTLL 980

Query: 994  DDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPNTTS-KYIESVEAVSID---- 1048
               +  + SF+     + VW++ ++M Y +  W  IS  N+TS   ++ +  VS++    
Sbjct: 981  RGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRHISTSNSTSFTKLQDIHQVSLEHSLE 1040

Query: 1049 -LQNSTSNVS-KILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSINNFQVNEDPAITLFEN 1106
               NS+SN +   L  YG  + T      A ++    W P F  N+   N +    +F N
Sbjct: 1041 KRANSSSNSNLDGLLVYGN-DKTQGDSYQASIYDYYSWTPLFIANSKSENSNSGPNIFMN 1099

Query: 1107 RDLSSLFNSKNSLPANIXXXXXXXXXXXXXXXXXXXXNKIEGKHSKIDRXXXXXXXXXXX 1166
            +D+S  F S+  LP                       +K      K+DR           
Sbjct: 1100 QDVSDFFISEQMLPNPTNHTSSRSSSSSSSAVTSNSGDKKHRASHKVDRGYVVLIGLALA 1159

Query: 1167 XXXXXXXXXXXXXIAYIF-RDEQKYESIKPRIDGQEMLDTVPPEKLMKFI 1215
                         IAY+F  D   YE + P  +G +  +T PP K  KF+
Sbjct: 1160 IGTVVVIGVFGILIAYMFGEDIGGYEFLSPPAEGTKAAETAPPAKSSKFL 1209

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/1194 (38%), Positives = 679/1194 (56%), Gaps = 27/1194 (2%)

Query: 39   LPNLNFN-NTSNSIQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLE 97
            LPNLN + N SN++Q+LG V+ + FY Y GQQNFT   + G +S + L+YYS++  IQLE
Sbjct: 37   LPNLNISQNNSNAVQILGGVDAISFYKYTGQQNFTKGISPGTNS-HGLVYYSNNTYIQLE 95

Query: 98   VGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSIL 157
              S+DT I KI P GDDSF+LSGSG +N  ++G Q+LYNL+TLS+ PIF+Q LG++ ++L
Sbjct: 96   DASDDTRIDKITPFGDDSFILSGSGTINNISVGNQILYNLSTLSMAPIFNQSLGDVETVL 155

Query: 158  VDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNIL 217
            V++  VYFGG F+Y   S    S + W+  SD    LPF GFG +S VNSILKLNDDNI+
Sbjct: 156  VNDTSVYFGGNFSYNNGSMIGHSALVWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIV 215

Query: 218  FVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDA-GTAYFDQNN 276
            F G F TL                          ++L Q+ISL+YA+WD+ G+     N+
Sbjct: 216  FAGKFYTL--DDSSVLITSSNNGTNSTFSLNATKLELGQRISLRYASWDSQGSTTLASNS 273

Query: 277  FVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMN 336
             VC   +  AW+    SG+L  N P  VSP+KIR+YN+  A   ++LF+I+T+PS+ IMN
Sbjct: 274  LVCPNDNGNAWLYPATSGSLVCNLPYEVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMN 333

Query: 337  LTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEFA 396
            LTY+DPL+G+LK CD FCPL + + L  AS N++S      FI+ N T V WS  +Q+FA
Sbjct: 334  LTYLDPLSGELKNCDEFCPLYSRATLLAASQNASSSMDMITFIDGNNTDVKWSSDFQDFA 393

Query: 397  FINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXXXXXXXXX 456
            F N + V++L LIA +SYG    LSG+EL+Q++ + YANN+LN+ GC +           
Sbjct: 394  FANELPVTSLKLIALNSYGDSIGLSGLELYQNTFSTYANNSLNEYGC-SALVNDSSSSIL 452

Query: 457  XDNGWYKGLDSDSYIAANYQSD-SSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESR 515
             +N WY GL  +SYIA NY  D + P+P V+FYPNI   G ++I  YTPGC+ D TC SR
Sbjct: 453  SNNSWYNGLTGESYIATNYIPDQNEPIPRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSR 512

Query: 516  SIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAI 575
             IVNVTV +P + T++ T  IYQNN+ +KYD+IF+G L  SPEI L + S I     + +
Sbjct: 513  GIVNVTVWNPQNNTMMKTYTIYQNNDNLKYDQIFSGYLDFSPEIVLEYISGIYSSNTATV 572

Query: 576  IVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSDT--KTKVGNNSIHQL 633
            +VADRV++    ++  + L + N       LNG+FQYQ SNFT  T  KTKVGN +++  
Sbjct: 573  VVADRVNVITVSLDTFNALSEINNVKRQTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLF 632

Query: 634  ALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETTRIENYSQ 693
             ++ +P + SL+   +N+ + + G ++ I  + LN + E++++      G+   I    Q
Sbjct: 633  PVNNYPKNASLLVEIYNDKLIVGGVSNRISTIDLNENFEIKSSENRTIQGDVYGITKTGQ 692

Query: 694  GLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANFTYEGSELLFFNNDYLYNVS 753
            GLL +G    SS N    L FN +F         V +  N +   +EL  F+N+Y+ N S
Sbjct: 693  GLLIYGDLR-SSDNQSTVLLFNESFGKVPNYSKRVNSATNISIADNELFVFDNNYIINAS 751

Query: 754  SESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLYGNXXXXXXXXXXX 813
            S + I N+T F+ S+ A G N N D L  G +   E+SN N                   
Sbjct: 752  SNAQISNSTSFSLSLWAAGNNGNGDVLFSGTVSHMEFSNLNGSASFKNEDQVQALNIGRG 811

Query: 814  IVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGTXXXXXXXXXXXXXXXXXIT 873
            IVPY   +LN++ + YAY+    +KI + N +  S ++S T                   
Sbjct: 812  IVPYFGAYLNESVSAYAYETDALNKIYFSNKVNPSWNWSNTITRMLYANNQTMLVVSS-E 870

Query: 874  NNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSGNFTLDDVDCHGICLY 933
            ++ ++ L I N+ +  ++A+E L +   ++++++F  N++ILV G+F +   +C G+CLY
Sbjct: 871  SSSTADLTIFNLRNMTTIANETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLY 930

Query: 934  NYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSITLASLDIKGYNISVLS 993
            NY TK WS F N+TI G + ++ L NS +++ISGLF+ + + SI L S ++  + +  L 
Sbjct: 931  NYETKSWSTFFNNTIFGEVTQLSLANSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLL 990

Query: 994  DDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPNTTSKYIESVEAVSIDLQNST 1053
              S+ +++SF+    S+  W++ ++  Y ++KWN  S P+  S  I SV  +S + ++ T
Sbjct: 991  SGSEGKLNSFVVTDNSLVAWNDTSLFIYGNQKWNITSLPSDDS-LIGSVSTISTNTKSDT 1049

Query: 1054 SNVSK--------ILFAYGEFNSTLYGRLNAMLFRAGDWKPYF--SINNFQVNEDPAITL 1103
             N           IL   G F    YG L ++LF    W PYF   I+N   N +P  T 
Sbjct: 1050 LNKRATNNAHDGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYFISEISN-SSNYNP--TF 1106

Query: 1104 FENRDLSSLFNSKNSLP-ANIXXXXXXXXXXXXXXXXXXXXNKIEGKHSKIDRXXXXXXX 1162
            F NRD+S+ FNS+ +LP  NI                    +K + +  KIDR       
Sbjct: 1107 FINRDVSTEFNSQITLPNLNITVTNPQSTSSQSPSTSATSESKSKSEKKKIDRGFVVLIG 1166

Query: 1163 XXXXXXXXXXXXXXXXXIAYIFRD-EQKYESIKPRIDGQEMLDTVPPEKLMKFI 1215
                             +AY+F+D E  Y+ IKPRID  EMLDTVPPEKLMKF+
Sbjct: 1167 LALALGTVSVLGIVGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/1204 (38%), Positives = 676/1204 (56%), Gaps = 48/1204 (3%)

Query: 35   QEFELPNLNFNNTSN-SIQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVL 93
            Q+  +P ++ +++ N  + LLGD E+L FY Y GQ+NFT    S   +  +LIYYS+   
Sbjct: 33   QDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFT---GSITETEKDLIYYSNGTF 89

Query: 94   IQLEVGSND---TDIQKIIPVGDDSFVLSGSGHL-NGYALGRQLLYNLTTLSIKPIFDQD 149
            I+L+  S++    DI  IIP GDDSF+LSG+G L  G+ L +QLLYNL++L    IF+Q 
Sbjct: 90   IKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQQLLYNLSSLEYTAIFNQS 149

Query: 150  LGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSIL 209
            +  +  IL D+EIVYFGGEF Y   +    SV+ WN T++E+  LPF+GFG DS VNSIL
Sbjct: 150  ISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEIQLLPFKGFGLDSVVNSIL 209

Query: 210  KLNDDNILFVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDAGT 269
            +L++DNI+F G F+TL                          I+ +Q I LK+A W +  
Sbjct: 210  RLDNDNIVFAGKFNTL------DDNTLLKQIRGSNSSKNATDIEFDQLIPLKHAGW-SSQ 262

Query: 270  AYFDQNNFVCEAGSSEAWIVEGRS-GNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVT 328
               + ++ +C +  S+ W  EG + G+  ++    + PSK+RIYNA  ++  VSLFRI+T
Sbjct: 263  GSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIYNAFDSDYQVSLFRIIT 322

Query: 329  SPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTW 388
            SP+NGIMNLTY+DP TG+L YCDA+CPLL++  LE A +N T  +    +I NN T++ W
Sbjct: 323  SPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSDSVAYIGNNNTNIKW 382

Query: 389  SESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXX 448
            + +YQEFAF+N + V +LT +A DSYGS   L G E++Q+ +  +AN+TLNQP CD    
Sbjct: 383  TSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFANDTLNQPNCD-NIN 441

Query: 449  XXXXXXXXXDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLA 508
                        W +G    SYI + Y   +  LP+V FYPNI   GD+++ M TPGC  
Sbjct: 442  SYSHAVTSSKQQWTQGSMDSSYILSTYDG-TGDLPSVNFYPNITYAGDYTLNMVTPGCTG 500

Query: 509  DGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTIL 568
            DG+C SR IVNVTV D  + TVLST+LIYQNNN+ KYD +++G L  +P+ITL FY +I 
Sbjct: 501  DGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYLESAPKITLKFYESIN 560

Query: 569  PDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFT--SDTKTKVG 626
             D  ++I+VADRVD+    I+   I     LK+ +  LNGLFQYQ+SNFT  S+   K+G
Sbjct: 561  TDSSTSIMVADRVDVIIDSIDQSKI----GLKTINETLNGLFQYQISNFTTISNDSLKIG 616

Query: 627  NNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETT 686
            N +I++ ++   PS+  L    +NN++ + G+ + I  LQLN DL + +   +  GG T 
Sbjct: 617  NTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLNDDLNIISEQRMGTGGPTE 676

Query: 687  RIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANFTYEGSELLFFNN 746
             I  YS GLLF G +N+SS   +  LS+NGTFSSF  L  N+T F N T + SELL FNN
Sbjct: 677  GINTYSNGLLFLGDFNLSSQQ-ISTLSYNGTFSSFGNLRTNITRFNNITIDDSELLVFNN 735

Query: 747  DYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKL--YGNXX 804
             Y++NVSS  YI N + F  S+ + G+NS  D +L+G + + +Y+  N  + +    +  
Sbjct: 736  RYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTELNGAVYINDANSIS 795

Query: 805  XXXXXXXXXIVPYAAVFLNDTANLYAYK---DGENSKIIYGNNMTTSLDFSGTXXXXXXX 861
                        Y A ++ND++  YAY    D  +  +I   N +  L  S +       
Sbjct: 796  TIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARGNRSEDLPVSWSHAVNTMI 855

Query: 862  XXXXXXXXXXITNNG---SSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSG 918
                       TN G    +SL + NIS+   +  ENL     + +++ FN N+++LV G
Sbjct: 856  YNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSSVNAIVAFNKNSSLLVGG 915

Query: 919  NFTL--DDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSS 976
            +FT+  DD  C G+CLYNY   KWS F N++I G+I ++Q +N  Q+LISG    +N + 
Sbjct: 916  DFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFNGTQLLISGNLYTENETG 975

Query: 977  ITLASLDIKGYNISVLSDDSKIEISSFI---HDGQSITVWSNDTIMEYKSEKWNEISFPN 1033
            I LA L++    +++L   S + + SF+   H    +   S++ I  Y + +W  ++  +
Sbjct: 976  INLAKLNMASNEVTILRHGSTM-VQSFVTFDHTTDELITQSDNEISYYTNGEWKNLTSED 1034

Query: 1034 TTSKYIESVEAVSIDLQNSTSNVS-KILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSINN 1092
                     + + +   +S  +VS + L   G+   + YG ++AML+   DW PYF ++ 
Sbjct: 1035 FNDSLYMGAQLIPLKQTSSKRDVSNRALLVNGDLKHSTYGSVSAMLYDFEDWMPYFIVDG 1094

Query: 1093 FQVNEDPAITLFENRDLSSLFNSKNSLPANIXXXXXXXXXXXXXXXXXXXXNKIEGKHSK 1152
               N   A  +F N+DLSSL+ ++  L                        +K E    K
Sbjct: 1095 --ENAGRASNIFMNKDLSSLYTTQTILQG-----SNTSTSTTSSNMPSETSDKNESSSDK 1147

