Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0B032408.257ON58558531200.0
CAGL0B01727g8.257ON57758516800.0
Kpol_392.98.257ON59458816730.0
TBLA0E044008.257ON58958416110.0
KNAG0H032608.257ON58058215960.0
NDAI0J014008.257ON58858515940.0
Suva_2.2698.257ON72552215960.0
KLTH0G13794g8.257ON72551915930.0
YDR109C8.257ON71551415760.0
Kwal_56.236078.257ON72551615770.0
KAFR0B055608.257ON60558215630.0
KLLA0F19041g8.257ON76351715690.0
NCAS0B038708.257ON59658315500.0
SAKL0H17160g8.257ON73952315520.0
Smik_4.3558.257ON70452215480.0
Skud_4.3708.257ON71451415470.0
Ecym_43138.257ON59759215030.0
ZYRO0C01782g8.257ON73052115090.0
TDEL0F038408.257ON72652214850.0
AGR092W8.257ON59658914040.0
TDEL0C059001.111ON5436165381e-60
Kwal_33.135301.111ON5345945188e-58
KLTH0F03080g1.111ON5335904985e-55
YNL249C (MPA43)1.111ON5426004882e-53
ZYRO0F16016g1.111ON5425954872e-53
Skud_14.891.111ON5696004883e-53
SAKL0C03432g1.111ON5476004776e-52
Suva_14.931.111ON5436064635e-50
Smik_14.861.111ON5435954558e-49
KNAG0F006601.111ON5355914204e-44
KLLA0C02937g1.111ON5164953271e-31
NCAS0A007801.111ON5495281787e-13
Ecym_50687.69ON41148741.8
SAKL0H03410g4.233ON61862751.9
Kpol_1043.262.329ON682156724.5
CAGL0L03333g1.239ON450116698.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0B03240
         (585 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...  1206   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   651   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   649   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   625   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   619   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   618   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   619   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   618   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   611   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   612   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   606   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   608   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    601   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   602   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   600   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   600   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   583   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   585   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   576   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   545   0.0  
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   211   1e-60
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   204   8e-58
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   196   5e-55
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   192   2e-53
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   192   2e-53
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   192   3e-53
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   188   6e-52
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   182   5e-50
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   179   8e-49
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   166   4e-44
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   130   1e-31
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    73   7e-13
Ecym_5068 Chr5 (152349..153584) [1236 bp, 411 aa] {ON} similar t...    33   1.8  
SAKL0H03410g Chr8 (325527..327383) [1857 bp, 618 aa] {ON} simila...    33   1.9  
Kpol_1043.26 s1043 complement(51825..53873) [2049 bp, 682 aa] {O...    32   4.5  
CAGL0L03333g Chr12 (381919..383271) [1353 bp, 450 aa] {ON} simil...    31   8.8  

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score = 1206 bits (3120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/585 (100%), Positives = 585/585 (100%)

Query: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60
           MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR
Sbjct: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60

Query: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120
           VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD
Sbjct: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120

Query: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180
           LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH
Sbjct: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180

Query: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGD 240
           SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGD
Sbjct: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGD 240

Query: 241 LVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLG 300
           LVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLG
Sbjct: 241 LVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLG 300

Query: 301 RIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPA 360
           RIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPA
Sbjct: 301 RIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPA 360

Query: 361 YQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLM 420
           YQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLM
Sbjct: 361 YQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLM 420

Query: 421 SGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLL 480
           SGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLL
Sbjct: 421 SGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLL 480

Query: 481 MELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSLNDVLWSQMKLMT 540
           MELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSLNDVLWSQMKLMT
Sbjct: 481 MELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSLNDVLWSQMKLMT 540

Query: 541 PKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVYK 585
           PKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVYK
Sbjct: 541 PKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVYK 585

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/585 (54%), Positives = 413/585 (70%), Gaps = 8/585 (1%)

Query: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60
           M  YIGVDVG+GS RAC+ +  G +L++  +DISK+E   G +TQSSNEIWDA+   +K 
Sbjct: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60

Query: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120
            I  SNV+   I GI FDATCSLVV +K+S EP+A GPNFD++NQNII+WMDHRA  ET 
Sbjct: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120

Query: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180
            IN + D  LKYVGG+MSVE E+PKIKWLK+H++PE F + VF+DL D+LT+ A+G    
Sbjct: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180

Query: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGD 240
           S+ SAVCKQG LP GVEGS  GWS EFL KIGLEE+S +NF  LGG    + GNF   G+
Sbjct: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP--NESGNFTYAGN 238

Query: 241 LVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLG 300
            +  V + F    N+   C+VG+G+IDAY+GW+GTVAS     +   + +E+  IE   G
Sbjct: 239 QLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST---IEVPNNKEVVDIEECAG 295

Query: 301 RIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPA 360
           R+A V+GTSTCHIVLSK  +F+ GVWGPYRDVL  + W  EGGQSFTGALL +I+  HP+
Sbjct: 296 RLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPS 355

Query: 361 YQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLM 420
             EL  +  ++N + F +L+  + EL     L++   LTK+ F+YGDY+GNRSP+ADP M
Sbjct: 356 ANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNM 415

Query: 421 SGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLL 480
              IIGQ+MD+S++DLA  YLAACEFIA QT+HIIDTL+  GH I AIYMSGG C+N +L
Sbjct: 416 RAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNIL 475

Query: 481 MELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSLNDVLWSQMKLMT 540
           M+LI+NC  LPL++ KYIDS+VVFG+AILG++A    S  +N  +    D+LWS M  MT
Sbjct: 476 MQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAY---SSSKNNSDKGGADLLWSTMSNMT 532

Query: 541 PKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVYK 585
           P GT + P +E S+ RK +  K++++LDM  T   YR+ +E   +
Sbjct: 533 PDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVENAIR 577

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/588 (53%), Positives = 421/588 (71%), Gaps = 5/588 (0%)

Query: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60
           M++YIGVDVGTGS RAC+ N  GEIL++  KDI+K+EL+  +ITQSS EIW  I + +  
Sbjct: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60

Query: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120
           V+  S + PSS+ GI FDATCSLVV DK + + + VGPNF+D N+NIILWMDHRA  ETD
Sbjct: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120

Query: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180
            IN+T DK LKYVGGKMSVE ELPKIKWLK++L+   F  C F DL D+LTYKAT K V 
Sbjct: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180

Query: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLK--EGNFLIP 238
           SFSS VCKQGLLP GVEGS +GWSKEF  KI L+ELS++NF  +GGSI+ +  E N    
Sbjct: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240

Query: 239 GDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSD-RVCSDSPQELNKIEG 297
           G+ VGH+ +  A    LP  C+VG+G+IDAY+GWVGTVA+ V +    ++     +K++ 
Sbjct: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDS 300

Query: 298 SLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIET 357
           S+G +AV++GTSTCHI LS +P+F++G+WGPYRDVL+ N W  EGGQS TGALL++I+ T
Sbjct: 301 SIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTT 360

Query: 358 HPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLAD 417
           HPAY EL     + +   F +L+ +L EL+      S+  L K+ F+YGDY+GNRSP++D
Sbjct: 361 HPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISD 420

Query: 418 PLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKN 477
             M   IIGQ+MD+SI+ LAI YL+ACEFI+ Q+R II  LV  GH I  IYMSGG  +N
Sbjct: 421 ESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARN 480

Query: 478 KLLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMK--ENKLEYSLNDVLWSQ 535
           +LLM L+++C  LP+V+ +YID+SV+FG+AILG+VA    ++K  +    +     LW++
Sbjct: 481 QLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKTLWNK 540

Query: 536 MKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583
           M  +TP GT++ P +     R  L AKY+++LDM +T  KYR++++E+
Sbjct: 541 MCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEI 588

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/584 (51%), Positives = 417/584 (71%), Gaps = 8/584 (1%)

Query: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60
           MS YIGVDVGTGSARAC+ + NG+IL+++   I +QEL+ G+ITQS+N+IW+ I   I+ 
Sbjct: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRN 60

Query: 61  VIDISNVD--PSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASE 118
           ++  SNVD   S I GI FDATCSLVV +  + + +AVGPNF+D++QN+ILWMDHRA  E
Sbjct: 61  ILQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120

Query: 119 TDLINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKI 178
           T  INST+ K LKYVGG+MSVE E+PKIKWLK++++P  +  C FLDL DFLTYKATG  
Sbjct: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180

Query: 179 VHSFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEG---NF 235
           + SF SAVCKQGLLP GVEGS  GW++EFL  IGLE+L  +NF KLGG +        +F
Sbjct: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240

Query: 236 LIPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRV--CSDSPQELN 293
              G+ +G++  K + +  + + C V +G+IDAY+GW+GT+A+   + +   ++    LN
Sbjct: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300

Query: 294 KIEGSLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDN 353
            +  S GR+AVV+GTSTCHI L+ +P+F+ GVWGPYRDVL  N W  EGGQS TGALL +
Sbjct: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360

Query: 354 IIETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRS 413
           ++ETHPAY+EL  I+ +Q+ ++F  L+ K+ EL   R L    +L KN+F YGD++GNRS
Sbjct: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420

Query: 414 PLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGG 473
           P+AD  M G IIG +MDSS+NDL   YL ACEFIA QTRHI+D +   G+ + ++YMSGG
Sbjct: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480

Query: 474 HCKNKLLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSLNDVLW 533
            C+N+LLM+LISNC  LP+V+ K ID++VVFG+A++G+ A++++    +  +   + +LW
Sbjct: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKSHSDNTKKP-DQILW 539

Query: 534 SQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYR 577
             M  MT +G ++ P+   S + K L  KY++YLDMI T  +YR
Sbjct: 540 DVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYR 583

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/582 (51%), Positives = 401/582 (68%), Gaps = 11/582 (1%)

Query: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63
           YIGVDVGTGSARA +   +G  LA+E   I +QEL++ FITQSS+EIW A+   ++ V+ 
Sbjct: 7   YIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVVT 66

Query: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123
            S V+P  + GI FDATCSLV  D  + + + VGPNFDDS QNIILWMDHRA  ETD IN
Sbjct: 67  KSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAIN 126

Query: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183
           +T D+ LKYVGG+MSVE ELPKIKWLK H+    F +C F DL D+LT+ AT K   SF 
Sbjct: 127 ATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSFC 186

