Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0B025505.251ON46346321680.0
Kpol_1032.875.251ON46446520380.0
TDEL0E037505.251ON47147120090.0
CAGL0E06490g5.251ON47247220080.0
Skud_11.825.251ON46846820060.0
YKL145W (RPT1)5.251ON46746720040.0
NCAS0F023005.251ON47447420040.0
Smik_11.915.251ON46846820020.0
ACR050C5.251ON47546420000.0
Ecym_82505.251ON45646419970.0
TBLA0C030405.251ON46846919970.0
SAKL0G11484g5.251ON45646319920.0
ZYRO0A10560g5.251ON46846819910.0
KLTH0G07524g5.251ON44546519850.0
Suva_11.805.251ON47147119730.0
KAFR0H036305.251ON44846419680.0
KNAG0H023005.251ON47747819430.0
KLLA0E13773g5.251ON47547619000.0
Kwal_23.28495.251ON40942318480.0
NDAI0C037805.251ON38538516800.0
Suva_7.2274.57ON4053097891e-100
Skud_7.2364.57ON4053097861e-100
Smik_7.2354.57ON4053097861e-100
YGL048C (RPT6)4.57ON4053097861e-100
KLLA0A04752g4.57ON4043097861e-100
KLTH0D03806g4.57ON4053017779e-99
Kwal_26.74744.57ON4053017779e-99
CAGL0D06292g4.57ON4003117724e-98
ZYRO0G22330g4.57ON4053187716e-98
AGL043C4.57ON4053017716e-98
Kpol_1041.424.57ON4033017708e-98
SAKL0H23672g4.57ON4083017709e-98
NCAS0A058804.57ON4073107691e-97
TDEL0E056604.57ON4063007664e-97
KAFR0F031004.57ON4053107656e-97
KNAG0D032004.57ON4003137647e-97
NDAI0D028504.57ON4053107649e-97
TBLA0B098804.57ON4013107631e-96
TPHA0F004404.57ON4033017612e-96
Skud_15.4258.708ON4373227191e-89
SAKL0H05764g8.708ON4213227162e-89
KLLA0C09592g8.708ON4343077172e-89
Smik_15.4428.708ON4373227137e-89
KNAG0G027208.708ON4443227131e-88
Suva_8.3088.708ON4373227102e-88
KLTH0D11990g8.708ON4333077085e-88
YOR259C (RPT4)8.708ON4373227076e-88
AAL113W8.708ON4323077067e-88
CAGL0K08910g8.708ON4363227068e-88
Ecym_23658.708ON4273077041e-87
KAFR0A040108.708ON4243227032e-87
NCAS0B011508.708ON4263227032e-87
TDEL0A065308.708ON4353227032e-87
Kwal_26.89128.708ON4343077014e-87
TBLA0D012408.708ON4433207009e-87
NDAI0E010208.708ON4433227001e-86
Kpol_1064.228.708ON4323206981e-86
NCAS0A101803.216ON4372976972e-86
KLLA0E21209g5.428ON4323086911e-85
ZYRO0F11946g8.708ON4443226922e-85
TPHA0D014708.708ON4553206932e-85
NDAI0A072903.216ON3762816852e-85
YDL007W (RPT2)3.216ON4372606902e-85
Ecym_55275.428ON4323086902e-85
KAFR0F024403.216ON4362606902e-85
SAKL0G02376g5.428ON4343086893e-85
NCAS0F033305.428ON4343086893e-85
Smik_4.2293.216ON4372606893e-85
TDEL0D040603.216ON4372736893e-85
KNAG0K015303.216ON4352606884e-85
TPHA0H017705.251ON4343086884e-85
Suva_4.2463.216ON4372606884e-85
ZYRO0A04224g3.216ON4372606876e-85
Kpol_1010.743.216ON4372606877e-85
KLTH0F16214g5.428ON4343086851e-84
Kwal_27.110323.216ON3763106791e-84
KNAG0C049605.428ON4233086832e-84
Kwal_55.214535.428ON4343086842e-84
SAKL0C11440g3.216ON4363106842e-84
CAGL0A02750g5.428ON4293086832e-84
CAGL0I04884g3.216ON4332606832e-84
Ecym_52863.216ON4372976832e-84
TPHA0A042703.216ON4372606824e-84
Smik_15.2955.428ON4343086814e-84
Skud_4.2473.216ON4372606815e-84
KAFR0E038905.428ON4343086815e-84
YOR117W (RPT5)5.428ON4343086815e-84
AEL011W3.216ON4372976815e-84
Suva_8.1705.428ON4343086805e-84
TBLA0F006903.216ON4342606806e-84