Query: 1153 IDRXXXXXXXXXXXXXXXXXXXXXXXXIAYIFR-DEQKYESIKPRIDGQEMLDTVPPEKL 1211
            IDR                        IAY F  ++ +YE +KPR+D  +M+DTVPPEKL
Sbjct: 1148 IDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFAGNKGQYEPLKPRVDEGDMIDTVPPEKL 1207

Query: 1212 MKFI 1215
            MKF+
Sbjct: 1208 MKFV 1211

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/1193 (37%), Positives = 670/1193 (56%), Gaps = 25/1193 (2%)

Query: 39   LPNLNFN-NTSNSIQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLE 97
            LPNLN + + SN++Q+LG V+ L  Y Y GQQNFT + + G +S   L+YYS++  IQ+E
Sbjct: 37   LPNLNISQDNSNAVQILGGVDALSLYEYTGQQNFTKEISPGTNS-RGLVYYSNNTYIQVE 95

Query: 98   VGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSIL 157
              S+DT I KI P G DSF+LSGSG +N   +G Q+LYNL+TLS+ PIFDQ LG++ S+L
Sbjct: 96   DASDDTRIDKITPFGADSFILSGSGTINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVL 155

Query: 158  VDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNIL 217
            ++   VYFGG F+Y   S    S + W+  S++   LPF GFG +S VNSI+KLNDDNIL
Sbjct: 156  INGTSVYFGGNFSYNNGSMTGHSALIWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNIL 215

Query: 218  FVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWD-AGTAYFDQNN 276
            F G F TL                          ++L Q+I L+YATWD  G+  F+ N+
Sbjct: 216  FAGKFYTL-DDSSALITAGSNNTTNSTSLLNATKLELGQRIPLRYATWDFQGSTTFESNS 274

Query: 277  FVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMN 336
             VC   + +AW+    SG L    P  VSP+K+R+YN+  ++  +S+F+I+T+PSN IMN
Sbjct: 275  LVCPNANEDAWVYPATSGTLVCKLPYEVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMN 334

Query: 337  LTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEFA 396
            LTY+DPL+G+LK CD FCPL + + L +AS N +S      F++NN T V WS  +Q+FA
Sbjct: 335  LTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFA 394

Query: 397  FINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXXXXXXXXX 456
            F N + V+ L   A +SYG    LSG+EL+QD+ + YANN+LN+ GC +           
Sbjct: 395  FANELPVTLLKFTAINSYGKSVGLSGLELYQDTFSTYANNSLNEYGC-SALANDSSSSTL 453

Query: 457  XDNGWYKGLDSDSYIAANY-QSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESR 515
              N WY GL  +SYIA  Y  +   P P V FYPNI   G + I  YTPGC+ D TC SR
Sbjct: 454  SSNSWYNGLGGESYIATEYVPNQDEPTPRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSR 513

Query: 516  SIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAI 575
             IVNVT+ +P + T++ T  IYQNN+ +KYD+I++G L  SPEI L + S I     + +
Sbjct: 514  GIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQIYSGYLDFSPEIILEYVSGIHTSNTATV 573

Query: 576  IVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSDT--KTKVGNNSIHQL 633
            +VAD+V++    ++    L +S      + LNG+ QYQ SNFTS T  +TK+GN +++  
Sbjct: 574  VVADQVNVITVLLDAFSTLSESANTKEYIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVF 633

Query: 634  ALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETTRIENYSQ 693
            A+  +P++ SL  +T  + + L G+ ++I  + LN +LE+  +      G+   +   SQ
Sbjct: 634  AVDNYPNNSSLFADTNGDRLILGGTNNHISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQ 693

Query: 694  GLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANFTYEGSELLFFNNDYLYNVS 753
            GLL FG   +SS N    L FNG+F +       V +  N +   ++L+ F+NDY+ N S
Sbjct: 694  GLLIFGDL-LSSNNQSSVLLFNGSFENVFNYSRTVNSAINISLANNDLIVFDNDYIVNTS 752

Query: 754  SESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLYGNXXXXXXXXXXX 813
            S + I N+T F+ S+ + G+N N+D L  G + R ++   N   +               
Sbjct: 753  SSAQILNSTSFSLSLWSAGSNGNDDVLFSGAVSRMQFGGLNGSARFLSEDKVQALNLDNA 812

Query: 814  IVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGTXXXXXXXXXXXXXXXXXIT 873
            +VPY A +LN++   YAY+    +KI + NN+  S ++S T                   
Sbjct: 813  VVPYLAAYLNESTTAYAYETNLLNKIYFSNNVDPSWNWS-TSITRMLYANNQSLLTVGSE 871

Query: 874  NNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSGNFTLDDVDCHGICLY 933
            ++ ++ L I N+ +   +A+E + +   I ++++F  N+++LV GNF +   +C G+CLY
Sbjct: 872  SSTTAELSIFNLKNFTMIANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLY 931

Query: 934  NYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSITLASLDIKGYNISVLS 993
            NY +K WS F N+T  G I ++    + Q++ISGLF  + Y S+ LAS ++    +  L 
Sbjct: 932  NYESKSWSTFFNNTFFGEITQLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLL 991

Query: 994  DDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPNTTSKYIESVEAVSIDLQNST 1053
              ++ +I+SF+   +SI  W++ +++ Y+ ++WN  S P   S  I SV  ++ +    T
Sbjct: 992  TGAEGKINSFVVTEESIVAWNDTSLLIYRDQEWNITSVPGNDSS-IGSVSTINTNAGPGT 1050

Query: 1054 SNVSK--------ILFAYGEFNSTLYGRLNAMLFRAGDWKPYF-SINNFQVNEDPAITLF 1104
             N           IL   G F+   YG L  +LF    W PYF S ++   N +P  T+F
Sbjct: 1051 LNRRATNNAENGTILLLSGNFSIPDYGNLQGLLFDFETWSPYFVSESSNTSNRNP--TIF 1108

Query: 1105 ENRDLSSLFNSKNSLPANIXXXXXXXXXXXXXXXXXXXXNKIEGKHSK-IDRXXXXXXXX 1163
             NRD+S+ FNS+  L +N+                    ++++ K  K IDR        
Sbjct: 1109 INRDVSTEFNSQIPL-SNLNVTETGPQSASSQFPSSSASSELKPKSKKRIDRGFVVLIGL 1167

Query: 1164 XXXXXXXXXXXXXXXXIAYIFRD-EQKYESIKPRIDGQEMLDTVPPEKLMKFI 1215
                            +AY+F+D E  Y+ IKPRID  EMLDTVPPEKLMKF+
Sbjct: 1168 ALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/1193 (37%), Positives = 666/1193 (55%), Gaps = 25/1193 (2%)

Query: 39   LPNLNFN-NTSNSIQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLE 97
            LP+LN + +  N+IQ+LG V+ L FY Y GQQNFT +  S  +S   L+YYS++  I LE
Sbjct: 37   LPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSETNS-RGLVYYSNNTYILLE 95

Query: 98   VGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSIL 157
                DT I KI P G DSF+LSGSG +NG  LG Q+LYNL+TLS+  IF Q LG++ ++L
Sbjct: 96   EADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVL 155

Query: 158  VDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNIL 217
            V++  VYFGG F+Y   S      + W+ TS+    LPF GFG DS VNSI+KLNDDNIL
Sbjct: 156  VNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNIL 215

Query: 218  FVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDA-GTAYFDQNN 276
            F G F TL                          ++L Q+I L+YA+WD+ G+  F+ + 
Sbjct: 216  FAGKFYTL--DDSSILTTSSTNTTNASSTLNATTLELGQRIPLRYASWDSQGSTTFESSY 273

Query: 277  FVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMN 336
             VC   S +AW+  G SG+L    P  V+P+KIR+YN+  +++ +SLF+I+T+PS  IMN
Sbjct: 274  LVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDNDISLFQILTNPSGSIMN 333

Query: 337  LTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEFA 396
            LTY+DP++G+L+ CD FCPL +   L +AS N +S      FI+NN T V WS  +Q+FA
Sbjct: 334  LTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFIDNNNTDVKWSSDFQDFA 393

Query: 397  FINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXXXXXXXXX 456
            F N + V++L   A +SYG+K  LSG+EL+QD+ + YANN+LN+ GC +           
Sbjct: 394  FANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNEYGC-SALANDSSSSIL 452

Query: 457  XDNGWYKGLDSDSYIAANY-QSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESR 515
             DN WY GL   SYIA +Y  + + P PTV FYP+I   G ++I  YTPGC+ D TC SR
Sbjct: 453  SDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYTINTYTPGCVQDNTCSSR 512

Query: 516  SIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAI 575
             IVNVT+ +P + T++ T LIYQNNN +KYD+I++G L  SPEI + + S I     + I
Sbjct: 513  GIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPEIVMKYVSGIYASNTATI 572

Query: 576  IVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSDTK--TKVGNNSIHQL 633
            +VAD+V++    ++    L ++        LNG+ QYQ SNFT+ T   TK+ N +++  
Sbjct: 573  MVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSNFTATTSNGTKIANTTLNLF 632

Query: 634  ALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETTRIENYSQ 693
            ++  +P + S+  + ++  + L G  ++I  +  N +LE+ ++      G+   +   +Q
Sbjct: 633  SVDNYPKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEVTSSENKTIQGDVYGMTQTNQ 692

Query: 694  GLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANFTYEGSELLFFNNDYLYNVS 753
            GLL FG    SS N    L FNG+F S S     V    N T   ++L+ FNNDY++N S
Sbjct: 693  GLLIFGDVR-SSDNKSTVLMFNGSFESVSNYSKAVENAINITLANNDLIVFNNDYIFNAS 751

Query: 754  SESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLYGNXXXXXXXXXXX 813
            S S I N+T F+ S+ + G N N+D L  G + + ++S+ +   +               
Sbjct: 752  SNSQISNSTSFSLSLWSAGNNDNDDVLFSGAVSQMQFSDLSGSARFLNESTVEALNLNKG 811

Query: 814  IVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGTXXXXXXXXXXXXXXXXXIT 873
            IVPY   +LN++   YAYK    SKI + NN++ S ++S                    +
Sbjct: 812  IVPYLGAYLNESTIAYAYKTNSLSKIYFSNNVSPSWNWSNNITKMVYANNQTLLVIGSES 871

Query: 874  NNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSGNFTLDDVDCHGICLY 933
            +  ++ L I N+ +  ++A+E L +   I + ++F  N+++LV G+F +   +C G+C+Y
Sbjct: 872  ST-TAELSILNLRNFTTIANETLGSNAKINAFVNFEKNSSLLVGGDFQMSKPNCTGLCVY 930

Query: 934  NYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSITLASLDIKGYNISVLS 993
            NY +K WS F N+TI G I ++   N  +++ISGLF+ +   SI L S ++    +  L 
Sbjct: 931  NYESKSWSTFFNNTIVGEITQLAFNNESELIISGLFATEKQQSIRLGSFNLTNSTMVPLL 990

Query: 994  DDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPNTTSKYIESVEAVSIDL---- 1049
              S  +++SF    +SI  W++ +++ YK +KWN  S P   S  + SV  +  +     
Sbjct: 991  TGSGGKLNSFTVTEESIVAWNDTSLLIYKDQKWNTTSLPGNGSS-VSSVTTIDTNTDSYA 1049

Query: 1050 --QNSTSNVSK--ILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSINNFQVNE-DPAITLF 1104
              + +T++  K  IL   G F+   YG L  +LF + +W PYF+    + +  +P  T+F
Sbjct: 1050 LRKRATTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWTPYFTSETLEASSYNP--TIF 1107

Query: 1105 ENRDLSSLFNSKNSLP-ANIXXXXXXXXXXXXXXXXXXXXNKIEGKHSKIDRXXXXXXXX 1163
             NRD+S+ FNS+  L  +N+                       + K   +DR        
Sbjct: 1108 INRDVSADFNSQIPLSNSNMTVTSPQSTSPLSPSSSASSEPNKKSKKKNMDRGFVVLIGL 1167

Query: 1164 XXXXXXXXXXXXXXXXIAYIFRD-EQKYESIKPRIDGQEMLDTVPPEKLMKFI 1215
                            +AY+F+D E  Y  IKPRID  EMLDTVPPEKLMKF+
Sbjct: 1168 ALALGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEMLDTVPPEKLMKFV 1220

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/1193 (37%), Positives = 666/1193 (55%), Gaps = 25/1193 (2%)

Query: 39   LPNLNFN-NTSNSIQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLE 97
            LPNLN + N SN++Q+LG V+ L FY Y GQQNFT +     SS + L+YYS++  IQLE
Sbjct: 37   LPNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKEIGPETSS-HGLVYYSNNTYIQLE 95

Query: 98   VGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSIL 157
              S+DT I KI P G DSF+LSGSG +N  ++G Q+LYNL+TLS+ PIF+Q LG + ++L
Sbjct: 96   DASDDTRIDKITPFGVDSFILSGSGTINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVL 155

Query: 158  VDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNIL 217
             D   +YFGG F+Y   S    S + W+  S+    LPF GFG +S VNSI+KLN+DNIL
Sbjct: 156  ADNSSIYFGGNFSYNNGSMTGYSALIWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNIL 215

Query: 218  FVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDA-GTAYFDQNN 276
            F G F TL                          ++L Q+I L+YA+WD+ G+  F  ++
Sbjct: 216  FAGQFYTL--DDPSALISSSNNGTNSTSSLNATTLELGQRIPLRYASWDSQGSTTFASDS 273