Query: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLVG 243
           SAVCKQGLLP GV+GS+  WS EFLE +GL EL   NF +LGG+   K   FL  G  VG
Sbjct: 187 SAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKP-KFLTAGQPVG 245

Query: 244 HVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLGRIA 303
            +  + +    L   C+V +GVIDAY+GW+G+V +        D   + + ++ ++ R+A
Sbjct: 246 QLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKF------DQSHKSSGLDVAITRLA 299

Query: 304 VVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAYQE 363
           +++GTSTCHI+LSK P F+ GVWGPYRDVL    W  EGGQS TGALL +I+ETHPA++E
Sbjct: 300 LIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEE 359

Query: 364 LERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMSGM 423
           L R+ ++Q  + F YL   L+ L + R++ +V  L+++ F+YGD++GNRSPLADP M   
Sbjct: 360 LVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRAT 419

Query: 424 IIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLMEL 483
           +IGQ+MD SI  LA++YLAACEFIALQTR I++T+V +GH +  +YMSGG C+N LLM+L
Sbjct: 420 VIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQL 479

Query: 484 ISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSLNDVLWSQMKLMTPKG 543
           I++   +P+VL KY D  VVFGAA+L   A+K      + +E   +  LW  M  MTP G
Sbjct: 480 IADSVGVPVVLPKYTDCCVVFGAALLACCASK----GCDGIEADQSTRLWDIMTAMTPMG 535

Query: 544 TLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVYK 585
           T ++P  + S  RKY+ AKY ++LDMI+    YR +M++V++
Sbjct: 536 TRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFR 577

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/585 (51%), Positives = 409/585 (69%), Gaps = 11/585 (1%)

Query: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63
           YIGVDVGTGS RACI +  G I +     I +QEL+   ITQSS EIW A+   +K+V++
Sbjct: 8   YIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVVN 67

Query: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123
                   + GI FDATCSLVV DK +   +AVGP+F+DSNQ+IILWMDHRA  ET  IN
Sbjct: 68  ELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEIN 127

Query: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183
           STND+ LKYVGG+MS+E ELPKIKWLK H+S + F RC F DLAD+LT+KATG+   SF 
Sbjct: 128 STNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSFC 187

Query: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEG-NFLIPGDLV 242
           S VCKQG++P GVEGSKLGWSK+FL  I LEEL+ N++ KLGGS++   G NFL  G+ +
Sbjct: 188 SVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAGEYI 247

Query: 243 GHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKI--EGSLG 300
             ++ +      L   C+VG+G+IDAY+GW+GTV S   D       ++L ++    ++G
Sbjct: 248 APLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDL------EQLFRVGMANAIG 301

Query: 301 RIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPA 360
           R+A V+GTSTCHIVLSK P+F+ GVWGPY+D + +  W TEGGQS TGALL ++++THP+
Sbjct: 302 RLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPS 361

Query: 361 YQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLM 420
           Y+ELE I+ +   N F YL+ +L E+       SV  L K++F YGD +GNRSPLADP M
Sbjct: 362 YKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSM 421

Query: 421 SGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLL 480
            G I+G +MD+S+++LA  YLAACEFIA Q R II+ +   GH I+AIYMSGG C+N LL
Sbjct: 422 KGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLL 481

Query: 481 MELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSLN--DVLWSQMKL 538
           M+L+++C  L +++ +YIDS+VVFGAAILG+ A+K+  +  ++ +  +N  ++LWS M  
Sbjct: 482 MKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMNK 541

Query: 539 MTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583
           MT  G+ +MP  +    R  L AKY+++LDM D   +YR  ++ V
Sbjct: 542 MTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAV 586

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/522 (56%), Positives = 386/522 (73%), Gaps = 3/522 (0%)

Query: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63
           ++GVDVGTGS RACI ++ G+IL++  K I ++E++  FITQSS EIWDA+   +K V+ 
Sbjct: 44  HVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVLQ 103

Query: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123
            S VDP  + GI FDATCSLVV     L+ IAVGP+F +++QNIILWMDHRA  ET+ IN
Sbjct: 104 ESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEIN 163

Query: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183
           ST DK LKYVGG+MSVE ++PKIKWLK++L  E F  C F +L D+LT+KATGK   SF+
Sbjct: 164 STGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSFA 223

Query: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLVG 243
           SAVCKQG LP GVE SKLGWS+EFL  IGL EL+TN+FE+LGGS+  K+ NFL  G+ VG
Sbjct: 224 SAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKK-NFLSAGECVG 282

Query: 244 HVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRV--CSDSPQELNKIEGSLGR 301
            +D   A    L  HC+VG+G+IDAY+GWVGTVA+  S  +   S++  E N I  ++GR
Sbjct: 283 FLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAIGR 342

Query: 302 IAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAY 361
           +A V+GTSTCHI+LSK P+F+ GVWGPYRDVLA N W  EGGQS TGALL ++I+THPA+
Sbjct: 343 LAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHPAF 402

Query: 362 QELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMS 421
            EL ++    + +IF YL+  LE L   R   SV  L K+ F YGDY+GNRSP+ADP M 
Sbjct: 403 TELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPNMR 462

Query: 422 GMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLM 481
             IIGQ+MD+S+ DLA+ YL ACEFI+ QTR II+ ++ +GH I AI+MSGG C+N LLM
Sbjct: 463 ACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGLLM 522

Query: 482 ELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENK 523
            L+++C  LP+++ +YID++VVFG+A+LG+ A++ + +   K
Sbjct: 523 RLLADCTGLPIMIPRYIDAAVVFGSALLGAAASEASDLANEK 564

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%)

Query: 530 DVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583
           D+LW  M+ +T +  ++ P  +    R  L  KY+++LDM +   KYR  ++ V
Sbjct: 663 DLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRV 716

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/519 (56%), Positives = 383/519 (73%), Gaps = 4/519 (0%)

Query: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60
           M  Y+GVDVGTGSARACI +  G IL++  + I +++L+  FITQSS EIW A+   +K 
Sbjct: 32  MLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKS 91

Query: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120
           V+  S V    I GI FDATCSLVV ++ + + +AVGP+F +++QNIILWMDHRA  ET 
Sbjct: 92  VVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQ 151

Query: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180
           LIN+T DK LKYVGG+MSVE E+PKIKWLK+HL    F+ C F DLAD+LT+KA+GK   
Sbjct: 152 LINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETR 211

Query: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSI-NLKEG-NFLIP 238
           SF S VCKQGLLP GVEGS  GWS+EFL +IGLEEL  ++F ++GGS+ N  +G NFL  
Sbjct: 212 SFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSA 271

Query: 239 GDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVA--SDVSDRVCSDSPQELNKIE 296
           G+ +G +D   A    L NHCVVG+GVIDAY+GWVGTVA  +DVS      + QE   ++
Sbjct: 272 GEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMD 331

Query: 297 GSLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIE 356
            + GR+A V+GTSTCHI +S+ P+F+ GVWGPYRD LA N W  EGGQS TGALL +++ 
Sbjct: 332 RATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLT 391

Query: 357 THPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLA 416
           THPAY EL ++    + + F YL+ +LE L   +K  SV +L K++F YGDY+GNRSP+A
Sbjct: 392 THPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIA 451

Query: 417 DPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCK 476
           DP M   IIGQ+MD+SI+DLA+ YL ACEFIA QTR I+D + T GH ++AI+MSGG C+
Sbjct: 452 DPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCR 511

Query: 477 NKLLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515
           N LLM L+++C  LP+V+ +YID++VVFG+A+LG+VA++
Sbjct: 512 NGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 550

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 530 DVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVYK 585
           D +W+ M  MT  G ++ P +E++  R  L AKY+++LDM +T  KYR  +++  +
Sbjct: 669 DAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDDAVR 724

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/514 (56%), Positives = 379/514 (73%), Gaps = 3/514 (0%)

Query: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63
           Y+GVDVGTGSARAC+ +++G +L++  K I +++L   FITQSS EIW+A+   ++ V++
Sbjct: 40  YVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVE 99

Query: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123
            S VDP  + GI FDATCSLVV    + E IAVGP+F +++QNIILWMDHRA  ET+ IN
Sbjct: 100 ESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEIN 159

Query: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183
           S+ DK LKYVGG+MSVE E+PKIKWLK++L    F  C F DL D+LT+KATGK   SF 
Sbjct: 160 SSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFC 219

Query: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLVG 243
           SAVCKQG LP GVEGS +GWSKEFL  IGL EL+ N+FE+LGGS+  K+ NFL  G+ + 
Sbjct: 220 SAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKK-NFLTAGECIS 278

Query: 244 HVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNK--IEGSLGR 301
            +DKK A    L  HCVV +G+IDAY+GWVGTVA+     V   +  E  K    G++GR
Sbjct: 279 PLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGR 338

Query: 302 IAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAY 361
           +A V+GTSTCHI+LSK P+F+ GVWGPYRDVLA   WA EGGQS TG LLD++I THPA+
Sbjct: 339 LAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAF 398

Query: 362 QELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMS 421
            EL  + +    + F YL++ LE L   RK+ SV  L K++F YGDY+GNRSP+ADP M 
Sbjct: 399 TELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMR 458

Query: 422 GMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLM 481
             IIGQ+MD+SI DLA+ YL+ACEFI+ QTR II+ ++  GH I AI+MSGG C+N LLM
Sbjct: 459 ACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLM 518

Query: 482 ELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515
            L+++C  LP+V+ +Y+D++VVFG+A+LG+ A++
Sbjct: 519 RLLADCTGLPIVIPRYVDAAVVFGSALLGAAASE 552

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 525 EYSLNDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583
            Y+    LW  M+ +T    ++ P  +    R  L  KY+++LDMI+T  KYR+ +++V
Sbjct: 651 RYNGTSFLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKV 709

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/516 (56%), Positives = 379/516 (73%), Gaps = 4/516 (0%)

Query: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63
           YIGVDVGTGSARACI +  G IL++  + I +++L+  FITQSS EIW A+   +K V+ 
Sbjct: 35  YIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVVR 94

Query: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123
            S V    I GI FDATCSLVV ++ S + +AVGP+F ++NQNIILWMDHRA  ET+ IN
Sbjct: 95  DSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETEQIN 154