Query: 277  FVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMN 336
             VC   + +AW+    SG+L  N P  VSP+KIR+YN+  ++  +S+F+I+T PS+ IMN
Sbjct: 274  LVCPNTNEDAWLYPDTSGSLVCNLPYEVSPTKIRLYNSQRSDSEISVFQILTDPSSSIMN 333

Query: 337  LTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEFA 396
            LTY+DPL+G+LK C  FCPL + + L +AS N +S      FI+NN T V W+  +Q+FA
Sbjct: 334  LTYLDPLSGELKNCGEFCPLYSRATLLSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFA 393

Query: 397  FINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXXXXXXXXX 456
            F+N + VS+L  +A +SYG    LSG+EL+QD+ + YAN++LN+ GC +           
Sbjct: 394  FVNELPVSSLKFVALNSYGGSVGLSGLELYQDTFSTYANDSLNEYGC-SALTNDSSSSTL 452

Query: 457  XDNGWYKGLDSDSYIAANYQSD-SSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESR 515
              N WY GL  +SYIAA Y  D + P+P V+FYPNI   G ++I MYTPGCL D TC +R
Sbjct: 453  SSNDWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNIIHPGHYTINMYTPGCLQDNTCSAR 512

Query: 516  SIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAI 575
             IVNVT+ +  + T++ T LIYQNN+ +KYD+I++G L  SPEI L + S I     + +
Sbjct: 513  GIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATV 572

Query: 576  IVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSDT--KTKVGNNSIHQL 633
            +VAD+V++    ++  + L DS+       LNG+ QYQ SNFTS    +TKVGN +++  
Sbjct: 573  VVADQVNVITVSLDAFNTLSDSSNAKKETLLNGILQYQKSNFTSTRLNETKVGNTTLNLF 632

Query: 634  ALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETTRIENYSQ 693
             +  +P + SL  + ++N + + G ++ I  + LN D E+ ++      G+   I   +Q
Sbjct: 633  PVKNYPKNSSLYADIYDNKLVIGGVSNRISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQ 692

Query: 694  GLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANFTYEGSELLFFNNDYLYNVS 753
            GLL FG   +SS N      FNG+F +       V +  N +   ++ +  +NDY+ N S
Sbjct: 693  GLLIFGDI-LSSNNQSAVFLFNGSFENVFNQSRTVNSALNISLANNDFIVLDNDYVVNAS 751

Query: 754  SESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLYGNXXXXXXXXXXX 813
            S + I N++ F+ S+ A G N + D L  G +   +Y N N  ++               
Sbjct: 752  SNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQYGNLNGSVRFLNENEIEPLNLEGG 811

Query: 814  IVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGTXXXXXXXXXXXXXXXXXIT 873
            IVPY   +LN++A  YAY+    +KI + N +  S ++S +                   
Sbjct: 812  IVPYLGAYLNESATAYAYEVDSLNKIYFSNEVYPSWNWS-SGITQMLYADNQTLLAVSAG 870

Query: 874  NNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSGNFTLDDVDCHGICLY 933
            ++ ++ L I ++ +   +A+E L +   I ++++F  N ++LV G+F + + +C G+CLY
Sbjct: 871  SSTTAELSIFDLRNLTMIANETLGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLY 930

Query: 934  NYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSITLASLDIKGYNISVLS 993
            NY +K WS F N+TI G I ++   NS +++ISGLF  + Y SI L S ++    +  L 
Sbjct: 931  NYESKTWSTFLNNTIFGEITQLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLL 990

Query: 994  DDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPNTTSKYIESVEAVSIDLQNST 1053
              S+ +++SF     SI  W++ ++  Y++++WN  S P   S         + D++++T
Sbjct: 991  SGSEGKLNSFTVTEDSIVAWNDTSLFIYRNQEWNITSLPGNASSISSVSAIYT-DIESNT 1049

Query: 1054 SNV--------SKILFAYGEFNSTLYGRLNAMLFRAGDWKPYF-SINNFQVNEDPAITLF 1104
             N           IL   G FN + YG L ++LF    W PYF S      N +P I  F
Sbjct: 1050 LNKRGINNVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTSNYNPII--F 1107

Query: 1105 ENRDLSSLFNSKNSLP-ANIXXXXXXXXXXXXXXXXXXXXNKIEGKHSKIDRXXXXXXXX 1163
             NRD+S+ FNS++ L   NI                    +K + K  KI R        
Sbjct: 1108 INRDVSTEFNSQSPLANVNITVTSPQSTSSQPPSSSASSESKSKSKKKKIGRGFVVLIGL 1167

Query: 1164 XXXXXXXXXXXXXXXXIAYIFRD-EQKYESIKPRIDGQEMLDTVPPEKLMKFI 1215
                            +AY+F+D E  Y+ IKPRID  EMLDTVPPEKLMKF+
Sbjct: 1168 ALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/1199 (37%), Positives = 682/1199 (56%), Gaps = 51/1199 (4%)

Query: 39   LPNLNFNNTSNSIQLLGDVENLQFYHYEGQQNFTDDGNSGI---SSTNNLIYYSDDVLIQ 95
            +PNLN     NS +LLG +++L FY Y GQQNFT    SGI   S++N L YYS++  IQ
Sbjct: 35   IPNLNLTTDDNSFELLGGIDSLSFYRYTGQQNFT----SGILPNSNSNGLTYYSNNTFIQ 90

Query: 96   LEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITS 155
            L   S D+ I++IIP G DSF+LSG G L GY+L  QLL+NL++ S+K IF+Q L ++ S
Sbjct: 91   LYEPSLDSRIERIIPFGSDSFILSGKGSLGGYSLSNQLLFNLSSFSLKQIFNQTLDSVNS 150

Query: 156  ILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDN 215
            ILVD  +V FGG FT  T S N  SV  WN T++    LPF GFG +S +NSI KLNDDN
Sbjct: 151  ILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGFGENSLINSITKLNDDN 210

Query: 216  ILFVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDAGTAYFDQN 275
            ILF G F TL                          I L Q I L  ATW +  ++FD+ 
Sbjct: 211  ILFAGKFYTL--------DNSTLLNVVNDTMRNISDINLGQLIPLSAATWSSTGSFFDEE 262

Query: 276  NFVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIM 335
             FVC   + EAW   G SG L  N P  V+P+KIRIYN+   ++ +SLFRI + PS  IM
Sbjct: 263  TFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRIYNSPDPDNEISLFRIFSDPSESIM 322

Query: 336  NLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEF 395
            NLTY+DP+ GQLK+CDAFCPL     L++AS N T  +     +N+NT+ + WS+ +QEF
Sbjct: 323  NLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIELLNDNTSDIRWSQDFQEF 382

Query: 396  AFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXXXXXXXX 455
            AF+N +  S+L  +A +SYG+   LS  +++QD++  +ANN+LN+P C++          
Sbjct: 383  AFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNSLNEPSCNS--LESFSSSD 440

Query: 456  XXDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESR 515
              +N W +G+D  +Y+   Y      LP V F+P+++  G +SI++YTPGC  D TC SR
Sbjct: 441  LSNNTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSIELYTPGCQQDNTCSSR 500

Query: 516  SIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAI 575
             IVNVTV +  + ++LST LIYQNN+++KYDE+++G L  SP+IT+T++S I     +  
Sbjct: 501  GIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYLNYSPKITVTYHSGIYSGTTAGT 560

Query: 576  IVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSDTK----TKVGNNSIH 631
            +V DR+++    IN  DIL + +  + SL+LNGLFQYQLSNF++ +K     +V N SI+
Sbjct: 561  VVVDRLNIM---INSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSKDSSIARVANTSIN 617

Query: 632  QLALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETTRIENY 691
            QL L+ F S+VSL  + +N+++ +      +   +LN DL ++++      G+ T +++Y
Sbjct: 618  QLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQQGIEGKITGLKSY 677

Query: 692  SQGLLFFGQYNIS--STNVVDNLSFNGTFSSFSQLGDNVTTFANFTYEGSELLFFNNDYL 749
            S G+L +G +N S  S+NV   LSFNG+F S   +   +T FAN T + SELL F+N+ +
Sbjct: 678  SNGVLVYGDFNSSKESSNV---LSFNGSFDSIGNITSPITNFANITIDDSELLVFDNNLI 734

Query: 750  YNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLYGNXXXXXXX 809
            +NVSS S I N + F+ S+ ++G+NSN DTL  G + + +++N +  + +  N       
Sbjct: 735  FNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGALSQVQFTNLSGSVSIANNLSATSLR 794

Query: 810  XXXXIVPYAAVFLNDTANLYAYK-DGENSKIIYGNNMTTSLDFSGTXXXXXXXXXXXXXX 868
                  PYAA+FLND+   Y  K D   S++I+ +       ++G               
Sbjct: 795  SIGS--PYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSKAPWRWTGYVDSMLYLTNQSMLA 852

Query: 869  XXXITNNGSSS-----LVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSGNFTLD 923
                   GSSS     L I N+     LA+E LN    + +M+ F  N++ILV GNF++ 
Sbjct: 853  V------GSSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVHFERNSSILVGGNFSIS 906

Query: 924  DVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSITLASLD 983
            + +C G+CLYNY   +W  F N TI G+I ++Q++N  Q++I+G+F  ++ SS+ LA ++
Sbjct: 907  NTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGVFDTKSQSSVNLALMN 966

Query: 984  IKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPNT-TSKYIESV 1042
            +    + ++    K  +  FI    +I  W+  ++ EY S  W +I   N+ +S  I+S+
Sbjct: 967  LTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSWVDIPISNSNSSTTIDSI 1026

Query: 1043 EAVS-----IDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSINNFQVNE 1097
               +     +  ++++   + +L   G+    +YG + AM++   +W PY SIN+   + 
Sbjct: 1027 GWTTTTDNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIYNFEEWIPYLSINSLVSSA 1086

Query: 1098 DPAITLFENRDLSSLFNSKNSLPANIXXXXXXXXXXXXXXXXXXXXNKIEGKHSKIDRXX 1157
            +    LF +RD+S LF+S+ +L  +                      K+     KIDR  
Sbjct: 1087 NQPAELFIDRDVSKLFDSQLALQVS-NTTASITASSSTPTPTSSPKKKLHQSKKKIDRGF 1145

Query: 1158 XXXXXXXXXXXXXXXXXXXXXXIAYIFRDEQ-KYESIKPRIDGQEMLDTVPPEKLMKFI 1215
                                  +AY FRD+   Y+ I PR++  EML TVPPEKLM+FI
Sbjct: 1146 VVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRVNEDEMLKTVPPEKLMEFI 1204

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/1188 (36%), Positives = 647/1188 (54%), Gaps = 39/1188 (3%)

Query: 40   PNLNFNNTSNSIQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLEVG 99
            P L+F     ++QL G    L F  YEGQ+NFT   N+   S   ++YYS+D  I+L  G
Sbjct: 35   PRLDF--PGEALQLFGGFNALTFPQYEGQENFTGTINNNTDS-RGIVYYSNDTFIKLING 91

Query: 100  SNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSILVD 159
            S+D+ ++KI+P G +SF+L GSG L GY LGRQLLYNL+ LS++PIF+  L ++  IL D
Sbjct: 92   SSDSYVEKIVPFGSESFILGGSGSLLGYELGRQLLYNLSDLSLRPIFENSLTDVRVILED 151

Query: 160  EEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNILFV 219
              + YFGG F++   S    SV +WN +S+    LPF GFG +S VNSI+KL+ DNILF 
Sbjct: 152  YPVAYFGGNFSFDNGSTVGHSVATWNSSSNTTSLLPFGGFGEESIVNSIIKLDSDNILFT 211

Query: 220  GMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDAGTAYFDQNN-FV 278
            G F TL                          I++ + + L+ ATW+  +     ++ F+
Sbjct: 212  GEFYTL------DDQTLLITNENTSKTNHSQSIEINELLPLRAATWNTDSDSSFDSSAFI 265

Query: 279  CEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMNLT 338
            C     EAW V   SG+L+ + P    P K+RIYN+    + VSLFRI+T PSNGIMNLT
Sbjct: 266  CPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYNSPEEHNAVSLFRIITKPSNGIMNLT 325

Query: 339  YVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEFAFI 398
            YVDPL+G+L  CDAFCPL+    L+ A +N    T Q V ++NN T + WS  YQ+FAF+
Sbjct: 326  YVDPLSGELLNCDAFCPLMLQDSLKAAVAN--GNTSQVVRLDNNLTDIQWSYDYQDFAFV 383

Query: 399  NNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXXXXXXXXXXD 458
            N I V+ L  +A  SYG    LS  +L+QD+ T YANN+LN+ GC  E           D
Sbjct: 384  NKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSLNEVGC--ESNDIASTSALSD 441

Query: 459  NGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESRSIV 518
            + W +GL   SY+ A++++    LP V FYP I   G +++ +YTPGC +D TC SRSIV
Sbjct: 442  SEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQYTMNLYTPGCSSDQTCTSRSIV 501

Query: 519  NVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAIIVA 578
            NVT+     G++LS+ L++QNN  MKYD++++G L  +P +TL +YS I P+  S ++VA
Sbjct: 502  NVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVLTLEYYSPISPNNPSNVVVA 561

Query: 579  DRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFT--SDTKTKVGNNSIHQLALS 636
            DR+++      V+ + +  N    ++ LNG+FQYQLSNFT  +D+K  + N +++   + 
Sbjct: 562  DRLEVI-----VESVDILKNQTDETIPLNGMFQYQLSNFTNSTDSKPSIANTTLNSYTVQ 616