Query: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183
           +T DK LKYVGG+MSVE E+PKIKWLK+HL    F  C F DLAD+LT+KA+GK   SF 
Sbjct: 155 ATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRSFC 214

Query: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSI-NLKEG-NFLIPGDL 241
           S VCKQGLLP GVEGSK GWS+EFL +IGLE+   ++F K+GGS+ N  +G NFL  G+ 
Sbjct: 215 STVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSAGEF 274

Query: 242 VGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVA--SDVSDRVCSDSPQELNKIEGSL 299
           VG +D   A    L NHCVVG+GVIDAY+GWVGTVA  +DVS        QE   ++ + 
Sbjct: 275 VGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDRAT 334

Query: 300 GRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHP 359
           GR+A V+GTSTCHI +S+ P+F+ GVWGPYRD LA N W  EGGQS TGALL +++ THP
Sbjct: 335 GRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMTTHP 394

Query: 360 AYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPL 419
           AY EL ++    + + F YL+ +LE L   +K  SV +L +++F YGDY+GNRSP+ADP 
Sbjct: 395 AYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIADPS 454

Query: 420 MSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKL 479
           M   IIGQ+MD+SI+DLA+ YL ACEFIA QTR I++ + T GH + AI+MSGG C+N L
Sbjct: 455 MRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRNGL 514

Query: 480 LMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515
           LM L+++C  LP+V+ +YID++VVFG+A+LG+VA++
Sbjct: 515 LMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 550

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%)

Query: 530 DVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVYK 585
           D +W+ M  MT  G ++ P  E +  RK L  KY+++LDM +T  KYR  + EV K
Sbjct: 669 DAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEK 724

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/582 (50%), Positives = 402/582 (69%), Gaps = 3/582 (0%)

Query: 3   NYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVI 62
           ++IGVDVGTGS RAC+ ++ G+ILA+  K IS++EL+ GFITQSS EIWD+I   +++VI
Sbjct: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79

Query: 63  DISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLI 122
             + +  + + GI FDATCSL V DK++LE +AVGP F  ++QNII+WMDHRA+ ETD I
Sbjct: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139

Query: 123 NSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSF 182
           NS  D  LKYVGGKMS+E E+PKIKWLK+H+  ETF + VF DL D+LT+KATG    S 
Sbjct: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199

Query: 183 SSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLV 242
            SAVCKQGLLP GVEGS  GWS+ FL   GL EL  N FE++GG  N    NFL  G+ V
Sbjct: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGN-NSRNFLSAGEYV 258

Query: 243 GHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLGRI 302
             + K       L   CVVG+G+IDAY+G +GT+A+ + +   +        ++ ++GR+
Sbjct: 259 STLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAIGRL 318

Query: 303 AVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAYQ 362
           A V+GTSTCHI LS +P+F++GVWGPY+D+LA++ W  EGGQS TG LL ++I THPAY+
Sbjct: 319 AAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYE 378

Query: 363 ELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMSG 422
           EL+   ++   ++F  L+E + +L   +   ++  LTK +F+YGDY+GNRSP+ADP M  
Sbjct: 379 ELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRA 438

Query: 423 MIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLME 482
            IIGQ+MD+++  LA+ YLAACEFIA QTRHII  +   GH I +IYMSGG C+N +LME
Sbjct: 439 SIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILME 498

Query: 483 LISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEY--SLNDVLWSQMKLMT 540
           L+++   LP+V+ KYID++VVFGAA++G+ A  + +  E   +    +   LW+ M  MT
Sbjct: 499 LLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHTLWNAMVKMT 558

Query: 541 PKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEE 582
             GT + PK  +   +  L  KY++Y+DM  T  KYR  +++
Sbjct: 559 GNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/517 (56%), Positives = 381/517 (73%), Gaps = 5/517 (0%)

Query: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60
           M  Y+GVDVGTGSARAC+ +  G IL++  + I + EL+  +ITQSS EIW+AI   +K 
Sbjct: 34  MVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKN 93

Query: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120
           V+  S VDP +I GI FDATCSLVV D N+ E + VGP+F D+ QNIILWMDHRA  ET+
Sbjct: 94  VVRDSGVDPRTIHGIGFDATCSLVVVDNNN-EDVGVGPDFTDNLQNIILWMDHRAIEETE 152

Query: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180
            IN+T DK LKYVGG+MSVE E+PKIKWLK+++  + F +C F DLAD+LT+KATG  + 
Sbjct: 153 EINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIR 212

Query: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGD 240
           S+ S VCKQGLLP GVEGSK GWSKEFL++IGLEEL  ++F KLGGS+   E  FL  G+
Sbjct: 213 SYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVT--ETTFLSAGE 270

Query: 241 LVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVA--SDVSDRVCSDSPQELNKIEGS 298
            +G + ++ A    L  HCVVG+GVIDAY+GWVGTVA  +DV       S +  + I+ +
Sbjct: 271 CIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRA 330

Query: 299 LGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETH 358
            GR+A V+GTSTCHI +SK P+F+ GVWGPYRDV+A   W  EGGQS TGALL +++ TH
Sbjct: 331 TGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTH 390

Query: 359 PAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADP 418
           PAY EL +++   N + F YL+ +LE L   RK  SV  L K++F YGDY+GNRSP+ADP
Sbjct: 391 PAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADP 450

Query: 419 LMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNK 478
            M   IIGQ+MD+SI+DL+I YL ACEFIA QTR I++ +   GH + AI+MSGG C+N 
Sbjct: 451 SMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNG 510

Query: 479 LLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515
           LLM L+++C  LP+V+ +YID++VVFG+A+LG+VA++
Sbjct: 511 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 547

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%)

Query: 530 DVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583
           D LW  M  MT  G ++ P  E +  R  L AKY+++LDM  T  KYRK ++EV
Sbjct: 709 DKLWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEV 762

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/583 (49%), Positives = 405/583 (69%), Gaps = 8/583 (1%)

Query: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63
           Y+G+DVGTGS RAC+ +  G +L++  K I+++EL+  FITQS+ EIW A    +K  I+
Sbjct: 17  YVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAIE 76

Query: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123
              VD S + GI FDATCSLV  +K + + + VGPNF++ + N+ILWMDHRA  E + IN
Sbjct: 77  QCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEIN 136

Query: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183
           +TNDK LKYVGG MSVE ++PKIKWLK+++ P  F +C F +LAD+LT+KATGK   SF 
Sbjct: 137 ATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSFC 196

Query: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSI-NLKEGNFLIPGDLV 242
           S VCKQG LP GVEGS  GWSKEFL  IGLE+L+ N+++ LGG++ N  + NF   G  +
Sbjct: 197 SVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSSGKCL 256

Query: 243 GHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVA--SDVSDRVCSDSPQELNKIEGSLG 300
           G +  +      L  +CVVG G+IDAY+G +GT+A  S+ S ++ +DS   L   + ++G
Sbjct: 257 GPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIGL---QNAIG 313

Query: 301 RIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPA 360
           R+A V+GTSTCH++LSK P+F+ GVWGPYRDV+A+  W  EGGQ+ TG LL  ++  HPA
Sbjct: 314 RLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHPA 373

Query: 361 YQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLM 420
           ++EL   +     + F YL+  L+EL +  K++S   L K++F YGDY GNRSP ADP+M
Sbjct: 374 FKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPMM 433

Query: 421 SGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLL 480
           S  IIGQ+M+ ++ +LA+ YLAACEFIA QTR I++T+   G  ++ IYMSGG C+NKLL
Sbjct: 434 SAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKLL 493

Query: 481 MELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSLNDVLWSQMKLMT 540
           M+L+S+C  LP++L KY+D++VVFGAAILG+ A    S K  ++E     +LW  M  MT
Sbjct: 494 MKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADA--SRKSVEIECDFGFMLWETMDRMT 551

Query: 541 PKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583
           P GTL+ P       RK L  KY+++LDM +T  KYR+ ++++
Sbjct: 552 PHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDI 594

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/523 (56%), Positives = 379/523 (72%), Gaps = 11/523 (2%)

Query: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60
           M+ Y+GVDVGTGSARACI +  G IL++  + I +QEL+  +ITQSS EIW AI   +K 
Sbjct: 32  MTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKS 91

Query: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120
           V+  S V P  I GI FDATCSLVV + +S + +AVGP+F ++ QNIILWMDHRA  ET 
Sbjct: 92  VVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETK 151

Query: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180
            IN+TNDK LKYVGG+MSVE E+PKIKWLK++L  E F +C F DLAD+LT+KATG    
Sbjct: 152 EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETR 211

Query: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGN----FL 236
           S+ S VCKQGLLP GVE SK GWSKEFL  IGLE+L  ++F KLGGSI   +G+    FL
Sbjct: 212 SYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIK-SDGSGGSTFL 270

Query: 237 IPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVAS----DVSDRVCSDSPQEL 292
             G+ +G +D   A    LP HCVVG+GVIDAY+GWVGTVA+    D+ + V +D+  E 
Sbjct: 271 SAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADN--EK 328

Query: 293 NKIEGSLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLD 352
             I+ + GR+A V+GTSTCHI +SK P+F+ GVWGPYRDV+A   W  EGGQS TGALL 
Sbjct: 329 TGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLA 388

Query: 353 NIIETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNR 412
           +++  HPAY EL  ++   + + F YL+ +LE L   R   SV  L K++F YGDY+GNR
Sbjct: 389 HVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNR 448

Query: 413 SPLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSG 472
           SP+ADP M   +IGQ+MD+SI+DLAI YL ACEFIA QTR I++ +   GH I AI+MSG
Sbjct: 449 SPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSG 508

Query: 473 GHCKNKLLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515
           G C+N LLM L+++C  LP+V+ +YID++VVFG+A+LG+VA++
Sbjct: 509 GQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 551

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%)

Query: 518 SMKENKLEYSLNDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYR 577
           ++++ K      D LW  M  MT  G ++ P S+    R  L AKY+++LDM +T  +YR
Sbjct: 662 ALEKEKSASGKGDALWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYR 721

Query: 578 KKMEEV 583
           + +++V
Sbjct: 722 EAVDKV 727

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/522 (54%), Positives = 377/522 (72%), Gaps = 3/522 (0%)