Query: 637  QFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETTRIENYSQGLL 696
             FP + SL  + +NN++++ GS S +  ++L+ DL + +T     GG    I +YS G++
Sbjct: 617  NFPKNASLFSSMYNNTLWVGGSVSGVAAVELDEDLHVSSTAKYATGGTVEGISSYSDGII 676

Query: 697  FFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANFTYEGSELLFFNNDYLYNVSSES 756
             FG +N+SS   V  L+FNG F SF  L   + T+ N +++  ELL FNN+Y++N+SS S
Sbjct: 677  LFGTFNLSS-QPVSTLTFNGVFGSFGNLETTLRTYTNVSFQQDELLVFNNEYVFNLSSNS 735

Query: 757  YIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLYGNXXXXXXXXXXXIVP 816
            YI N++ F  S+ + G N  +DTL  G + ++++        +Y N             P
Sbjct: 736  YISNSSTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYSNSSVAHFSLQNGAQP 795

Query: 817  YAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGTXXXXXXXXXXXXXXXXXITNNG 876
            YAA  LND+   YAY+ G  S++ + N       + GT                   +  
Sbjct: 796  YAACHLNDSVTAYAYRYGSVSQLYFDNGKEGPWTWFGTINSMRYSKNSTILAIGTDGSTD 855

Query: 877  SSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSGNFTLDDVDCHGICLYNYF 936
               L + N++    LA+  ++  G I+SM+ F+ N+++LV G++ + D DC G+CLYNY 
Sbjct: 856  EPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVGGDYHISDADCSGLCLYNYD 915

Query: 937  TKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSITLASLDIKGYNISVLSDDS 996
             K+W+ FAN++I G+I EMQL  S  +LISG  +  N +S+ L S ++  Y ++ L  DS
Sbjct: 916  QKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSVNLLSFNMSNYEVNPLVWDS 975

Query: 997  KIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPNTTSKYIESVEAVSID-----LQN 1051
               I SFI +   I  W+  ++  Y    W  + F N++   I  V AV  +      Q 
Sbjct: 976  NGPIKSFIAEDNDIITWNETSLSGYSDGDWQNLEFDNSSLISIVDVIAVKTEPALDKRQT 1035

Query: 1052 STSNVSKILFA---YGEFNSTLYGRLNAMLFRAGDWKPYFSINNFQVNEDPA-ITLFENR 1107
             +S    IL A   Y E+         A ++    W PY+ + N   +EDP+  T F N+
Sbjct: 1036 FSSTFDAILVAGQNYAEYP-------QASIYNFQRWLPYY-VANKADDEDPSRTTFFTNQ 1087

Query: 1108 DLSSLFNSKNSLPANIXXXXXXXXXXXXXXXXXXXXNKIEGKHSKIDRXXXXXXXXXXXX 1167
            D S L++S+N L                          +  K  KI+R            
Sbjct: 1088 DDSQLYDSQNLLSDPTRTTTSSSSSTTSSSQTSPSKGSLVRKSGKINRGFVVLIGLALAL 1147

Query: 1168 XXXXXXXXXXXXIAYIFRDEQKYESIKPRIDGQEMLDTVPPEKLMKFI 1215
                        +A +F     YE + PR D  EM+DTVPPEKL+KF+
Sbjct: 1148 GTVVIIGITGVLLALVFNGHSGYEQVDPRADESEMIDTVPPEKLLKFL 1195

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/1196 (36%), Positives = 672/1196 (56%), Gaps = 30/1196 (2%)

Query: 39   LPNLNFNNTSN-SIQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLE 97
            +P LN   +++ + QLLGD++ L FY Y+GQQNFT     G S++N LIYYS++ LIQLE
Sbjct: 35   IPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTGIIPG-SNSNGLIYYSNNTLIQLE 93

Query: 98   VGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSIL 157
              SNDT I KI P G DSF+LSG+G L+GY+L  QLLYNLTTLSI+PIF+  +  + +IL
Sbjct: 94   EPSNDTYIAKITPFGSDSFILSGTGSLSGYSLTNQLLYNLTTLSIEPIFNTSIEEVKTIL 153

Query: 158  VDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNIL 217
            +D+ +VYFGG FT    + N  S+I W+ TS     L F GFG +S +NSI+KLNDDNIL
Sbjct: 154  IDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEFLNFGGFGENSIINSIVKLNDDNIL 213

Query: 218  FVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDAGTAYFDQNNF 277
            F G F TL                          + + Q + L  +TWD G + FD + F
Sbjct: 214  FAGEFYTL----DEPDFLIQNTTSSQNNIFNSTTVDIGQLVPLSASTWDTGESTFDSDTF 269

Query: 278  VCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMNL 337
            VC   + E+WI  G +G+L    P  V+P+KIRIYN+   ++ VSLFRI+T+ + GIMNL
Sbjct: 270  VCPDTTEESWIQSGTTGSLTCKLPFEVAPTKIRIYNSPNEDNQVSLFRILTNEAQGIMNL 329

Query: 338  TYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEFAF 397
            TY+DP++ +LK+CDAFCPL + + L  A +N+TS +     + +NTT + W++ +QEFAF
Sbjct: 330  TYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPSDTIHLLADNTTDIKWTQEFQEFAF 389

Query: 398  INNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXXXXXXXXXX 457
            IN I VS++  +A DSYG+  ALS  +L+Q+++  +AN+TLN+P C++            
Sbjct: 390  INQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFANDTLNEPNCNSIESSSSSSLSAN 449

Query: 458  DNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESRSI 517
            D  W  GL   +YI+  Y  +  P+P V F P I+  G +SI +YTPGC  D TC SR+I
Sbjct: 450  D--WEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYPGQYSINIYTPGCTQDDTCSSRAI 507

Query: 518  VNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAIIV 577
            VNVTV D    ++L+T+LIYQNN E+KYDE+++G L+ SP +T+ + S +      A +V
Sbjct: 508  VNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSSSPRVTIEYVSGLYASNTVATVV 567

Query: 578  ADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSD----TKTKVGNNSIHQL 633
            ADR+++    + V  +  +    +  + LNGL QYQ+SNF++     T  K+ N S++QL
Sbjct: 568  ADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQISNFSTSSSETTDVKITNTSLNQL 627

Query: 634  ALSQFPSSVSLIGNTF-NNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETTRIENYS 692
            +L QF  + S+  + + +N++ L  S   I  ++LN ++++ ++      G T    +YS
Sbjct: 628  SLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLNENMDIESSNEASLTGNTAGFSSYS 687

Query: 693  QGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDN--VTTFANFTYEGSELLFFNNDYLY 750
             G+L +G+YN+SS  +   +++NGTF+       N  +T   N T   +ELL  +N  +Y
Sbjct: 688  GGILAYGEYNLSS-KITYLVNYNGTFNEIPNFNKNSSITNVVNLTIHDTELLVIDNQAIY 746

Query: 751  NVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLYGNXXXXXXXX 810
            NVSS S I N++    S+ ++G+N N DT+  G I   +Y++ N  + +  N        
Sbjct: 747  NVSSSSTITNSSALQLSLWSSGSNLNRDTVFSGAIALLDYTDLNGSIAIGNNFTVTNITN 806

Query: 811  XXXIVP--YAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGTXXXXXXXXXXXXXX 868
                    Y  +FLND+ ++YA K    S++++ N  +    F                 
Sbjct: 807  NVSSTNSLYTGLFLNDSLSIYASKTDSYSELLFSNGYSAPWSFFEGINYMVYSSHQTMLA 866

Query: 869  XXXITNNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSGNFTLDDVDCH 928
                  N +S L I N++   ++A+E LN    I  +I+F  N+T++V GNFT+   +C 
Sbjct: 867  VASSDFNKNSELSILNLTTFETIANETLNVNSKINGLINFEHNSTLIVGGNFTILQSNCS 926

Query: 929  GICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSITLASLDIKGYN 988
            G+CLYNY + +W  FAN +I G+I +M+L N  Q+L+SGLF+AQN SS+ LA +D+  Y 
Sbjct: 927  GLCLYNYDSNEWLTFANHSINGTIAQMELINGTQLLLSGLFNAQNISSVNLAIMDLSTYA 986

Query: 989  ISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPNTTSKYIESVEAV--- 1045
            +S +       + SF   G  I  W+   +  Y++  W+ I     +S  I S+E +   
Sbjct: 987  VSSIKMGDANILQSFATIGDKIITWNGIMLESYENGAWSTIQSNFNSSTTIRSIEPIGFG 1046

Query: 1046 -SIDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSINNFQVNEDPAITLF 1104
             ++  ++ T +    +   G    T YG + AM++   +W+PY+ I+    N   A  +F
Sbjct: 1047 PTLQKRDGTGSADGFIIN-GNIYDTEYGTIQAMIYNFKEWRPYYIIS--STNSQIAGQIF 1103

Query: 1105 ENRDLSSLFNSKNSL--PANIXXXXXXXXXXXXXXXXXXX--XNKIEGKHSKIDRXXXXX 1160
             NRD S+L+NS++ L  P N                       ++ +    KIDR     
Sbjct: 1104 MNRDDSALYNSQSVLQNPNNATVTTPSSTSSGTPSATHSSQPHHQKQVGRKKIDRGFVVL 1163

Query: 1161 XXXXXXXXXXXXXXXXXXXIAYIFRD-EQKYESIKPRIDGQEMLDTVPPEKLMKFI 1215
                               +AYIF+D +  ++++ PR +  EML+TVPPEKLMKF+
Sbjct: 1164 IGLALALGTVSLLGIIGLVLAYIFKDGDGSHDALNPRTNEDEMLETVPPEKLMKFL 1219

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1206 (36%), Positives = 658/1206 (54%), Gaps = 53/1206 (4%)

Query: 35   QEFELPNLNFN-NTSNSIQLLGDVENLQFYHYEGQQNF----TDDGNSGISSTNNLIYYS 89
            Q F  P L F+ N  +S+QLLG  + L  Y Y GQQNF    T D NS     N L+YYS
Sbjct: 33   QTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITPDTNS-----NGLVYYS 87

Query: 90   DDVLIQLEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQD 149
            ++ LIQL  G +DT I  I+P+G DSF+LSGSG LN Y+L  QL YNL++LS+ PIF+  
Sbjct: 88   NNTLIQLNQGLDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLSSLSVYPIFNTT 147

Query: 150  LGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSIL 209
            L  + SILVDE++VYFGG FT+   + +  SV  WN+TS+    LPF GFG +S +N+IL
Sbjct: 148  LEQVESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLGFGENSSINNIL 207

Query: 210  KLNDDNILFVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDAGT 269
            +LNDDNILF G F TL                          ++L   + L  ATW +  
Sbjct: 208  RLNDDNILFAGEFYTL-------DDASLLTSNTSNATTNIYDLELSPLLPLNEATWSSDV 260

Query: 270  AYFDQNNFVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTS 329
            + FD ++F+C    S+AW V G +G L  + P   + +KIRIYN+  +++ +S FR+++ 
Sbjct: 261  SDFDASSFICVNPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPDSQNQISEFRLISD 320

Query: 330  PSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWS 389
            PS  IMN+TY+DP TG L++CD++CPLL+   L +AS  ++     R+ +++N T + WS
Sbjct: 321  PSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSSASDAASVSEMARL-LSDNATVIKWS 379

Query: 390  ESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXX 449
              YQEF F+N +  + L  +A +SYGS  AL+G  L+QD +  +ANN+LN   C T    
Sbjct: 380  AEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANNSLNGASC-TSNNS 438

Query: 450  XXXXXXXXDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLAD 509
                    DN W  G    +Y+   Y     P+P V F  N+   GD+ I +YTPGC  D
Sbjct: 439  DYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDYVINLYTPGCSDD 498

Query: 510  GTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILP 569
            GTC +R +VNVTV D +D ++LST  IYQNN  +KYDE+F+G L  S  I L + S I  
Sbjct: 499  GTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSVRIVLEYVSGISS 558

Query: 570  DLDSAIIVADRVDLTPTYINVDDIL--LDSNLKSTSLKLNGLFQYQL---SNFTSDTKTK 624
            D     +VADR ++   Y+   DIL  + S+   +++ LNGLFQYQL   S+  + +  K
Sbjct: 559  DSTGTTVVADRSNI---YVTSLDILGQISSSKNGSTVALNGLFQYQLSNFSSTFNSSSAK 615

Query: 625  VGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGE 684
            VG   ++Q  L  F ++ SL  +T++N + + G+  ++  L+ ++DL    +   DN G 
Sbjct: 616  VGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLNFSTS---DNSGV 672

Query: 685  TTRIEN---YSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGD-NVTTFANFTYEGSE 740
              + +N   +S+G+  +G +N+S       +++NG+F+ F+Q G+ ++ TF N T+  SE
Sbjct: 673  EGQFKNMQPFSEGIFLYGNFNLSGV-TEGAVTYNGSFNPFTQYGNSSIDTFKNVTFGNSE 731

Query: 741  LLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLY 800
            +L FNN YLYNVSS + + N++  + S+ + GAN+N D L  G   +  YS  NE + + 
Sbjct: 732  ILVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDLLFNGASSQMSYSFNNESINIG 791

Query: 801  GNXXXXXXXXXXXIVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGTXXXXXX 860
             N           I PY  +++N +   Y Y+D +N+++ + N    S  +         
Sbjct: 792  ANNIVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWPNDVVAAIY 851

Query: 861  XXXXXXXXXXXITNNGSSS-LVISNISDGMSLASE-NLNNYGYITSMIDFNSNNTILVSG 918
                        ++  SSS L + N +    +A+E   +    I+ +++F SN T ++ G
Sbjct: 852  SDNQSLLIAGTSSSLESSSFLTVLNTTTYDVIANESLSSQQSQISGIVNFASNATAIIGG 911