Query: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63
           Y+GVDVGTGS RACI +K+G IL++  K I ++EL   FITQSS EIW+A+   +++VI 
Sbjct: 31  YVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKVIQ 90

Query: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123
            + VDP+ I GI FDATCSLVV      + IAVGP+F +++QNIILWMDHRA  ET+ IN
Sbjct: 91  EAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETEEIN 150

Query: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183
            + +  LKYVGG+MSVE E+PKIKWLK++L    F  C F DL D+LT++ATGK   SFS
Sbjct: 151 FSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRSFS 210

Query: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLVG 243
           S VCKQG LP GVEGS LGWSK+FL+ IGL EL+ N+FEKLGGS+   + NFL  G+ +G
Sbjct: 211 SVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLR-NQKNFLSAGECIG 269

Query: 244 HVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNK--IEGSLGR 301
            +D K A    L  +CVV +G+IDAY+GWVGTVA+     +   +  E  K    G++GR
Sbjct: 270 PLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDFNGAIGR 329

Query: 302 IAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAY 361
           +A V+GTSTCHI+LSK  +F+ G+WGPYRDVLA   WA EGGQS TG LLD++I THPA+
Sbjct: 330 LAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVITTHPAF 389

Query: 362 QELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMS 421
            +L ++    N + F YL+  LE L   RK  SV +L K++F YGDY GNRSP+ADP M 
Sbjct: 390 SKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPIADPNMR 449

Query: 422 GMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLM 481
             IIGQ+MD+SI+DLA+ YL ACEFI+ QTR II+ ++  GH I A++MSGG C+N LLM
Sbjct: 450 ACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRNGLLM 509

Query: 482 ELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENK 523
            L+++C  LP+V+ +YID +VVFG+A+LG+ A+K+  + + +
Sbjct: 510 RLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDLNKRR 551

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 530 DVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRK---KMEEVY 584
           ++LW  M+ +T    ++ P ++    R  L  KY+++LDM++T   YR+   K+EE +
Sbjct: 645 NILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEETF 702

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/514 (55%), Positives = 374/514 (72%), Gaps = 3/514 (0%)

Query: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63
           Y+GVDVGTGSARACI +++G +L++  K I ++EL+  FITQSS EIWDA+   +K VI 
Sbjct: 40  YVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQ 99

Query: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123
            S VDP  + G+ FDATCSLVV      + +AVGP+F  ++QNIILWMDHRA  ET+ IN
Sbjct: 100 ESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEIN 159

Query: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183
           S+ DK LKYVGG+MSVE E+PKIKWLK++L  E F  C F DL D+LT+KATGK   SFS
Sbjct: 160 SSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFS 219

Query: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLVG 243
           SAVCKQG LP GVEGS LGWS+EFL  IGL EL  ++FEKLGGS+  K+ NFL  G+ +G
Sbjct: 220 SAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKK-NFLSAGECIG 278

Query: 244 HVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELN--KIEGSLGR 301
            +D K A    L  +CVV +G+IDAY+GWVGTVA+     +   +  E N     G++GR
Sbjct: 279 SLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGR 338

Query: 302 IAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAY 361
           +A V+GTSTCHI+LSK P+F+ G+WGPYRDVLA   WA EGGQS TG LLD++I+ HPAY
Sbjct: 339 LAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAY 398

Query: 362 QELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMS 421
            EL ++T+    + F YL+  LE +   R   SV  L +++F YGDY+GNRSP+AD  M 
Sbjct: 399 TELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMR 458

Query: 422 GMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLM 481
             IIGQ+MD+S+ DLAI YL+ACEFI+ QTR I++ ++  GH I AI+MSGG C+N LL 
Sbjct: 459 ACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLT 518

Query: 482 ELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515
            L+++C  LP+V+ +YID +VVFG+A+LG+ A++
Sbjct: 519 RLLADCSGLPIVIPRYIDGAVVFGSALLGAAASE 552

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 4/69 (5%)

Query: 509 LGSVAAKINSMKENKLEYSLNDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLD 568
           L +VA  + S++E +  Y    +LW  M+ +T     + P       R  L  KY+++LD
Sbjct: 638 LNTVA--LRSLEEKR--YRGTGILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLD 693

Query: 569 MIDTNIKYR 577
           M +T  +YR
Sbjct: 694 MAETQKRYR 702

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/592 (49%), Positives = 397/592 (67%), Gaps = 21/592 (3%)

Query: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60
           + +YIGVDVGT S RAC+ + +G IL++  K IS+QE+Q  ++TQSSNEIW AI   I++
Sbjct: 2   LQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRK 61

Query: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120
           +I  S V   SI GI FDATCSLVV ++ + + +AVGPNFDD  Q+IILWMDHRA  E +
Sbjct: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVN 121

Query: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180
            INST  + LKYVGGKMS+E ++PKIKWLK++L    F +C F DL DFLTY+ATG    
Sbjct: 122 EINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCR 181

Query: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGD 240
           SF S VCK GLLP GV+GS  GW ++  E IGL EL    F KLGG ++    NFL  GD
Sbjct: 182 SFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGD 241

Query: 241 LVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLG 300
            VGH+  + A    L   C+V +G+IDAY+GWVGT+A+ ++  + SD  +     E +  
Sbjct: 242 YVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGIT--LGSDGQES----ELASS 295

Query: 301 RIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPA 360
           R+A V+GTSTCHI +SK P F+ GVWGPYRD L    W TEGGQS TGALL +++++HPA
Sbjct: 296 RLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPA 355

Query: 361 YQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLM 420
           Y  L ++   Q  + F +++ +LEEL+  R   SV  L K++F YGDY+GNRSP+ADP M
Sbjct: 356 YDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNM 415

Query: 421 SGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLL 480
              IIGQ+MD S++DLAI  L ACEFIA QTR I++ +   GH IT+IYMSGG C+N +L
Sbjct: 416 RATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVL 475

Query: 481 MELISNCCVLPLVLSKYIDSSVVFGAAILGSVA-----------AKINSM-KENKLEYSL 528
           ++L++NC  LP+VL KYID++VVFG+A+LG  A           A ++++  + ++   L
Sbjct: 476 IKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSEL 535

Query: 529 ---NDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYR 577
                +LW+ M  +T  G ++ P +      + L  KYE++LDMI+T  +YR
Sbjct: 536 KPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYR 587

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/521 (54%), Positives = 369/521 (70%), Gaps = 6/521 (1%)

Query: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60
           M  YIGVDVGTGSARAC+ +  G I+++  K I ++EL+  +ITQSS EIW AI   +K 
Sbjct: 31  MIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKT 90

Query: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120
           V+  S VD   I GI FDATCSLV  +      + VGP+F++ +QNIILWMDHRA  ET 
Sbjct: 91  VVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETA 150

Query: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180
            INSTN   LKYVGG+MS+E E+PKIKWLK+H+  E F+  VF DLADFLTYKATG    
Sbjct: 151 EINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTR 210

Query: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLK----EGNFL 236
           SF+S+VCKQGLLP GVEGS  GWS EFL  I L EL  N+F KLGGS+  K      NFL
Sbjct: 211 SFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFL 270

Query: 237 IPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNK-- 294
             G  VG +  + A    L +HCVVG+GVIDAY+GWVGTVA+   + +   +  E  K  
Sbjct: 271 SAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLG 330

Query: 295 IEGSLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNI 354
           ++ + GR+A V+GTSTCH+ LS+ P+F+ GVWGPYRDV+A   W  EGGQS TGALL ++
Sbjct: 331 VDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHV 390

Query: 355 IETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSP 414
           + THPAY +LE ++     + F YL+ +LE L   RK  SV  L K++F YGDY+GNRSP
Sbjct: 391 LSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSP 450

Query: 415 LADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGH 474
           +AD  M   IIGQ+MD+S++DLA++YL ACEFIA QTR I++ +   GH I++I+MSGG 
Sbjct: 451 IADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQ 510

Query: 475 CKNKLLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515
           C+N LLM L+++C  LP+++ +YID++VVFG+A+LG+VA++
Sbjct: 511 CRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASE 551

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 532 LWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583
           LW  M  MT  G ++ P  + +  R  L AKY+++LDM +T  +YR  ++ V
Sbjct: 669 LWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRV 720

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/522 (54%), Positives = 371/522 (71%), Gaps = 8/522 (1%)

Query: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60
           M  Y+GVDVGTGSARACI +  G IL++  K I ++EL+  +ITQSS EIW +I   +K 
Sbjct: 32  MIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKS 91

Query: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120
           V+  S V    I GI FDATCSLVV D    E + VGP F +++QNI+LWMDHRA +ET+
Sbjct: 92  VVRDSGVPVERIHGIGFDATCSLVVVDDEDKE-VGVGPVFANNDQNIVLWMDHRAIAETN 150

Query: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180
            IN+TNDK LKYVGG+MSVE E+PKIKWLK++L  E F +C F DLAD+LT+KAT K   
Sbjct: 151 EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTR 210

Query: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNF-----EKLGGSINLKEGNF 235
           SF S VCKQGL+P GVEGSK GWSK+FL  I L EL  N F          + +    +F
Sbjct: 211 SFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSF 270

Query: 236 LIPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVA--SDVSDRVCSDSPQELN 293
           L  G+ VG +D++ A    LP HCVVG+GVIDAY+GWVGTVA  +DV     +++ +   
Sbjct: 271 LSAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKK 330

Query: 294 KIEGSLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDN 353
            I+ + GR+A V+GTSTCHI LS+ P+F++GVWGPYRDV+A   WA EGGQS TGALL +
Sbjct: 331 GIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAH 390

Query: 354 IIETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRS 413
           ++ THPA+ EL  ++   N + F YL+ +LE L   R   SV  L K+++ YGDY+GNRS
Sbjct: 391 VMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRS 450

Query: 414 PLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGG 473
           P+ADP M   IIGQ+MD+SI+DLAI YL ACEFIA QTR I++ +   GH I+ I+MSGG
Sbjct: 451 PIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGG 510

Query: 474 HCKNKLLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515
            C+N LLM L+++C  LP+++ +YID++VVFG+A+LG+VA++
Sbjct: 511 QCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASE 552

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 530 DVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVYK 585
           D LW  M  MT  G ++ P  E    R  L AKY+++LDM D+  +YR+ +++V K
Sbjct: 667 DALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVEK 722

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/589 (46%), Positives = 375/589 (63%), Gaps = 15/589 (2%)

Query: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63
           Y+GVDVGT  ARACI +K+G ILA     IS+ + +   ITQSS+EIW A+   ++  + 
Sbjct: 10  YVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAVA 69

Query: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123
            S V    + GI FDATCSLVV D++S   +AVGP+F D+ QN+ILWMDHRA +E   IN
Sbjct: 70  ESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEIN 129

Query: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183
           ST    L+YVGGKMSVE ++PKIKWL+ H+    F +C F DL DFLTY+ATG    SF 
Sbjct: 130 STGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSFC 189

Query: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLVG 243
           S VCK GL+P GV+ S  GWS+EFLE+IGLEEL  + F +LGG+++     F   G+ VG
Sbjct: 190 STVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGEPVG 249

Query: 244 HVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLGRIA 303
            + +  A    L   CVVG+GVIDAY+GWVGTV +        D  +E   +E   GR+A
Sbjct: 250 LLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGAS------PDGARESGGVEELAGRLA 303

Query: 304 VVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAYQE 363
            V+GTSTC I+LS+ P F+ GVWGPYRDVLA   W TEGGQS TGALL + + THPAY E
Sbjct: 304 AVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPAYTE 363

Query: 364 LERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMSGM 423
           L +   ++    F Y++ +L++LR      S+  L K+ F+YGDY+GNRSPLADP M   
Sbjct: 364 LHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSMRAA 423

Query: 424 IIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLMEL 483
           ++G +MD S +DLA+  L A EFIALQ RHI+D +   G  +  +Y+SGG  +N LL +L
Sbjct: 424 MVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQL 483

Query: 484 ISNCCVLPLVLSKYIDSSVVFGAAILGSVA-----AKINSMKENKLEYSLNDV----LWS 534
           +++    P+V  +++ ++VVFG+A+L + A     A  N+   + L  S +      LW 
Sbjct: 484 LADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMHRLWQ 543

Query: 535 QMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583
            M  +T  G ++ P  +     + L+AKY+V+L+M +    YRK +++V
Sbjct: 544 IMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDV 592

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  211 bits (538), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 177/616 (28%), Positives = 283/616 (45%), Gaps = 121/616 (19%)

Query: 5   IGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIW------DAILDII 58
           IG+D+G+ S R  +     +++   VK       ++ +     + +W      D I+ +I
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLMVQCVKQ------KISYYYHGDSALWEYTQSTDEIMKVI 59

Query: 59  KRVIDISNVDPSSIDGIAFDATCSLVVFDK--NSLEPIAVGPNFDDSNQNIILWMDHRAA 116
           +R +    +D  +I      ATCS+ +F K  N LEP           QN+I WMD+ + 
Sbjct: 60  ERCLHDLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISG--SHRQNVIFWMDNSSK 117

Query: 117 SETDLINSTNDKRLK-YVGGKMSVEFELPKIKWLKDHL-SPETFHR--CVFLDLADFLTY 172
           +E  L+N+  +KRL+ ++GGK   E  +PKI  L ++L S +       V +DL  +L Y
Sbjct: 118 TECKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYLAY 177

Query: 173 KATGKIVHSFSSAVCKQGLLPTGVEGSKLGWSKEFLE---------KIGLEELSTNNFEK 223
           +   +   +F   +        G +G   GWS +F            IG E    ++FE 
Sbjct: 178 EIAKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFYIDTLKIPSNITIGPEPPLEDDFEY 237

Query: 224 LGGSINLKEGNFLIPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDR 283
             G +                                     ID YS W+          
Sbjct: 238 CKGIV----------------------------------ASCIDCYSSWLS--------- 254

Query: 284 VCSDSPQELNKIEGSLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVL-AENMWAT-E 341
           +CS +P+E          + +V GTSTC++  + +   I GVWGP+ D+L   N +A  E
Sbjct: 255 LCSPTPEE---------SLFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYE 305

Query: 342 GGQSFTGALLDNIIETHPAYQELERITSRQNKNIFVYLDEKLE------ELRVNRKLDSV 395
           GGQS TG L++++++THPA       +S   K+ +  L EK+E      E +  R   S+
Sbjct: 306 GGQSCTGKLIEHLLQTHPA-------SSSIAKDDWPLLLEKIEQEISAIEEQTGR---SI 355

Query: 396 FYLTKNMFIYGDYYGNRSPLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHII 455
            + TK+MF YGD+ GNR+P ADP MSGM IG+T D S N+L ++Y+   EF+A Q +++I
Sbjct: 356 HFKTKHMFFYGDFQGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMI 415

Query: 456 DTLVTHGHG---ITAIYMSGGHCKNKLLMELIS-----NCCVLPLVLSKYIDSSVVFGAA 507
            ++     G   IT I + G   KNK L+ LIS         LP      ++ S V GA 
Sbjct: 416 -SIFNKAQGQDKITEIRICGSQAKNKRLLSLISLLHEGGTIKLP---KTDVELSGVSGAF 471

Query: 508 ILGSVAAKINSMKENKLEYSLNDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYL 567
           +LG  A     + ++ L+         Q+ +     ++  P      L   L+AKYE++L
Sbjct: 472 LLGKSAL----LNKSPLDLIQEKDDQKQVDIFETPSSINQP------LSMLLEAKYEIHL 521

Query: 568 DMIDTNIKYRKKMEEV 583
           DM    + YR+ + ++
Sbjct: 522 DMAKQQLIYREMINKI 537

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  204 bits (518), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 171/594 (28%), Positives = 269/594 (45%), Gaps = 94/594 (15%)

Query: 5   IGVDVGTGSARACITN-KNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63
           +G+D+G+   R    N +  E +AV  + ++  E + G  TQSS EI  AI++  + +  
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFESL-- 65

Query: 64  ISNVDPSSIDGIAFDATCSLVVFDKNS---LEPIAVGPNFDDSN-QNIILWMDHRAASET 119
             N+D  ++      ATCSL VF +NS   L+P  V  +    N QN++ WMD  A  E 
Sbjct: 66  --NIDIWAVQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIEEC 123

Query: 120 DLINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIV 179
             IN        Y GG    E  +PK+       S       VF DL  ++ Y    +  
Sbjct: 124 SNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNNSDFEVF-DLHTYVAYDLANRYG 182

Query: 180 HSFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPG 239
              S  + +      G +G   GW  EF EK             L    N++ G   I  
Sbjct: 183 WDASFLINRPNHNGIGHDGEIKGWKDEFYEKT------------LKLPPNVRIGPLCI-- 228

Query: 240 DLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSL 299
                 +++F+         V     ID YS W    +S         +P+         
Sbjct: 229 ------NRRFSP--------VKVASCIDCYSSWFSMFSS---------TPER-------- 257

Query: 300 GRIAVVSGTSTCHIVLSKQPL-FISGVWGPYRDVLAEN---MWAT-EGGQSFTGALLDNI 354
             + + +GTSTC++  + +P   + G+WGP+ D+L       W+  E GQS TG L++++
Sbjct: 258 -SLFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQSTTGKLIEHL 316

Query: 355 IETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSP 414
            E+HPA +        +++N+     E    L   +  +SV + TK+MF YG+  GNR+P
Sbjct: 317 FESHPAAKPY-----LEDRNVLFNRLETEINLIEQQSAESVHFKTKHMFNYGELQGNRTP 371

Query: 415 LADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGH 474
             DP MSGM IG++ D+S  DL +KY+   EF+A Q RHI + L   G  I  I ++G  
Sbjct: 372 YCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL---GAPINDIRVAGSQ 428

Query: 475 CKNKLLMELIS-----NCCVLPLVLSKYIDSSVVFGAAILGSVAA-KINSM----KENKL 524
            KN  L+ LIS     +   +P   + Y+    V GA +LG      +N +    +EN  
Sbjct: 429 AKNNRLLSLISFVNHGSRVRIPATRADYVG---VQGAYLLGKAKHLGLNVVELITQENGG 485

Query: 525 EYSLNDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRK 578
           E  + D+             + + K+E++ LR   + KY++YL+M  T  +YR+
Sbjct: 486 ESPMKDI------------EVRIEKNEENKLRALFEIKYKIYLNMAQTQRQYRE 527

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  196 bits (498), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 167/590 (28%), Positives = 269/590 (45%), Gaps = 78/590 (13%)

Query: 5   IGVDVGTGSARACITN-KNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63
           +G+D+G+ + R  I + K  +++ +  K +         +TQSS +I  AI   I+ +  
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCIQDL-- 68

Query: 64  ISNVDPSSIDGIAFDATCSLVVF--DKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDL 121
             N D  S+      ATCSL VF  D   L+P+ +     +   N++ WMD  A  E ++
Sbjct: 69  --NPDLKSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSATLECEI 126

Query: 122 INSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHS 181
           +N T  +  +++GG    E  +PK+  +      E  H+    DL  ++ Y+   K    
Sbjct: 127 VNKTAGRLKEFMGGSFVPEMGIPKLASIFKKPEAEG-HKLEVFDLHSYIAYELAIKYGWD 185

Query: 182 FSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDL 241
            S  + K      G +G   GW   F           N+  KL  ++ +   + L     
Sbjct: 186 TSRIINKPNENRIGHDGELKGWDAGFY----------NDVLKLPANVKIGPIHAL----- 230

Query: 242 VGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLGR 301
                       N  +   V +  ID YS W           +CS SP            
Sbjct: 231 ------------NTESPVRVAS-CIDCYSNWFS---------MCSSSPNN---------S 259

Query: 302 IAVVSGTSTCHIVL-SKQPLFISGVWGPYRDVL----AENMWATEGGQSFTGALLDNIIE 356
           + + +GTSTC++   ++    I GVWGP+ ++L    A+     E GQS TG L++++ E
Sbjct: 260 LFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIEHLFE 319

Query: 357 THPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLA 416
           THPA     R  S     +F  ++  +E+L  +   +SV + +K+MF YG+  GNR+P  
Sbjct: 320 THPA----ARAYSMDKSKLFSAIESAIEKLEQDFG-ESVHFRSKHMFTYGELQGNRTPYC 374