Query: 919  NFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSIT 978
            NF++ +V+C G+CL+NY    WS+FA+++I G++  MQL+N  ++++SGLFS +N SSIT
Sbjct: 912  NFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFSTKNISSIT 971

Query: 979  LASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKW--NEISFPNTTS 1036
            +ASL++K   I+ L         SF    Q I  W+N  +  Y+   W    IS  N++S
Sbjct: 972  MASLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTALSIYEDNVWTVERISNINSSS 1031

Query: 1037 -----KYIESVEAVSIDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSIN 1091
                  Y+    A+S   +  TS+   IL + G+     YG + AM++    W PY  IN
Sbjct: 1032 VVDNLNYVTLASALS---KRDTSSSDAILVS-GQLYDNSYGHIQAMVYDFSSWVPYLLIN 1087

Query: 1092 NFQVNEDPAITLFENRDLSSLFNSKNSLPANIXXXXXXXXXXXXXXXXXXXXNKIEGKHS 1151
            +     D +I  F +RD+SS  N++ +L  N                     +     H 
Sbjct: 1088 S---ESDSSINAFIDRDMSSFTNTQVALLTNSGTVSNSSSSTTSPGASASATSIPNKTHK 1144

Query: 1152 -KIDRXXXXXXXXXXXXXXXXXXXXXXXXIAYIFRDEQ-KYESIKPRIDGQEMLDTVPPE 1209
             KIDR                        +AY+FRD+   YE I PRID  EM++TVPPE
Sbjct: 1145 RKIDRGFVVLLGLALALGTVAVLGIAGVIMAYVFRDDNGAYEPINPRIDENEMIETVPPE 1204

Query: 1210 KLMKFI 1215
            KLMK+I
Sbjct: 1205 KLMKYI 1210

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/1210 (33%), Positives = 625/1210 (51%), Gaps = 77/1210 (6%)

Query: 36   EFELPNLNFNNTSNSIQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQ 95
            E  +P  +  N +N  Q+L D+  + FY Y GQQNFT D N  ++    LIYYS++  + 
Sbjct: 32   EVTVPTFDVGNKNNQFQILDDINGISFYEYLGQQNFTTDAN--VTDVQRLIYYSNETFMS 89

Query: 96   L-EVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNIT 154
            L +  + +  IQ IIP+GDDSF+LSG G +N  +L  QL++N+T LSI  IFD  L +I 
Sbjct: 90   LSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLASQLVFNMTDLSITKIFDTPLRSIE 149

Query: 155  SILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDD 214
             + VD  +VYF G FT+     N++  I W+     +  LPF GFG  + +NSILKLNDD
Sbjct: 150  GVTVDGPLVYFMGNFTFN----NNTGAIMWDSRDRSINLLPFHGFGPYANINSILKLNDD 205

Query: 215  NILFVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDAGTAYFDQ 274
            NILF G F T+                          + L   + L+Y+ W       D 
Sbjct: 206  NILFAGHFSTVWNSSLLLQSNVSEESVRNTTS-----LLLNPSVPLQYSQWKTN-GELDS 259

Query: 275  NNFVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGI 334
            +  +C   S ++W V   +G+     P  ++PSKIRIYN+   +  VSLFR +T P+  I
Sbjct: 260  SQLICPDPSKDSWSVSATTGDFTCELPFQITPSKIRIYNSPDKDSQVSLFRFLTYPAGSI 319

Query: 335  MNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQE 394
            MNLTY+DPL+G +  CDAFCPL + + L++   N T+E      INNN+T++ W+ +YQE
Sbjct: 320  MNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDN-TAEANTVAIINNNSTNIQWTPNYQE 378

Query: 395  FAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGC---DTEXXXXX 451
            FA ++ +  ++L   A  SYG+   L+G +++Q S +A+ NN+ N P C   D +     
Sbjct: 379  FALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGNNSFNTPNCNNNDKDSNNTF 438

Query: 452  XXXXXXDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGT 511
                   N W        Y+   Y  + +P+P V +  +IQ  G++SI ++TPGC AD T
Sbjct: 439  TSSSLSPNNWTS---VGEYLTVGYTPNENPVPKVTYKIDIQHSGEYSINVFTPGCSADNT 495

Query: 512  CESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDL 571
            C +R IVN T+ D     +L+T LIYQNN+E+KYD +++G+L  S EIT+T+YS +    
Sbjct: 496  CSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLNSSCEITMTYYSGLYASN 555

Query: 572  DSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSDT-KTKVGNNSI 630
                IVADRVDL     N+  + L    + + L LNGLFQYQ+SNFT+D+   K+ N S+
Sbjct: 556  TVTTIVADRVDL-----NIISMDLSHRTEVSKLALNGLFQYQISNFTNDSIPMKIANTSL 610

Query: 631  HQLALSQFPSSVSLIGNTF-NNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETTRIE 689
            +Q AL+ F  SVSL      N+SI L+G+  N+  + LN+DL ++N+  + +    T  +
Sbjct: 611  NQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDLSVQNSTRLISTENFTTFQ 670

Query: 690  NYSQGLLFF-GQYNISSTNVVDNLSFNGTFSSFSQLGDN--VTTFANFTYEGSELLFFNN 746
             YS GL+   GQ N+S         F   F + +   D    T  AN T  G ELL FNN
Sbjct: 671  PYSNGLVMLDGQGNVS--------LFKDNFKNLNTTMDGSLATDVANITLNGDELLVFNN 722

Query: 747  DYLYNVSSESYIY-NNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLYG--NX 803
             Y+YNV+S+     N+++F  +V + GANS NDT+ LG +V+ +Y+  N+  ++    N 
Sbjct: 723  GYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVVQWQYAIANQSAQVNADFND 782

Query: 804  XXXXXXXXXXIVPYAAVFLNDTANLYAYKDGENSKI-IYGNNMTTSLDFSGTXXXXXXXX 862
                       VP   +FLND +  Y YK+   SK+ I  +N T+ L++ G         
Sbjct: 783  GIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYITNSNSTSGLEWYGEPETVVYDK 842

Query: 863  XXXXXXXXXITNNG-SSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSGNFT 921
                       +N  SS+L ++N++    +  ENLN    I+S++ F  N+T+LV+G+F 
Sbjct: 843  NDTLLMVGYYNDNTFSSTLSLTNLTSFDVIKEENLNVGSSISSLLYFAKNDTLLVAGDFE 902

Query: 922  LDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSITLAS 981
              + +C  +CLYNY + +W + AN+++ GS+  +QL+ +D IL+ G  +    + + +A 
Sbjct: 903  PSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQLYQNDTILVLGNLTLPQANDVNMAF 962

Query: 982  LDIKGYNIS--VLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPNTTSKY- 1038
            +++   ++   ++  D+ + + S I     I  W++  +  +    W  +S P T S   
Sbjct: 963  VNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVLFSFDGNSWTRVSVPGTDSSAT 1022

Query: 1039 -IESVEAVSIDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSINNFQVNE 1097
             I SV+ +S++           L   GEF  + +G + ++++   DW PY       V+ 
Sbjct: 1023 SISSVQFISME------GTDDALLLLGEFRHSEFGDIKSIVYNFRDWIPYL----LYVDG 1072

Query: 1098 DPAIT--LFENRDLS-------SLFNSKNSLPANIXXXXXXXXXXXXXXXXXXXXNKIEG 1148
                T  LF NRD+S        L NS   L                         K+  
Sbjct: 1073 PRQGTGHLFMNRDISLHNIAQIPLLNSTRVL----TNQSFASSTSSSVSSTSTTLPKVST 1128

Query: 1149 KHSK-----IDRXXXXXXXXXXXXXXXXXXXXXXXXIAYIFRDE--QKYESIKPRIDGQE 1201
             HSK     +DR                        +AYIFRD     Y+++ PR+D   
Sbjct: 1129 THSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENA 1188

Query: 1202 MLDTVPPEKL 1211
            M++T+PPEKL
Sbjct: 1189 MVNTLPPEKL 1198

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/1118 (35%), Positives = 605/1118 (54%), Gaps = 55/1118 (4%)

Query: 40   PNLNFNNTSN-SIQLL--GDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQL 96
            P  N  +++N S+QLL     + L F HY GQQNFT    S  SS N+LIYYS+D  I+L
Sbjct: 41   PQFNLQDSTNQSLQLLTSNGFDTLNFVHYNGQQNFTQPIIS--SSQNHLIYYSNDTYIRL 98

Query: 97   EVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDL-GNITS 155
                  T IQ IIP G D+F+LSG+G LNG+ L  QL+YNLT LS+ PIF+  L   + +
Sbjct: 99   LDIPYSTRIQHIIPYGQDAFILSGTGSLNGFELSNQLVYNLTDLSLTPIFENKLVPEVRT 158

Query: 156  ILVDEE--IVYFGGEFTYQTRSQN-SSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLN 212
            I  D +  +VYFGG F+Y     N S+ +I W+ +S++ I   F GFGS+S +N+ILKLN
Sbjct: 159  IFKDPDTNLVYFGGNFSYLLPDSNISNGLIIWDSSSNDTISYEFGGFGSNSVINNILKLN 218

Query: 213  DDNILFVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXI---QLEQQISL---KYATWD 266
             +++LF G F TL                          +   +L Q+I L   K++T D
Sbjct: 219  SNDLLFSGQFYTLDDPSILHIPYNITFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTAD 278

Query: 267  AGTAYFDQNNFVCEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRI 326
                Y ++N  +C     EAW  + ++G+LQ+  P ++ PSKIRI+N+   +D V+ FRI
Sbjct: 279  TND-YINKNQLICPTSEIEAWASDSKAGSLQITLPFSIRPSKIRIFNSPDPDDEVATFRI 337

Query: 327  VTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSV 386
                 N IM+L Y+DPL GQLKYC  FCPL N + L+  +SN   ++     ++NNTT +
Sbjct: 338  NPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDI 397

Query: 387  TWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTE 446
             WS +YQEFAF+N  D++ L   A  SYGS+  LSG+ LFQ     +AN + N+P C+ +
Sbjct: 398  KWSTTYQEFAFVNQFDLTTLEFQALSSYGSRVGLSGLSLFQSDIAVFANESYNKPSCNDQ 457

Query: 447  XX--------------XXXXXXXXXDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQ 492
                                     DN WY  L +  Y+A  Y S S  +PTV FYPN+ 
Sbjct: 458  TAYDNEDLIKAALPRVMGSSYSILSDNDWYTPLPNSDYLACTYLSSSKLIPTVTFYPNLL 517

Query: 493  AVGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGK 552
              G++++ M TPGC AD +C+SR IVNVT+ + TD ++L T LIYQ N   K+D+IFNG 
Sbjct: 518  YAGNYTVDMITPGCTADNSCDSRGIVNVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGY 577

Query: 553  LTVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQY 612
            L    +IT++FYS +  +  +  IVADR++L    ++       + +   ++ LNGLFQY
Sbjct: 578  LDPLVKITMSFYSGVYSNTGNFTIVADRINLIINSLDFVTTTSSNEIDIYNVTLNGLFQY 637

Query: 613  QLSNFTSDTKTKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQ-LQLNS-- 669
               N  ++      N++I+Q A S +P++VSLI   ++    L G + N +Q  Q+    
Sbjct: 638  PEYNSVNNLNENYTNSTINQYAYSNYPANVSLIAAAYDKDTLLVGGSINKLQEFQIEKNG 697

Query: 670  -DLELRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSF-NGTFSSFSQLGDN 727
             ++ L+NT    +    T I  YS GL+ +G   + S+     ++F N  F +     D 
Sbjct: 698  QNISLQNT--FKDLNSVTGIVPYSDGLIAYGDI-MDSSGSYKAITFTNNKFGTLGNFTDE 754

Query: 728  VTTFANFTYEGS-ELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIV 786
            + +F+N +   S E+L FNN Y YN S+     N + F  S+ + G N+ ND +  G + 
Sbjct: 755  IQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVS 814

Query: 787  RSEYSNFNEPLKLYGNXXXXXXXXXXXIVPYAAVFLNDTANLYAYKDGEN--SKIIYGNN 844
             +E  N    + +  N           I PY+AVFLND++ +YAY +     +++I+ N 
Sbjct: 815  ENENVNLTGVVSINANEQIKELNLGNNIYPYSAVFLNDSSTIYAYMEPNTRLNRLIHSNG 874

Query: 845  MTTSLDFSGTXXXXXXXXXXXXXXXXXITNNGS-SSLVISNISDGMSLASENLNNYGYIT 903
               S  +                    I++     S  I N++    +A+E LN    I+
Sbjct: 875  EQISWSWKNKISSMAFFPNESLLSVGTISDKDVFPSFSILNLTSNKVIANETLNKNSQIS 934

Query: 904  SMIDFNSNNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQI 963
            S++ F  N+++LV GNFT  D  C G+CL+NY TK WS F N+T++G++ +++L N+  I
Sbjct: 935  SLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNI 994

Query: 964  LISGLFSAQNYSSITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKS 1023
            LISG  S    ++I LA L++  YN+S+L  ++   ++SF   G  I  W++ T+ +Y +
Sbjct: 995  LISGTLSTNKSANIDLALLNLNTYNVSILLQNTN--LTSFEFTGNQIAAWNSSTLFQYNN 1052