Query: 417 DPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCK 476
           D  MSGM IG+T D+S  DL +KY+   EF+A Q +HI +        I  I ++G   K
Sbjct: 375 DSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECFKAE---IKDIRIAGSQAK 431

Query: 477 NKLLMELIS--NCCVLPLVLSKYIDSSVVFGAAILGSVAAK-INSMKENKLEYSLNDVLW 533
           N  L+ L S  N  +   + ++  D   V GA +LG  A K IN +          D L 
Sbjct: 432 NTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHKNINIID----LIDKRDRLQ 487

Query: 534 SQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583
           S +  + P    M   +  + L++ L+AKY++YLDM  T ++YR  ++ V
Sbjct: 488 SHILELGP----MKLGNHNTKLKQLLEAKYKIYLDMAQTQMRYRAMVDSV 533

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  192 bits (488), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 172/600 (28%), Positives = 274/600 (45%), Gaps = 87/600 (14%)

Query: 5   IGVDVGTGSARACITNKNGEIL---AVE----VKDISKQELQLGFITQSSNEIWDAILDI 57
           IG+DVG+ SAR  + N   + L   A E     +D SK+  +     Q S EI  A+   
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDSSKKSWKFW---QKSTEIIKALQKC 65

Query: 58  IKRVIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVG-PNFDDSNQNIILWMDHRAA 116
           ++++    N+    +      ATCSL +F+++    + +  PN D    N+I WMD  A 
Sbjct: 66  LQKL----NIREYEVKSCGVSATCSLAIFERDRTSNMLIPYPNED----NVIFWMDSSAV 117

Query: 117 SETDLINSTNDKRL-KYVGGKMSVEFELPKIKWLKD---HLSPETFHRCVFLDLADFLTY 172
           +E   +N    ++L  Y+GGK   E  +PK+K+  D   HL  + FH     DL  ++ Y
Sbjct: 118 NECQWLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFH---IFDLHQYIAY 174

Query: 173 KATGKIVHSFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKE 232
           + +     +    + ++ L   G +G   GWS  F + I                INL  
Sbjct: 175 ELSRLYEWNIEGLLGRENLNGIGNDGEVSGWSSSFYKNI----------------INLPS 218

Query: 233 GNFLIPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQEL 292
              +    LV          AN      V    ID+Y+ W               SP   
Sbjct: 219 NVSIGTTSLV----------ANKHISTTVVRSCIDSYASWFAVA-----------SPH-- 255

Query: 293 NKIEGSLGRIAVVSGTSTCHIV-LSKQPLFISGVWGPYRDVLAE--NMWATEGGQSFTGA 349
             +E SL  IA   GTS+C++   +     I GVWGP+  +L    +      GQS TG 
Sbjct: 256 --LETSLFMIA---GTSSCYMYGTTISDTRIPGVWGPFDTILDNRGDFSVYAAGQSCTGK 310

Query: 350 LLDNIIETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYY 409
           L++++ E+HP      R   +   +I+  L++ + ++  N  L S+  LTK+MF YGDY 
Sbjct: 311 LIEHLFESHPC----ARKILKDGADIYQVLEQTIRDIEKNNGL-SIHILTKDMFFYGDYE 365

Query: 410 GNRSPLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHG--ITA 467
           GNR+P ADP + G  IG++ D+S+ +L  KY+   EF++ QT+ IIDT         I  
Sbjct: 366 GNRTPFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKE 425

Query: 468 IYMSGGHCKNKLLMELIS--NCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLE 525
           + +SG   KN+ L+ LIS  N  V  +   + +D   + GA +L   A +   + +   E
Sbjct: 426 LRISGSQAKNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKEKKQLADVITE 485

Query: 526 YSLNDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVYK 585
               D+     K  +     +   ++  +LRK L  KY ++LDM     +Y K ++EV++
Sbjct: 486 ---RDISNDSEKFESLAEYRL--GNDSILLRKLLCVKYHIHLDMAKQQKRYHKLVDEVFQ 540

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  192 bits (487), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 165/595 (27%), Positives = 273/595 (45%), Gaps = 88/595 (14%)

Query: 5   IGVDVGTGSARACITN-KNGEILAVEVKDIS---KQELQLGFITQSSNEIWDAILDIIKR 60
           IG+D+G+ S R  + N +N +I+A ++K +      E      TQSS EI  AI    + 
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQCFQE 69

Query: 61  VIDISNVDPSSIDGIAFDATCSLVVFDK--NSLEPIAVGPNFDDSNQNIILWMDHRAASE 118
           +    N+D   I      ATCSL +F    N+L P     N DD ++N++ WMD  A  E
Sbjct: 70  L----NIDKHEIKSCGVGATCSLAIFQTKDNALIPW----NLDDPDKNVVFWMDSIAIKE 121

Query: 119 TDLINSTNDKRLK-YVGGKMSVEFELPKIKWLKDHLSPETFHRCVF--LDLADFLTYKAT 175
           T  +N      ++ ++GG    E  +PK++   D L   T +   F  +DL  ++     
Sbjct: 122 TQEVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILK-NTDNNSTFEIIDLHRYIAMSLA 180

Query: 176 GKIVHSFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNF 235
            +    +++      L   G +G   GWS  F E +                + L     
Sbjct: 181 QQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENV----------------LQLPPNIV 224

Query: 236 LIPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKI 295
           + P     H  K+  GL          +  ID YS W   + S++ +             
Sbjct: 225 IGPTKHSQHSSKQ--GLK--------VSSCIDCYSNWFALLPSNLQNS------------ 262

Query: 296 EGSLGRIAVVSGTSTCHIVLSKQ-PLFISGVWGPYRDVL--AENMWATEGGQSFTGALLD 352
                 + +V GTSTC++  S +    I GVWGP+ ++   ++     E GQS TG L++
Sbjct: 263 ------LFIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTGKLIE 316

Query: 353 NIIETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNR 412
           ++ +THPA      I +R   ++F  +++ +E++  N + DS+   TK+MF YGD  GNR
Sbjct: 317 HLFKTHPAS---SHIDTRDWPHLFSQINDFIEKVEQNTQ-DSIHMQTKHMFFYGDLDGNR 372

Query: 413 SPLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHG--HGITAIYM 470
           +P ADP MSGM IG+T D+S  +L  KY++  EFIA Q +H++    T      I+ +  
Sbjct: 373 TPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIFNTLNGDEDISNLQF 432

Query: 471 SGGHCKNKLLMELISNCCVLPLVLSKYIDSSVV--FGAAILGSVAAKINSMKENKLEYSL 528
            G   KNK L+ L++       +    +D +++  +G+ ++G  +    S+ E       
Sbjct: 433 CGSLAKNKRLLNLLALLNPRLRIAMPEMDVALMGAYGSYLMGKASTSDKSIVE------- 485

Query: 529 NDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583
             V  +Q     P      P+    +L + L+ KY++Y +M +   KYRK++  V
Sbjct: 486 --VAHNQTYSYRP------PEKTDGLLVELLEVKYQIYFNMAEQQRKYRKQVNNV 532

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  192 bits (488), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 172/600 (28%), Positives = 277/600 (46%), Gaps = 89/600 (14%)

Query: 5   IGVDVGTGSARACITN-KNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIK---R 60
           IG+DVG+ SAR  I N +N  +L +  + +   +      +++S + W    +IIK   +
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDS----SRTSWKFWQRSTEIIKALQK 89

Query: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKN----SLEPIAVGPNFDDSNQNIILWMDHRAA 116
            +    +   ++      ATCSL +F+K+    SL P    PN D    N+I WMD  A 
Sbjct: 90  CLQKLKITEYNVKSCGVSATCSLAIFEKDKRNGSLIPY---PNED----NVIFWMDSSAI 142

Query: 117 SETDLINSTNDKRL-KYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKAT 175
            E   +N+   ++L  ++GG    E  +PK+K+  +  S     +    DL  ++ Y+ +
Sbjct: 143 DECKQLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELS 202

Query: 176 GKIVHSFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNF 235
                +    + ++     GV+G   GWS  F E I                        
Sbjct: 203 HLYQWNNEVLLKRENNKMVGVDGEASGWSPSFYENI-----------------------M 239

Query: 236 LIPGDLV----GHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQE 291
            +P +++    G   KK A  A       +    ID+Y+ W               SP  
Sbjct: 240 HLPSNVIIGSNGATCKKIASSA-------IVRSCIDSYASWFAV-----------SSPH- 280

Query: 292 LNKIEGSLGRIAVVSGTSTCHIVLSK-QPLFISGVWGPYRDVLAENMWAT--EGGQSFTG 348
              +E SL  IA   GTSTC++  +    + I GVWGP+  +L  N   +    GQS TG
Sbjct: 281 ---LETSLFMIA---GTSTCYMYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAGQSCTG 334

Query: 349 ALLDNIIETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDY 408
            L++++  THP  +E+     ++  +I+  L+  + ++   +   SV   TK++F YGDY
Sbjct: 335 KLIEHLFVTHPCAKEI----LKRGADIYQVLERTIHDIE-KQNGQSVHVFTKDIFFYGDY 389

Query: 409 YGNRSPLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTH--GHGIT 466
            GNR+P ADP M G  IG+T D+SI +L  KY+   EF++ QTR IIDT      G  I 
Sbjct: 390 EGNRTPFADPRMKGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCIQ 449

Query: 467 AIYMSGGHCKNKLLMELIS--NCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKL 524
            + +SG   KNK L+ LIS  N  +        +D   V GA +L   A +   + +   
Sbjct: 450 ELRISGSQAKNKRLLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANEGKQIIDVIR 509

Query: 525 EYSLNDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVY 584
           E   +D   ++     P+  L+   ++ S+LR+ L AKY ++LDM     +Y K ++EV+
Sbjct: 510 ERDTSDD--NEKFEPLPEYQLL---NDSSLLRRLLWAKYRIHLDMAKQQQRYHKLIDEVF 564

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  188 bits (477), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 163/600 (27%), Positives = 270/600 (45%), Gaps = 89/600 (14%)

Query: 5   IGVDVGTGSARACITN-KNGEILAVEVKDISKQEL-QLGFITQSSNEIWDAILDIIKRVI 62
           +GVD+G+ S R  I + +N  +L V  + +        G  TQS+ EI  A+    +  +
Sbjct: 13  VGVDLGSSSVRVGIYSLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAAL----QECL 68