Query: 1024 EKWNEISFPN-TTSKYIESVEAVSIDLQNSTSNVSK-------ILFAYGEFNSTLYGRLN 1075
            E W++I  PN T S  ++S+    I  +NS+S + K       I+ A G+F S   G + 
Sbjct: 1053 EAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKRALRDTNIMVATGQFYSKGLGTVQ 1112

Query: 1076 AMLFRAGDWKPYFSINNFQVNEDP--AITLFENRDLSS 1111
            A+ + +  W PYF   N   N D   +I +F N+D+SS
Sbjct: 1113 ALYYTSDTWIPYF-YGNLTNNMDTSNSINIFPNKDISS 1149

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 27/37 (72%), Gaps = 1/37 (2%)

Query: 1180 IAYIFRDEQ-KYESIKPRIDGQEMLDTVPPEKLMKFI 1215
            +++IFRD +  YES+KPR    EM D VPPEKLM F+
Sbjct: 1241 LSFIFRDSRGDYESLKPRTTEHEMFDAVPPEKLMPFV 1277

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1204 (32%), Positives = 629/1204 (52%), Gaps = 49/1204 (4%)

Query: 37   FELPNLNFNNTSN-SIQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQ 95
            +++PNL+ + + N  +QLLG+ +++    Y GQ+NFT  G    +  N LIYYS++  ++
Sbjct: 35   YDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFT--GEVSGNPENALIYYSNETFLE 92

Query: 96   LEVGSNDTDI---QKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGN 152
            +   S+ +++     I+P  DD+F+LSG+G ++G+ L RQLL+NL++L  + IF QDL  
Sbjct: 93   IYSSSDSSEVFSVDHIVPFKDDAFILSGAGSISGHQLSRQLLFNLSSLEFREIFGQDLAQ 152

Query: 153  ITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLN 212
            + +I  + + V+FGG F Y+  +Q   S++ W+   D V  LPF GFG +S VNSIL L+
Sbjct: 153  VNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVEVLPFGGFGKNSTVNSILNLD 212

Query: 213  DDNILFVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDAGTAYF 272
            + NILF G F  +                           +L  QISL+ A W       
Sbjct: 213  NSNILFAGNFSAVDNTQQLNNINVSNTSNTSVP-------ELGHQISLQSAAW-VSDGTL 264

Query: 273  DQNNFVCEAGSSEAWIVEGRS-GNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPS 331
            D++   C +  S  W+  G + G  +L  P    PSK+R++NA  +++ VSLFRIVT+PS
Sbjct: 265  DKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFNARDSDEQVSLFRIVTTPS 324

Query: 332  NGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSES 391
            NGIMNLTY+DP TG+L  CDA+CPLL+S  L   SS S    + + F   N T++ WSES
Sbjct: 325  NGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSKSYPGDQVQYF--ENRTTLQWSES 382

Query: 392  YQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXXXX 451
            +Q+FAF+NN+ VS LT IA DSYGS   L+GIEL++ +++ YANNTLN P C  +     
Sbjct: 383  FQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVYANNTLNAPNC-AQGSATS 441

Query: 452  XXXXXXDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGT 511
                   + W  G    +Y++ + Q DS   P V FYP+I   G ++I + TPGCL D +
Sbjct: 442  NALLSNSSAWDSGSSEGNYLSTSVQ-DSETNPFVIFYPSIIYPGVYTIDVLTPGCLEDSS 500

Query: 512  CESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDL 571
            C++R I+N T+ D  + T+L +  IYQNN+  K+D +++G L    ++TL F   I    
Sbjct: 501  CQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVKVTLEFDGAINSGT 560

Query: 572  DSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSDTKTKVGNNSIH 631
            +  ++VA ++      +N++D        +TS  +NGL  Y  SN TS   +++G+ S  
Sbjct: 561  EVPVMVASKI-----VVNIEDFDQSVFENNTSGFINGLLHYSTSN-TSSFLSELGSYSAT 614

Query: 632  QLA---LSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETTRI 688
             LA   +S+ P   ++  N F + + L  +   + +L+L ++L +        G + + I
Sbjct: 615  DLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLANNLSIEEYTFETIGKDISTI 674

Query: 689  ENYSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANFTYEGSELLFFNNDY 748
              YS GL+  G +N SS        FNGTF + ++    V TF+N T   +E+L F+ + 
Sbjct: 675  SEYSGGLIIVGTFNGSSEPAAR--GFNGTFFNLTEFNSTVRTFSNLTLGQTEMLIFDKNI 732

Query: 749  LYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLYGNXXXXXX 808
            + N ++   IY+ +  T  V + G N  NDTL  G +++++Y+N N    +  N      
Sbjct: 733  ILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSFFISTNSEEVSQ 792

Query: 809  X--XXXXIVPYAAVFLNDTANLYAYKDGENSKIIYG------NNMTTSLD-FSGTXXXXX 859
                    +PY A F++++   YAY + +N+   +G      +  T  L  +SG      
Sbjct: 793  NFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQLSAWSGKVGAMA 852

Query: 860  XXXXXXXXXXXXITNNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSGN 919
                           +  S L+++N S G SLAS   ++   + S+I F  NN++LV G+
Sbjct: 853  SSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEISLNSIIFFARNNSVLVGGS 912

Query: 920  FTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSITL 979
            F +++  C G+CL+NY  KKWS F N++I+G I  M+++N+  +LI+G F       ++L
Sbjct: 913  FRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAGSFRLNETDGVSL 972

Query: 980  ASLDIKGYNISVLSDDSKIEISSFIH-DGQS--ITVWSNDTIMEYKSEKWNEISFPNTTS 1036
            AS+ +K  +  +L  +  I ++ F+  DG S  +  +S+ ++++ +S KW +IS   T +
Sbjct: 973  ASICLKDSSSEIL-HEGNITLNGFVSMDGSSNNVVAFSDTSLLQLESGKWQQISTNFTEN 1031

Query: 1037 KYIESVEAVSID---LQNSTSNVSKILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSINNF 1093
               + ++   +     +    + SK+L   G      +G +NA  + +G+W P+ S N  
Sbjct: 1032 SKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHAKFGSINAAFYDSGEWTPFLSSNQA 1091

Query: 1094 QVNEDPAIT-LFENRDLSSLFNSKNSLPANIXXXXXXXXXXXXXXXXXXXXNKIEGKHSK 1152
              + D   + +F NRDLS   + K  L                        N ++ K  K
Sbjct: 1092 TSSSDLETSHVFLNRDLSDFLDYKGYLQGTFSSNTSSGTSGTPSPSGSSPSN-LQRKKKK 1150

Query: 1153 IDRXXXXXXXXXXXXXXXXXXXXXXXXIAYIFRDE-QKYESIKPRIDGQEMLDTVPPEKL 1211
            IDR                         +Y F D    Y+  KPR D  EM+DTVPPEKL
Sbjct: 1151 IDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDSGDGYQLSKPRTDENEMIDTVPPEKL 1210

Query: 1212 MKFI 1215
            M+FI
Sbjct: 1211 MRFI 1214

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/1204 (33%), Positives = 615/1204 (51%), Gaps = 61/1204 (5%)

Query: 36   EFELPNLNFNNTSNSIQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQ 95
             +E PN +    S  +  + + E L    Y GQQNFT   N      ++L+YYS+D  ++
Sbjct: 34   RYEAPNWD----SPDLTYMNNFEELTVISYTGQQNFTVQANE-----SSLLYYSNDTFVK 84

Query: 96   LEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITS 155
            L   S +T +  I+P+ +DSF+LSG+G +NG AL +Q+L NLT+L+  PIF   + N+  
Sbjct: 85   LFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQQILLNLTSLTTSPIFPSAVENVMD 144

Query: 156  ILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDN 215
            IL   E V F G F+    ++     + W++ ++     PF+GFG +S VNS++KLN DN
Sbjct: 145  ILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTTELFPFKGFGENSIVNSVVKLNSDN 204

Query: 216  ILFVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDAGTAYFDQN 275
            ILF G F  +                          +Q +Q + LK ++        D  
Sbjct: 205  ILFAGSFQEI----QNASLLQEFGNATNSSHEDLTSLQFDQSVPLKLSSITGENVQSDI- 259

Query: 276  NFVCEAGSSEAWIV-EGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGI 334
              +C +G    W   E     LQ +  N + PSK+RIYN+      +SLFRI+T PSNGI
Sbjct: 260  -LLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYNSVEENSEISLFRIITGPSNGI 318

Query: 335  MNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQE 394
            MNLTY+DP +G+LK CDA+CPLL+   L   S NST+  +  V INNN+T++ WSESYQE
Sbjct: 319  MNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPK-SVGINNNSTNLKWSESYQE 377

Query: 395  FAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXXXXXXX 454
            FAF+N+I V+ L  +A  SYGS  AL  IE+F+     YANN+ N+P C  E        
Sbjct: 378  FAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYANNSYNEPNC--ESVTEYSKA 435

Query: 455  XXXDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCES 514
                + WY   +SD+YI+ N   +   +P V F+PNI   G ++  +YTPGCL D +C  
Sbjct: 436  ELSSDNWYTTDESDTYISTNIDDN---IPYVTFHPNITYPGRYTFNIYTPGCLQDNSCSK 492

Query: 515  RSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSA 574
            R IVNVT++D +   VL++ LIYQ NNE K+D ++ G L  +PEI +T+   I      +
Sbjct: 493  RGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGSAPEIIVTWDKAI--GESDS 550

Query: 575  IIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSDTKTKVGNNSIHQLA 634
            ++V DR+ +   YI  D I + SN   T+  LNGLFQY  +N T+   +   N++ +  A
Sbjct: 551  VMVVDRLGVITEYI--DTISISSN--DTTFHLNGLFQYNTANVTASIFST--NDTFNDYA 604

Query: 635  LSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETTRIENYSQG 694
            L  FP   +L   + NN I + G+ + I +++LN +  + ++  +   G TT I  YS G
Sbjct: 605  LYNFPLDANLYAASLNNDILIGGNFNGIAKVELNDEALISSSQKLGTSGYTTGIFEYSNG 664

Query: 695  LLFFGQYNISSTNVVDNLSFNG-TFSSFSQLGDNVTTFANFTYEGSELLFFNNDYLYNVS 753
            LL  G Y + + +  + LS++G  F+SF QL + +    NFT +G ELL F+N Y++NVS
Sbjct: 665  LLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVNFTIDGHELLLFDNAYIFNVS 724

Query: 754  SESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLYGNXXXXXXX---X 810
            +  Y+ N++ F  +  + G NS ND+LL G+ ++      N    L  +           
Sbjct: 725  ANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLASLSSDGQVSSPTLPEL 784

Query: 811  XXXIVPYAAVFLNDTANLYAYKDG-----ENSKIIYGNNMTTSLDFSGTXXXXXXXXXXX 865
               + PY A ++NDT+  YA ++G     ++  +I   N ++ +                
Sbjct: 785  PTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHMLQIQWSAPINAFLYDN 844

Query: 866  XXXXXXITNNGSSS-------LVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSG 918
                  I  NGS+S         I N++   ++A  N +    + SM+ F+SNN+ILV G
Sbjct: 845  VPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFSTNERVNSMVSFSSNNSILVGG 904

Query: 919  NFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQ-ILISGLFSAQNYSSI 977
            ++ +D  +C+ +CLYNY TK+W++F N +I G I +MQ  +  + +L+ GL    N S+I
Sbjct: 905  SYEID--NCNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNI 962

Query: 978  TLASLDIKGYNISVLSDDSKIEISSFIHDGQS---ITVWSNDTIMEYKSEKWNEISFPNT 1034
             L S+++ G NI          + SF+    S   I    N  I+  +S  W+       
Sbjct: 963  QLLSVEV-GSNIFSTVKSGTEPLLSFVPIDDSTDNIIAQMNSEILRLESGTWSSFGPQLN 1021

Query: 1035 TSKYIESVEAVSIDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFRAG--DWKPYFSINN 1092
                +   + +S          S I+   G  NS+ +G L ++++      W+PYF I++
Sbjct: 1022 NDSIVSGFKVLSGTESKKRDEGSHIVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVISD 1081

Query: 1093 FQVNED-PAITLFENRDLSSLFNSKNSLPANIXXXXXXXXXXXXXXXXXXXXNKIEGKHS 1151
             +  E  P+ + F+N +   L +S+  L +N                     +    K  
Sbjct: 1082 PKEQESLPSSSFFQNVNDLYLSSSQTVLQSN-----NSDTSASSTPTPSTTSSSHSTKDK 1136

Query: 1152 KIDRXXXXXXXXXXXXXXXXXXXXXXXXIAYIFRDEQKYESIKPRIDGQEMLDTVPPEKL 1211
            KIDR                        I Y F +   YES+KPRI+  EMLDTVPPEKL
Sbjct: 1137 KIDRGFIVLIGLALALATVAVIGLIGALICYFFINNNGYESLKPRINQDEMLDTVPPEKL 1196

Query: 1212 MKFI 1215
            MKFI
Sbjct: 1197 MKFI 1200

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/1214 (33%), Positives = 608/1214 (50%), Gaps = 69/1214 (5%)

Query: 36   EFELPNLNFNNTSNS-IQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVLI 94
            ++  P+L+ +   NS + +  D +   +Y Y+GQQ FT   +      N+LIYYS++  +
Sbjct: 34   QYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTGLADE---RKNSLIYYSNNTYV 90

Query: 95   QLEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNIT 154
            QL    +  +I+KI+P GDDSF+LSG G   G+ L  QL+YNL++  I  I  + L ++ 
Sbjct: 91   QLAELPDGAEIKKIVPWGDDSFILSGRGVFEGHRLEHQLIYNLSSFEITEILKEPLEHVN 150

Query: 155  SILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDD 214
             IL D E+VYFGG FTY   + +  SV+ W+ T      LPF GFG  S VN+I+KL+D 
Sbjct: 151  DILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSLLPFYGFGQGSVVNNIIKLDDS 210

Query: 215  NILFVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDAGTAYFDQ 274
            NILFVG F T+                          I+     SL++++        + 
Sbjct: 211  NILFVGKFSTI-----DNTALLPHRNVSSSFLSNSTNIETNALASLRFSSL-VHDGTLNS 264

Query: 275  NNFVCEAGSSEAWIVEGRS-GNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNG 333
            + FVC  GS+++W +   + G L +   N ++PSKIRIYN+  + + V+LFRIVTSPS  
Sbjct: 265  SAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYNSKDSNNQVNLFRIVTSPSRS 324

Query: 334  IMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQ 393
            IMN+TYVDP+TG L  CDA+CPL   S L   + NSTS      F NNN   V W+ +YQ
Sbjct: 325  IMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENSTSSV-MAAFPNNNNVLVKWTAAYQ 383

Query: 394  EFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXXXXXX 453
            EFAF+N + +  LT IA DS+G    L GIELFQ  +  Y NNTLNQP CD++       
Sbjct: 384  EFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNTLNQPNCDSQ-QNFPAS 442

Query: 454  XXXXDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCE 513
                D  WY+GL   SY+A ++ +     P+V   P+I   G +++ + TPGCL D TC 
Sbjct: 443  VVSKDTVWYQGLPDQSYMATSFTAGK---PSVTLTPSIPYPGIYTLNLVTPGCLTDNTCA 499

Query: 514  SRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDLDS 573
             R IVNVT+    +GT L  + IYQNN  +KYD +F G L  SP + L +   I P   +
Sbjct: 500  FRGIVNVTI-RAQNGTHLMNRWIYQNNENLKYDPLFRGYLDDSPNVVLEWIGPIDPAAAN 558

Query: 574  AIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFT-SDTKTKVGNNSIHQ 632
             ++VADRV  T    +++D+ + +   +++L LNGLFQY  SNFT ++  T VG+ +I Q
Sbjct: 559  NVMVADRV--TSIIDSIEDLEMKNGTSNSNL-LNGLFQYAASNFTNTNLSTLVGSTNIDQ 615

Query: 633  LALSQFPSSVSLIGNTFNNSIFLAG-STSNIVQLQLNSDLELRNTVV----VDNGGETTR 687
              +   P S SL G  +N+++F+   S   + ++    D +  + +V    +D  G  T 
Sbjct: 616  YPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKD-DWNDIIVDPQLIDTEGPVTG 674

Query: 688  IENYSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANFTYEGSELLFFNND 747
            I  YS GL      N   TN+  +LSFNG+ S+  +      +  N T +GSE+L F+N 
Sbjct: 675  IFPYSNGLALTVHSN--QTNMASSLSFNGSISTIFRSNAPSLSILNLTIDGSEILVFDNG 732

Query: 748  YLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKLYGNXXXXX 807
            Y+YNVSS+S I N+     S+L+ GAN  +D +L GN+  +++   N  + +  +     
Sbjct: 733  YVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNGAIAIDADSNEVV 792

Query: 808  XXXXXXI---VPYAAVFLNDTANLYAY--KDGENSK---IIYGNNMTTSL--DFSGTXXX 857
                  +   + Y  +F+ND+++ YAY  K   +SK   ++YG +    L  D S     
Sbjct: 793  TSGLPSVDDGIIYRGLFINDSSSAYAYYSKSLGSSKGGIVVYGEHEPEYLSTDDSTVNDM 852

Query: 858  XXXXXXXXXXXXXXITNNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVS 917
                           T+ G +SL I ++S   +   E       I +M+ F  N T+LV 
Sbjct: 853  LYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPIKETFEIGEVINTMVLFGRNYTLLVG 912

Query: 918  GNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYSSI 977
            G FT +   C  +CLYNY T  W+ F +  I G I ++Q  + + ++++GL ++ +   +
Sbjct: 913  GTFTRN--GCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLMVAGLLASSDSKDL 970

Query: 978  TLASLDIKGYNISVLSDDSKIEISSFIH------DGQSITVWSNDTIMEYKSEKWNEISF 1031
             L  +D+   N+ ++S        +F H          +     + +  +   +W  IS 
Sbjct: 971  QLVEIDLS--NMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFHFVDGQWKNISP 1028

Query: 1032 PNTTSKYIESVEAVSIDLQNSTSNVSK------ILFAYGEFNSTLYGRLNAMLFRAGDWK 1085
              +    I  +  +S D     S + +      ++   G F+S  YG +NAM +    W 
Sbjct: 1029 DTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGNFSSPDYGDINAMYYDFNGWN 1088

Query: 1086 PYFSINNFQVNED---PAITLFENRDLSSLFNSKNSLPANIXXXXXXXXXXXXXXXXXXX 1142
            PY+     + N D   P   LF N+D+S  F S + +                       
Sbjct: 1089 PYYFSVPRESNSDEVIPQGQLFLNKDVS--FTSSSQI--------YLSNDNDNDDTPAAS 1138

Query: 1143 XNKIEGKHS-KIDRXXXXXXXXXXXXXXXXXXXXXXXXIAYIFRDEQKYESIKPRIDGQE 1201
                  KH+ K+ +                         AY+F D   YE +KPRI+  E
Sbjct: 1139 EPATHEKHTKKLAKIFVVLIALALALATVAVLGVVGVLFAYLFGDHNAYEPLKPRINEAE 1198

Query: 1202 MLDTVPPEKLMKFI 1215
            ML TVPPEKLMKFI
Sbjct: 1199 MLKTVPPEKLMKFI 1212

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1221 (32%), Positives = 596/1221 (48%), Gaps = 92/1221 (7%)

Query: 35   QEFELPNLNFNNTSNS-IQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVL 93
            + ++ P L+ +   N  + +  D +  ++Y+Y+GQQ FT       SS   LIYYS+   
Sbjct: 33   KHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKGQQLFTGQEQHQGSS---LIYYSEGTY 89

Query: 94   IQLEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNI 153
            +QL    +DT +++I+P G DSF+LSG+G L    L  QL+YNL+TL +  I  Q L ++
Sbjct: 90   VQLAKLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLSTLEVTEILPQSLESV 149

Query: 154  TSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLND 213
              ILVD ++VYFGG+FTY   +++  S + WN TS     LPF GFG  S VN+ILKL+ 
Sbjct: 150  NDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGGFGRGSSVNNILKLSG 209

Query: 214  DNILFVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDAGTAYFD 273
              +LFVG F  L                          I+     SL+Y+T  +   + D
Sbjct: 210  SGVLFVGRFSNL--EAASYAETASVLASTEKPQLNVTTIETNALTSLRYSTITS-DGHLD 266

Query: 274  QNNFVCEAGSSEAWIVEGRS-----GNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVT 328
            +  F+C   + ++W V         G L +   + + PSKIRIYN+    + + LFRIVT
Sbjct: 267  KGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKKNGNEIKLFRIVT 326

Query: 329  SPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTW 388
            SPS  IMN+TY+DP TG+L  CDA+CPL+  S L + ++ S      R+ +N+    + W
Sbjct: 327  SPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAESGPADVARL-VNDEKVLIKW 385

Query: 389  SESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXX 448
            +  YQEFAFIN I +  +  IA DSYG+   L G+ELFQ  + AY N+TLNQP C  +  
Sbjct: 386  TPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVNSTLNQPNCGEQQL 445

Query: 449  XXXXXXXXXDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLA 508
                      N W++G    SY++AN    +   P V   P I   G +++ +YTPGC  
Sbjct: 446  SPFSTTA---NIWHQGATDASYLSANVVESN---PMVNVKPVIPHSGTYTLNLYTPGCED 499

Query: 509  DGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTIL 568
            DGTC+ R IVNVT+L  ++GT L T+ IYQNN  +KYD ++ G L  +P + + + S I 
Sbjct: 500  DGTCDYRGIVNVTLL-ASNGTTLMTRWIYQNNYRLKYDPLYTGHLDPNPTVRMEWVSPIN 558

Query: 569  PDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSDTKTKVGNN 628
              ++  I+VADRV      ++  D +     KS    LNGLFQY  +  + D   +    
Sbjct: 559  SAVNRKIMVADRVSAIIDSLDGLDDIRHPREKS----LNGLFQYTPAGSSLDNGIQ---K 611

Query: 629  SIHQLALSQFPSSVSLIGNTFNNSIFLA-GSTSNI-VQLQLNSDLELRNTVVVDNGGETT 686
             I++   +  P  VSL+G  ++  + L   ST +I V     +D    +    D  G   
Sbjct: 612  YINKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWNDVDVTRQDVPGSLN 671

Query: 687  RIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANFTYEGSELLFFNN 746
             I  YS+GL+F G++N+SS      L ++G F SF  L    ++  N T +GSELL FNN
Sbjct: 672  GISPYSKGLVFTGKFNLSS-GPSSALHYDGNFGSFFDLNSETSSIINMTIDGSELLLFNN 730

Query: 747  DYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNEPLKL--YGNXX 804
             ++YN S+ S +  ++MF  S L+  ANSNND L  G+I   ++ + +  + L   GN  
Sbjct: 731  KFIYNTST-SQMLTSSMFQLSALSAAANSNNDLLFTGSIADIKHGSAHGAVALDAEGNIF 789

Query: 805  XXXXXXXXXIVPYAAVFLNDTANLYAYKD-GENSKIIY--------GNNMTTSLDFSGTX 855
                        +  V+LNDTA  YAY     NS +          GNN   S + +   
Sbjct: 790  TSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETPGNNFNLSNNIATVR 849

Query: 856  XXXXXXXXXXXXXXXXITNNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTIL 915
                                   +L++ ++     +A E LN    I S++ F  +NT+L
Sbjct: 850  EMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNPGERINSIVLFGEDNTLL 909

Query: 916  VSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYS 975
            V G+F  D   CH +CLYN+  + WSAFA+  I G I ++Q  N+  ++  G  + Q+  
Sbjct: 910  VGGSFEKD--GCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNRNLIAVGSMTVQSRP 967

Query: 976  SITLASLDI--------------KGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEY 1021
            +I   + D+              + +N  +   DS  E  +   DG+   VW       Y
Sbjct: 968  NILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEYVA--EDGKQ--VW------HY 1017

Query: 1022 KSEKWNEISFPNTTSKYIESVEAVSID---LQNSTSNVS-KILFAYGEFNSTLYGRLNAM 1077
               +W  ++  +     I+ +  + ++    QN  + V  +++  +G+ NS+ YG +NAM
Sbjct: 1018 SGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNELVVIHGQMNSSEYGEINAM 1077

Query: 1078 LFRAGDWKPYFSINNFQVNED---PAITLFENRDLSSLFNSKNSLPANIXXXXXXXXXXX 1134
             +   +W+PY+        E+   P   +F N+D+S    +  SLP  +           
Sbjct: 1078 HYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDISR--QTTTSLPLEVVVSDSPPTA-- 1133

Query: 1135 XXXXXXXXXNKIEGKHSKIDRXXXXXXXXXXXXXXXXXXXXXXXXIAYIFRDEQKYESIK 1194
                        E K  K+ +                        +AY F D   Y+ +K
Sbjct: 1134 ------------EPKR-KLAKGYVVLIALGLALATIALLGIIGVILAYAFGDHNAYQPLK 1180

Query: 1195 PRIDGQEMLDTVPPEKLMKFI 1215
            PRI+  EML TVPPEKLMKFI
Sbjct: 1181 PRINEDEMLKTVPPEKLMKFI 1201

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  560 bits (1444), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 385/1224 (31%), Positives = 631/1224 (51%), Gaps = 86/1224 (7%)

Query: 35   QEFELPNLNFNNTSNS-IQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNLIYYSDDVL 93
            + FE+P+L+ + ++N  IQLLG+ +NL +Y Y GQ NFT  G S   +  +LIY+S+  L
Sbjct: 33   KNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQDNFT--GISDEKARESLIYHSNGTL 90

Query: 94   IQLEVG--SNDT-DIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDL 150
            ++L     SN++  +  +IP+ DDSF+LSG+G ++G  L  Q+++NL+ LS   IF+Q L
Sbjct: 91   LELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAVLDHQVVFNLSDLSYTAIFNQSL 150

Query: 151  GNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILK 210
              + +I V+    YFGG F ++   Q++  +I W+   +EV  LPF G G DS VNSIL 
Sbjct: 151  SPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFVKNEVETLPFGGLGKDSNVNSILV 210

Query: 211  LNDDNILFVGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDAGTA 270
            L+D+NILF G F T+                           +L  +I LK A W +  +
Sbjct: 211  LDDNNILFAGNFSTIDEKSALNSTLGINSTSDSAP-------ELSHKIPLKTAKWTSDGS 263

Query: 271  YFDQNNFVCEAGSS-EAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTS 329
               +++ VC + S+  AW+  G +G  +L+  +T+ PSK+R++NA T ++ VSLFR++T+
Sbjct: 264  -LQKDDLVCPSNSATSAWLGTGTTGQFELSIAHTIRPSKLRLHNARTLDEEVSLFRVITT 322

Query: 330  PSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWS 389
            PSNGIMNLTY+DP +G+L+ CDA+CPLL++  L  A S + S T Q  F+NN TT V WS
Sbjct: 323  PSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAKSKAAS-TDQVEFLNNQTT-VQWS 380