Query: 63  DISNVDPS--SIDGIAFDATCSLVVF----DKNSLEPIAVGPNFDDSNQNIILWMDHRAA 116
           D   + P   SI      ATCS+ VF       SL P+ +      S++N++ WMD  A+
Sbjct: 69  DELGLRPGGRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVAS 128

Query: 117 SETDLINSTNDKRLKY-VGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKAT 175
              D ++      +K  + G    E  +PK+  L       +       DL  ++ Y   
Sbjct: 129 EACDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQFPGRSLE---VFDLHKYIAYDLA 185

Query: 176 GKIVHSFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNF 235
            +     ++   +      G +G   GW +EF            N  KL  ++ +   + 
Sbjct: 186 RRYGWDMAALANRPNSNGIGHDGEVGGWPQEFYR----------NVLKLPATVAVGPAS- 234

Query: 236 LIPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKI 295
              G  VG                      ID Y+ W G         VCS  P++    
Sbjct: 235 TFKGQRVGVAS------------------CIDCYASWFG---------VCSTQPEQ---- 263

Query: 296 EGSLGRIAVVSGTSTCHIVLSK-QPLFISGVWGPYRDVL--AENMWAT-EGGQSFTGALL 351
                 + +V+GTSTC++  S      + G+WGP+ ++L   E  W+  E GQS TG LL
Sbjct: 264 -----SLFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQSTTGRLL 318

Query: 352 DNIIETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGN 411
           +++ ETHPA ++    T R    +F  L++++ ++  +    S+ +L ++MF+YG+  GN
Sbjct: 319 EHLFETHPAARDYAGDTGR----LFKDLEDRIADMEADSGC-SIHHLARHMFLYGELQGN 373

Query: 412 RSPLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVT-HGHGITAIYM 470
           R+P ADP M GM +G+T D+S  +LA+KY+   EF+A QTR I++   T     I  + +
Sbjct: 374 RTPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAAAIGELRV 433

Query: 471 SGGHCKNKLLMELIS--NCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSL 528
           +G   +N+ L+ L+S  N  +   V ++    + V GA +LG         K   L+ SL
Sbjct: 434 AGSQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLG---------KARYLDVSL 484

Query: 529 NDVLWSQMKLM-----TPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583
            DV+      +     T         + K  LR+ L+AKY ++LDM     +YR +++ V
Sbjct: 485 LDVVRKPGATIPTVEVTESSNYPACGATKENLRRLLEAKYAIHLDMAQVQQRYRSEIDAV 544

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  182 bits (463), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 171/606 (28%), Positives = 276/606 (45%), Gaps = 103/606 (16%)

Query: 5   IGVDVGTGSARACITNKNGEILAVEVK-------DISKQELQLGFITQSSNEIWDAILDI 57
           IG+D+G+ SAR  I +   ++L    +       D SK+  +     Q S EI  A+ + 
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPVPYYHDSSKKSWKF---WQKSTEIIKALQNC 65

Query: 58  IKRVIDISNVDPSSIDGIAFDATCSLVVFDKN----SLEPIAVGPNFDDSNQNIILWMDH 113
            + +     +   ++      ATCSL +F K+    +L P    PN D    N+I WMD 
Sbjct: 66  FQEL----KITQYNVRSCGVSATCSLAIFQKDLTNGNLIPY---PNED----NVIFWMDS 114

Query: 114 RAASETDLINSTNDKRL-KYVGGKMSVEFELPKIKWL---KDHLSPETFHRCVFLDLADF 169
            A  E + +N    ++L  Y+GGK   E  +PK+K+      H   + FH     DL  +
Sbjct: 115 SAVDECEWLNEKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFH---IFDLHQY 171

Query: 170 LTYKATGKIVHSFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSIN 229
           + Y+       +      ++ +   G +G   GWS  F           N+  KL  ++ 
Sbjct: 172 IAYELGRLYRWNTDELSARENINGIGNDGEASGWSSSFY----------NDIMKLPSNVT 221

Query: 230 LKEGNFLIPGDLVGHVDKKFAGLANLPNHCVVGT----GVIDAYSGWVGTVASDVSDRVC 285
           +                    GL  L ++    T      ID+Y+ W             
Sbjct: 222 I--------------------GLTGLNSNNSSSTTTVCSCIDSYASWFAV---------- 251

Query: 286 SDSPQELNKIEGSLGRIAVVSGTSTCHIVLSK-QPLFISGVWGPYRDVLAEN--MWATEG 342
             SP     +E SL  IA   GTSTC++  S      I GVWGP+  +L  N        
Sbjct: 252 -SSP----NLEASLFMIA---GTSTCYMYGSPVTTTKIPGVWGPFDTILETNGNYSVYTA 303

Query: 343 GQSFTGALLDNIIETHPAYQELERITSRQNKNIFVYLDEKLEEL-RVNRKLDSVFYLTKN 401
           GQS TG L++++ ++HPA ++++R      ++I+  L+  ++++ + NRK  S+  L K+
Sbjct: 304 GQSCTGKLIEHLFKSHPAARKIQR----SGEDIYEVLENSIQDIEKKNRK--SIHILAKH 357

Query: 402 MFIYGDYYGNRSPLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTH 461
           MF YGDY GNR+P AD  M G  IG++ D+SI +L  KY++  EF++ QT+ IIDT    
Sbjct: 358 MFFYGDYEGNRTPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQ 417

Query: 462 GHG--ITAIYMSGGHCKNKLLMELIS--NCCVLPLVLSKYIDSSVVFGAAILGSVAAKIN 517
             G  I  + +SG   KN  L+ LIS  N  +     ++ ID   V GA +LG  A +  
Sbjct: 418 NSGARIEELRVSGSQAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANEKK 477

Query: 518 SMKENKLEYSLNDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYR 577
            + +   E   N    +  +   P GT  +  ++  +L++ L  KY ++LDM     +Y 
Sbjct: 478 QIIDIIRERDAN----ADSEEFEPFGTYQL-GNDCILLKRLLSVKYRIHLDMAKQQQQYH 532

Query: 578 KKMEEV 583
           + ++E 
Sbjct: 533 RLVDEA 538

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  179 bits (455), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 158/595 (26%), Positives = 269/595 (45%), Gaps = 81/595 (13%)

Query: 5   IGVDVGTGSARACI-TNKNGEILAVE------VKDISKQELQLGFITQSSNEIWDAILDI 57
           IG+D+G+ SAR  I +  N  +L +        +D +K+  +     Q S EI +A+   
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQDFTKKSWKF---WQKSTEIIEALQKC 65

Query: 58  IKRVIDISNVDPSSIDGIAFDATCSLVVFDK-NSLEPIAVGPNFDDSNQNIILWMDHRAA 116
            +++     +   ++      ATCSL +F++ ++ E +   PN      N+I WMD  A 
Sbjct: 66  FQKL----KITEYNVKSCGVSATCSLAIFERVHTSEALIPYPN----ENNVIFWMDSSAT 117

Query: 117 SETDLINSTNDKRL-KYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKAT 175
            E + +N+   K+L  Y+GG+   E  +PK+K+  +  S     R    DL  ++ Y+  
Sbjct: 118 DECEWLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELG 177

Query: 176 GKIVHSFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNF 235
                +    +  + +   G +G   GWS  F + I                +N+     
Sbjct: 178 RLYQWNIDGLLRGENINGIGNDGEASGWSSSFYKNI----------------MNIPSNVI 221

Query: 236 LIPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKI 295
           + P   VG V KK            V    ID+Y+ W               SP  L + 
Sbjct: 222 IGP---VGLVSKKVIS-------TTVVRSCIDSYASWFAV------------SPPFLER- 258

Query: 296 EGSLGRIAVVSGTSTCHIVLSK-QPLFISGVWGPYRDVLAE--NMWATEGGQSFTGALLD 352
                 + +++GTS+C++  +      I GVWGP+ ++L +  +      GQS TG L++
Sbjct: 259 -----SLFMIAGTSSCYMYGTPVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSCTGKLIE 313

Query: 353 NIIETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNR 412
           ++ E+HP      R   +   +I+  L++ +  +   + L S+  L K+MF YGDY GNR
Sbjct: 314 HLFESHPC----ARKILKSGADIYQVLEQTIHGIEKKKGL-SIHILAKDMFFYGDYEGNR 368

Query: 413 SPLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGH--GITAIYM 470
           +P ADP M G  IG+T D+SI +L  KY++  EF++ QT+ IIDT  +      I  + +
Sbjct: 369 TPFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRIQELRI 428

Query: 471 SGGHCKNKLLMELIS--NCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSL 528
           SG   +N+ L+ LIS  N  +        +D   + GA IL   A +   + +   E  +
Sbjct: 429 SGSQARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANEKKQLVDVIRERDV 488

Query: 529 NDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583
            D      +   P     +  ++ ++L+  L  KY ++LDM      Y K ++EV
Sbjct: 489 GD----DNEKFQPLSEYCL-GNDSTLLKNLLCVKYRIHLDMAKQQKYYYKLVDEV 538

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  166 bits (420), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 160/591 (27%), Positives = 260/591 (43%), Gaps = 87/591 (14%)

Query: 5   IGVDVGTGSARACITN-KNGEILAVEVKDI----SKQELQLGFITQSSNEIWDAILDIIK 59
           IG+D+G+ S R  I +  +  +L V  K +          L   TQ S EI    L  IK
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFSKPVPYYYESNRTSLWEYTQDSAEI----LTAIK 63

Query: 60  RVIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASET 119
              D++++    +      ATCSLV+ +++  +      + +  ++N++ WMD  A  ET
Sbjct: 64  ECFDMADLQKYDVKSCGVAATCSLVLCERSGDDTFQ---HCEGDSRNVVFWMDSMAKEET 120

Query: 120 DLINSTNDKR-LKYVGGKMSVEFELPKIKWLKDHLS--PETFHRCVFLDLADFLTYKATG 176
           + +N+   +  L ++GG    E  +PK+      +S  P+   +    DL  ++ YK   
Sbjct: 121 NSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQWEVFDLHKYVAYKLAQ 180

Query: 177 KIVHSFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFL 236
           +   +             G +G   GWSK F +KI                         
Sbjct: 181 EYCWNTERLSNHPNSNGIGHDGELAGWSKSFYDKI-----------------------VR 217

Query: 237 IPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIE 296
           +P ++     K      +L    V+    ID YS W   +             Q LNK  
Sbjct: 218 LPPNVTIGCPKTIENEDSL----VIVDSCIDCYSSWFSPL-------------QSLNK-- 258

Query: 297 GSLGRIAVVSGTSTCHIV---LSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDN 353
                + +V+GTSTC+I      K    + G+WGP+ D+L  N    E G S +G L+++
Sbjct: 259 ---NTLFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVYESGSSCSGKLIEH 315

Query: 354 IIETHPAYQELERITSRQNKNIFVYLDEKLEE---LRVNRKLDSVFYLTKNMFIYGDYYG 410
           +  +HP+   L   T +        L  KLEE   +   +   S+ +   N F+YGD  G
Sbjct: 316 LFTSHPSAISLNLSTGQ--------LISKLEEEINIWETQNATSIHFEACNNFLYGDLDG 367

Query: 411 NRSPLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYM 470
           NR+P  DP M GM IG++ D+S  DL +KY+   E +A QT+ ++D      + I  +++
Sbjct: 368 NRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDNF-EKLNSINELFI 426

Query: 471 SGGHCKNKLLMELIS--NCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSL 528
            G   KN  L++LIS  N   L LV  +  D   V GA +LG         K   L  S+
Sbjct: 427 CGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLG---------KAGYLGTSV 477

Query: 529 NDVLWSQMK-LMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRK 578
           + V  S+ +  ++ K T    K +++ L K L  KY ++L+M +   ++RK
Sbjct: 478 DLVPVSEPREYISVKYTNDSDKIQQTKLYKLLLTKYIIHLEMAEQQQRFRK 528

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  130 bits (327), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 126/495 (25%), Positives = 214/495 (43%), Gaps = 78/495 (15%)

Query: 5   IGVDVGTGSARACITNKNGEILAVEVKD-ISKQELQLGFITQSSNEIWDAILDIIKRVID 63
           IGVD+G+   R  I +   + L  E K+ +       G ITQ +++I  A+    ++  +
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSLVKETKEKVPYFRHGNGIITQCTSDILTAV----EKAFN 61

Query: 64  ISNVDPSSIDGIAFDATCSLVVFDK--NSLEPIAVGPNFDDSNQNIILWMDHRAASETDL 121
              +   +I  +   ATCS+VV  +   +L P  +  + +    +II WM   A  ET+ 
Sbjct: 62  TLYIQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAIEETEY 121

Query: 122 INSTNDKR-LKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180
           +N+  D+  L + GGK   E  +PK+  L      +       LDL  +L +K + K+ H
Sbjct: 122 LNNITDESILCHFGGKFFPEMAIPKLLHLNKLYKDDGL---TVLDLHIWLLWKISLKLGH 178

Query: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGD 240
                V +      G +G   GWSKEF E + L ++                    I  +
Sbjct: 179 KELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKI-------------------FIGNN 219

Query: 241 LVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLG 300
            V   +++F            G   ID Y+ W    ++ + +R                 
Sbjct: 220 AVIKKNEQF------------GDSCIDCYASWFQCWSTAMLNRT---------------- 251

Query: 301 RIAVVSGTSTCHIVLSKQ-PLFISGVWGPYRDVLA--------ENMWATEGGQSFTGALL 351
            + VV+GTSTC +  S     FI G+WGP++D+L         +N    E G S TG LL
Sbjct: 252 -LFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGISRTGVLL 310

Query: 352 DNIIETHPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGN 411
           + ++ THPA ++        + N    ++ K++ L       S+  + KN F + DY   
Sbjct: 311 EKLLSTHPAVKD-------SDVNFLETVEHKID-LIEQSDTQSIHLMIKNTFFHEDYEEF 362

Query: 412 RSPLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGH-GITAIYM 470
            S       SG I+ +  + ++ DLA+KY+   E +A Q   +I+     GH  I+ + +
Sbjct: 363 ESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAF-EEGHITISKLLI 421

Query: 471 SGGHCKNKLLMELIS 485
           +G   KN  L++++ 
Sbjct: 422 TGSQAKNSRLLQILQ 436

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 121/528 (22%), Positives = 203/528 (38%), Gaps = 117/528 (22%)

Query: 5   IGVDVGTGSARACITN-KNGEILAVEVKDI---SKQELQLGFITQSSNEIWDAILDIIKR 60
           IG+DVG+ S R  I N ++G  +   VK++    + + +L   TQ++  + D+I   ++ 
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTIKTIVKEMLYKHEPDSKLWHYTQNAFVMRDSIFTALEE 64

Query: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNS----LEPIAVGPNFDDSNQNIILWMDHRAA 116
           +    +V+   +      ATCS+V   ++S    L P+ +     ++  +II W DH A 
Sbjct: 65  L----HVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDHTAQ 120

Query: 117 SETDLINST-----------NDKRLKYVGGKMSV--EFELPKIKWLKDHLSP---ETFHR 160
            E   +N+             +K L  +G +     E  +PK+  L + +     ET H 
Sbjct: 121 PEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYETPHI 180

Query: 161 CVFLDLADFLTYKATGKIVHSFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNN 220
               DL  ++      K   +      K  +   G++G   GW   F     +  L   +
Sbjct: 181 LEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGWDLSFY----VWALPETS 236

Query: 221 FEK-LGGSINLKEGNFLIPGDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASD 279
           F   +G S  + E + + P                           ID Y+ W  T A  
Sbjct: 237 FPICIGPSKVINETSIVRP------------------------KSCIDCYASWFSTDACT 272

Query: 280 VSDRVCSDSPQELNKIEGSLGRIAVVSGTSTCHIVL-----------SKQPLFISGVWGP 328
             D                   + + +GTSTC +              +QPL  S  WGP
Sbjct: 273 KDDT------------------LFMAAGTSTCCLYAMPRSALEYFGEQQQPL--SLFWGP 312

Query: 329 YRDVLAENMWAT-EGGQSFTGALLDNIIETH---PAYQELERITSRQNKNIFVYLDEKLE 384
           + +VL ++  ++ E G S TG LL+ +   H    ++   E I   +N+ I +Y      
Sbjct: 313 FTNVLDKDKKSSFEIGFSETGILLEKLFNKHQITASWSVAESINYVENQ-IAIY------ 365

Query: 385 ELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMSGMIIGQTMDSSIND--------L 436
                RK     YL   ++++  Y     P      SG     T D   ND        L
Sbjct: 366 ----ERKKSHSIYLEPEIYLFLKYLTLNKP------SGRDTPDTPDLFGNDGVTDSTLGL 415

Query: 437 AIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLMELI 484
             KY+A  E++A Q  ++I         I  + +SG   +NK L++LI
Sbjct: 416 IFKYIAILEYLAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>Ecym_5068 Chr5 (152349..153584) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii ADR353C
          Length = 411

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 255 LPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLGRI 302
           LP H  VG G   ++S   GT AS  S RV S        +E SLGRI
Sbjct: 136 LPPHNAVGAGA--SFSAVAGTTASTASSRVSSTDSWGWVPMERSLGRI 181

>SAKL0H03410g Chr8 (325527..327383) [1857 bp, 618 aa] {ON} similar
           to uniprot|Q07379 Saccharomyces cerevisiae YDL057W
           Hypothetical ORF
          Length = 618

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 8/62 (12%)

Query: 410 GNRSPLADPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQ---TRHIIDTLVTHGHGIT 466
           G+  P ADP      IG+T+   + D+   Y  AC     Q    R  +DT+V H  G+ 
Sbjct: 110 GDSEPNADP-----SIGRTIQQDVQDIETVYQFACSEQCRQLLGKRLTLDTIVAHSRGVI 164

Query: 467 AI 468
           A+
Sbjct: 165 AM 166

>Kpol_1043.26 s1043 complement(51825..53873) [2049 bp, 682 aa] {ON}
           complement(51825..53873) [2049 nt, 683 aa]
          Length = 682

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 68/156 (43%), Gaps = 21/156 (13%)

Query: 195 GVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLVGHVDKKFAGLAN 254
            ++  +L   +  L+ I  +ELS  N E+L G    K GN  +  +L   +++K     N
Sbjct: 37  SIDNGELEKYRGILDDITSQELSQENIEELKG----KYGNLQVFIELETLINEKVKSELN 92

Query: 255 LPN----HCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSL-GRIAVVSGTS 309
           L        ++ T +ID   G+V     DV      D  Q+L KI+ SL      +    
Sbjct: 93  LSELDKIDDIINTLIID---GFV-----DVEYERIEDLNQQLLKIKSSLENSNNELEKNR 144

Query: 310 TCHIVLSKQPLFISGVWGPYRD----VLAENMWATE 341
           T  ++++     ++ +  P ++    VL E+ W T+
Sbjct: 145 TESVIINFNDSLLANIINPLKEEFDGVLLESKWDTK 180

>CAGL0L03333g Chr12 (381919..383271) [1353 bp, 450 aa] {ON} similar
           to uniprot|P36137 Saccharomyces cerevisiae YKR044w
          Length = 450

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 52/116 (44%), Gaps = 16/116 (13%)

Query: 471 SGG-HCKNKLLMELISNCCVLPLVLSKY-----IDSSVVFGAAILGSVAAKINSMKENKL 524
           SGG H KN  LM L +N   L LV   Y      D  + +   IL +           K 
Sbjct: 169 SGGVHAKNVDLMGLPNNLPGLALVFDTYKNNYRTDVEIPYLDLILNT--------DPQKD 220

Query: 525 EYSLN-DVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKK 579
            YS+N D L S  K +TPK   + P + K  + K L+  Y   +  +  +I+Y+K+
Sbjct: 221 MYSVNTDNLESTSKKLTPKHIKLHPSTIKGDITK-LRIIYSETIGFLKVDIQYQKE 275

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,752,707
Number of extensions: 2981531
Number of successful extensions: 8147
Number of sequences better than 10.0: 40
Number of HSP's gapped: 8247
Number of HSP's successfully gapped: 59
Length of query: 585
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 470
Effective length of database: 40,294,809
Effective search space: 18938560230
Effective search space used: 18938560230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)