Query: 390  ESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXX 449
            ESYQ+FAF+N++ V+++T +A DSYGS   ++G EL++D  + YAN++ N P C +    
Sbjct: 381  ESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYEDDFSVYANDSFNVPDCSSTSNY 440

Query: 450  XXXXXXXXDNGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLAD 509
                       W +G   + Y+    + +S   P+V FYP I   G ++I + TPGCLAD
Sbjct: 441  SKASLSASQ--WDQGSSDEDYVYTLVE-NSQEAPSVTFYPQIVYSGLYTINVLTPGCLAD 497

Query: 510  GTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILP 569
            G+C+SRS+VN ++ D  +GT+LS+  IYQNN+  KYD +++G L    ++ L +   I  
Sbjct: 498  GSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYSGYLENEVKVVLEYEGAIGN 557

Query: 570  DLDSAIIVADRVDLTPTYINVDDILLDSNL---KSTSLKLNGLFQYQLSNFTSDTKTKVG 626
               S ++VA ++      +N D+   DS++   K  + KLNGL  Y LSN +S  +    
Sbjct: 558  TEGSPMMVAGQIS-----VNTDE--FDSSVFTDKYKTGKLNGLLHYSLSNSSSYLQNFKS 610

Query: 627  NNS--IHQLALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGE 684
            NNS  + Q ++S F  + +   + F N I L  S+  + +L+++   ++R     + G E
Sbjct: 611  NNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEIDQQFDVRTVTTEEVGDE 670

Query: 685  TTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQLGDNVTTFANFTYEGSELLFF 744
             + +  +S+GL   G ++ S+        +NG+F        NVTTF NFT +G+EL+  
Sbjct: 671  VSGVFAFSEGLGVIGTFDGSTKGAK---FYNGSFFDIPLSHSNVTTFTNFTLDGAELVSL 727

Query: 745  NNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFN---------- 794
             N Y  N ++++   N++  T +  + G N+  +T+  G++ R+EY++ N          
Sbjct: 728  GNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLNGSFFISSNSQ 787

Query: 795  EPLKLYGNXXXXXXXXXXXIVPYAAVFLNDTANLYAYKDGENSKIIYG----NNMTTSLD 850
               +L G+            + Y A +++++   YA+ D  ++   YG     +M    D
Sbjct: 788  SSSRLRGSQGR---------IWYDATYIDNSTTGYAFYDPSSTNGSYGVSIYKDMAKERD 838

Query: 851  FS----GTXXXXXXXXXXXXXXXXXITNNGSSSLVISNISDGMSLASENLNNYGYITSMI 906
             S                            S  L+++N++ G   A+        I S+I
Sbjct: 839  LSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEWKTNVSINSLI 898

Query: 907  DFNSNNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILIS 966
             F+ N ++LV G+F   + +C G+CL++Y  K WS F ++ I GSI  M+++N   +++ 
Sbjct: 899  FFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLVLG 958

Query: 967  GLFSAQNYSSITLASLDIKGYNISVLSDDSKIEISSFIHDGQS---ITVWSNDTIMEYKS 1023
            G F   +   + LAS+ +   + ++L   ++  +     DG+    + V +ND +    +
Sbjct: 959  GFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVAVSAND-LFRLTN 1017

Query: 1024 EKWNEISFPNTTSKYIESVEAVSIDL--QNSTSNVSK-ILFAYGEFNSTLYGRLNAMLFR 1080
              W  IS     S     +    I    QN      K  L   G+     YG+++A L+ 
Sbjct: 1018 NNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNSLLITGDLLHKTYGKISAALYD 1077

Query: 1081 AGDWKPYFSINNFQVNEDPAIT--------LFENRDLSSLFNSKNSLPANIXXXXXXXXX 1132
              DW PYFS         PA +        ++ N+D+SS FN +  L ++          
Sbjct: 1078 FNDWIPYFSTT-------PATSTDGLGQSRIYSNKDISSAFNYQGVLQSS-RGGNSSSVP 1129

Query: 1133 XXXXXXXXXXXNKIEGKHSKIDRXXXXXXXXXXXXXXXXXXXXXXXXIAYIF-RDEQKYE 1191
                       +++  K +KI R                        + + F +   KY+
Sbjct: 1130 SGTSSPTSSSPSQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQ 1189

Query: 1192 SIKPRIDGQEMLDTVPPEKLMKFI 1215
            S++PR D  EM+DTVPPEKLM+FI
Sbjct: 1190 SLEPRADESEMIDTVPPEKLMRFI 1213

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  539 bits (1388), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 364/1109 (32%), Positives = 574/1109 (51%), Gaps = 71/1109 (6%)

Query: 42   LNFNNTSNS-IQLLGDVENLQFYHYEGQQNFTDDGNSGISSTNNL--IYYSDDVLIQLEV 98
            LNF+++ N+ IQLLG +E   +Y+Y+GQQNFT    +  SS N L  IYYS++ L++L+ 
Sbjct: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFT----TASSSQNELELIYYSNNTLLRLDA 57

Query: 99   GSNDTDIQKIIPVGDDSFVLSGSGHLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSILV 158
               D +++ IIP  DD F+LSG G ++G  L RQ+L NLT LS +PIF+++LG + SI V
Sbjct: 58   VPTDVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFV 117

Query: 159  DEEIVYFGGEFTYQTRSQNSSSVISWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNILF 218
            D E+VYFGG+ TY     +  SV+ WN T++    LPF GFGS+S VNSI++L ++N+LF
Sbjct: 118  DNEVVYFGGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLF 177

Query: 219  VGMFDTLGXXXXXXXXXXXXXXXXXXXXXXXXXIQLEQQISLKYATWDAGTAYFDQNNFV 278
             G F  L                           ++ QQISL+ ATW+A +   D + F+
Sbjct: 178  TGQFAKLENNSFVSKTNRTRNFSISMEDS-----EVGQQISLRQATWNANSN-LDVDAFI 231

Query: 279  CEAGSSEAWIVEGRSGNLQLNFPNTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMNLT 338
            C     +AW  EG  G +  NFPNT++ SKIRIYN    ++ +SLFR++  P NGI+NLT
Sbjct: 232  CPNSDQQAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLT 291

Query: 339  YVDPLTGQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEFAFI 398
            Y+DP++  +K+C   CPL     L  A  N T E+    FINNN+T++ W+E YQEFAF+
Sbjct: 292  YLDPISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFV 351

Query: 399  NNIDVSALTLIAQDSYGSKTALSGIELFQDSHTAYANNTLNQPGCDTEXXXXXXXXXXXD 458
            N + +++L  +A +SY     LSG +++QDS   + NN+ N+P C +             
Sbjct: 352  NQLPITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSS-NDIASYVKLSG 410

Query: 459  NGWYKGLDSDSYIAANYQSDSSPLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESRSIV 518
            NGW+   + +SY+A +Y  +    P++ ++  I   G++ + + TPGC  D TC +R IV
Sbjct: 411  NGWFTVANDNSYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIV 470

Query: 519  NVTVLDPTDGTVLSTQLIYQNNNEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAIIVA 578
            NVT  D ++G +L + LIYQNNN +KYD+IF G L  S  + + +YS I  +  +A +V 
Sbjct: 471  NVTTFDNSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVV 530

Query: 579  DRVDLTPTYINVDDILLDSNLKSTSLKLNGLFQYQLSNFTSDT---KTKVGNNSIHQLAL 635
              VD+    I+  + + D      SL LNG+F+Y  SNFT D      K+    +    +
Sbjct: 531  GVVDVVRVSIS-SEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGV 589

Query: 636  SQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQLNSDLELRNTVVVDNGGETTRIENYSQGL 695
            S F    S+     N +++L  +  ++ +L         N++   NG      EN   GL
Sbjct: 590  SNFNKGASIFAVDQNQNLYLGSTNGSVYEL---------NSL---NGSSVPSTENNLSGL 637

Query: 696  LFFGQYNISSTNVVDNLSFNGTFSSFSQLG--------------------DNVTTFANFT 735
            +  G Y++    V+        F S +  G                    D++    N T
Sbjct: 638  I-NGMYSVEEGLVI--------FGSIAHRGREYGAVILNKSITPLDIVANDSIQASFNST 688

Query: 736  YEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIVRSEYSNFNE 795
              GS LL F+N  ++N++S     N +     +   G NSN+D LL+GNIV    +  NE
Sbjct: 689  LFGSNLLVFDNSTIFNMTSFMVFENTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNE 748

Query: 796  PLKLYGNXXXXXXXXXXXIVPYAAVFLNDTANLYAYKDGENSKIIYGNNMTTSLDFSGTX 855
             L +  N                A++LNDT  LY+   G  +     +       +  T 
Sbjct: 749  SLLISSNGTYSPFSLSDNDTIEGAIYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTV 808

Query: 856  XXXXXXXXXXXXXXXXITNNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTIL 915
                              +N S  ++I   S  +   + NL  +  I ++++F SN T L
Sbjct: 809  VPVFYSNGQQLLGAIQENSNKSQIVLIDLFSSQVINDTGNLTMHK-INAIVNFASNATAL 867

Query: 916  VSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLWNSDQILISGLFSAQNYS 975
            V G+F+L +  C G+CLYNY    WS+F N++I G+I +++ +N  Q+L+SG       +
Sbjct: 868  VGGDFSLSNPACVGLCLYNYNNSNWSSFLNNSITGNISQIK-FNDTQMLLSGKLEVNKTA 926

Query: 976  SITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTIMEYKSEKWNEIS-FPNT 1034
             I L S+++      +L  ++ + +  FI     +  W++  I      +W+ ++ F + 
Sbjct: 927  DINLLSINLTSNKQDILLYNNSVVLDDFILVRNLVVGWNSTDIFIRNVTQWSNLNIFDDG 986

Query: 1035 TSKYIESVEAVSIDLQNSTSNVSKILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSINNFQ 1094
            T+  I  +E    D     SN + I+  YG+F+S  YG +NA+++    W PYF ++   
Sbjct: 987  TNATINRIENFGAD-----SNPALII--YGQFDSMKYGTINAVIYDFNSWYPYFEVD--V 1037

Query: 1095 VNEDPAITLFENRDLSSLFNSKNSLPANI 1123
            V++      F +RD SS  N+++ +P +I
Sbjct: 1038 VSQTATPLFFADRDQSSYGNTRHVVPDHI 1066

>YDR141C Chr4 complement(734901..739997) [5097 bp, 1698 aa] {ON}
           DOP1Golgi-localized, leucine-zipper domain containing
           protein; involved in endosome to Golgi transport,
           organization of the ER, establishing cell polarity, and
           morphogenesis; detected in highly purified mitochondria
           in high-throughput studies
          Length = 1698

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 2/59 (3%)

Query: 345 GQLKYCDAFCPLLNSSGLETASSNSTSETRQRVFINNNTTSVTWSESYQEFAFINNIDV 403
           G L   + F PLL SS  E    N       R F +N  T++ W + +QE   I N+ +
Sbjct: 424 GSLVIPELFIPLLYSS--EKFKQNEQIMKTARTFFDNTETNIIWGKLFQELEDIKNLKI 480

>TBLA0G00480 Chr7 (97343..98938) [1596 bp, 531 aa] {ON} Anc_6.54
           YOR166C
          Length = 531

 Score = 32.7 bits (73), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 58/113 (51%), Gaps = 16/113 (14%)

Query: 591 DDI-LLDSNLKSTSL---KLNGLFQYQLSNFTSDTKTKVGNNSIHQLALSQFPSSVSLIG 646
           DD+ LLD N+ S +     +N L++Y  S F+   K    N  IHQ + ++FPS +S I 
Sbjct: 426 DDLSLLDYNVDSITTITDCVNILYKYWSSVFSEFFK----NTQIHQDSWTEFPSQLSYIP 481

Query: 647 NTFNNSIFLAGSTSNIVQLQLN-SDLELRNTVVVDNGGETTRIENYSQGLLFF 698
            T N         SNI+++  + SDL+ R+T+       +T I+ + +  L F
Sbjct: 482 TTPNILQIFLKFWSNILKILYSPSDLQYRDTI-------STEIQKWHEISLLF 527

>KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {ON}
           similar to uniprot|Q05958 Saccharomyces cerevisiae
           YLR228C ECM22 Sterol regulatory element binding protein
           regulates transcription of the sterol biosynthetic genes
           ERG2 and ERG3 member of the fungus-specific Zn[2]-Cys[6]
           binuclear cluster family of transcription factors
           homologous to Upc2p
          Length = 775

 Score = 32.7 bits (73), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 14/90 (15%)

Query: 872 ITNNGSSSLVISNISDGMSLASENLNNYGYITSMIDFNSNNTILVSGNFTLDDVDCHGIC 931
           I N+ ++S+  SN  +  + +   L+  G I SMIDF++N       N  L D+      
Sbjct: 421 IVNSNATSMSKSNTQESQASSDTELSRIGTIASMIDFSTNT------NLNLIDLK----L 470

Query: 932 LYNYFTKKWSAFANSTIKGSIVEMQLWNSD 961
            ++Y T  W           I E ++W+ D
Sbjct: 471 FHHYCTNVWPTIT----AAGISEKKIWSVD 496

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 126,801,918
Number of extensions: 5863584
Number of successful extensions: 15692
Number of sequences better than 10.0: 99
Number of HSP's gapped: 16000
Number of HSP's successfully gapped: 110
Length of query: 1215
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1094
Effective length of database: 39,606,813
Effective search space: 43329853422
Effective search space used: 43329853422
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)