Kpol_1062.335.428ON4343086807e-84
Skud_15.2805.428ON4343086781e-83
TDEL0E019705.428ON4343086781e-83
AER254W5.428ON4603086801e-83
NDAI0B056205.428ON4823086793e-83
TBLA0A037405.428ON4343086744e-83
KLLA0F14707g3.216ON4342606746e-83
KLTH0G16698g3.216ON4552976748e-83
ZYRO0F09900g5.428ON4343086712e-82
Kpol_543.175.486ON4282786474e-79
ZYRO0D11528g5.486ON4532806461e-78
KLLA0C06534g5.486ON4282626413e-78
NCAS0A119805.486ON4262796413e-78
NDAI0A042905.486ON4262796414e-78
Ecym_45485.486ON4252626397e-78
Smik_4.6685.486ON4282796389e-78
YDR394W (RPT3)5.486ON4282796389e-78
CAGL0K09526g5.486ON4312636371e-77
Skud_4.6685.486ON4282796371e-77
TBLA0D018605.486ON4292796371e-77
AFR394W5.486ON4722596402e-77
KAFR0E035805.486ON4252796352e-77
TPHA0J028605.486ON4312636353e-77
SAKL0G03828g5.486ON4252626344e-77
Suva_2.5715.486ON4282796335e-77
KNAG0C045905.486ON4322966345e-77
TDEL0A035005.486ON4262796134e-74
KLTH0G02662g5.486ON4252626065e-73
Kpol_1020.97.288ON8122315263e-58
TBLA0J006407.288ON8522315263e-58
TDEL0H015607.288ON8382315245e-58
NCAS0E035807.288ON6012315147e-58
TBLA0C048407.288ON8472315221e-57
Kpol_2000.157.288ON8232315202e-57
KLLA0F05676g7.288ON8302315202e-57
SAKL0F09834g7.288ON8422315202e-57
KLTH0A05324g7.288ON8322315202e-57
NCAS0A137607.288ON8252315192e-57
NDAI0A030407.288ON8422315193e-57
KNAG0B029407.288ON8382315193e-57
NDAI0A022807.288ON8252315175e-57
Smik_4.1117.288ON8352315175e-57
Kwal_23.59967.288ON8312315166e-57
Ecym_80377.288ON8362315167e-57
KAFR0L011907.288ON8242315158e-57
Suva_4.1197.288ON8362315159e-57
Skud_4.1297.288ON8352315159e-57
YDL126C (CDC48)7.288ON8352315159e-57
AFR158W7.288ON8322315151e-56
CAGL0J09350g7.288ON8302315151e-56
ZYRO0C09262g7.288ON8302315141e-56
TPHA0A032607.288ON8262315113e-56
NCAS0E040505.34ON13292794943e-53
KAFR0D019005.34ON12612794934e-53
ZYRO0D07414g5.34ON14202694881e-52
TDEL0G005905.34ON12942344854e-52
NDAI0B007805.34ON13482794845e-52
Kwal_47.18848singletonOFF3021564536e-52
Ecym_47695.34ON13392694811e-51
TPHA0L022105.34ON14002704802e-51
KLTH0B09130g5.34ON13332894792e-51
SAKL0H01276g5.34ON13372694793e-51
Kpol_513.195.34ON13772354793e-51
TBLA0C068505.34ON14262694783e-51
KNAG0K002805.34ON14082714783e-51
CAGL0G00528g5.34ON13172364774e-51
KLLA0A09823g5.34ON13192364766e-51
ABR139W5.34ON12702364766e-51
Kpol_483.204.259ON7832614717e-51
Smik_16.385.34ON13892344731e-50
Skud_7.6035.34ON13862344722e-50
ZYRO0D15290g7.168ON7272644662e-50
TBLA0I011902.472ON8352654683e-50
Kwal_23.42535.34ON13292424713e-50
Ecym_12587.168ON7472644645e-50
KNAG0L010607.168ON7132614627e-50
KNAG0B061604.259ON7722614647e-50
Skud_13.2452.472ON8242574649e-50
KLTH0F13904g7.168ON7392634611e-49
YGR270W (YTA7)5.34ON13792344661e-49
Kpol_401.37.168ON7862644621e-49
Suva_7.5665.34ON13982364652e-49
Kwal_26.77492.472ON8142574612e-49
NCAS0J015504.259ON7722424593e-49
Ecym_74002.472ON8042564594e-49
AAR025C7.168ON7262644574e-49
TDEL0A024802.472ON8162574594e-49
KLTH0D05412g2.472ON8132574577e-49
CAGL0C02585g4.259ON7712724567e-49
KAFR0A058904.259ON7722824568e-49
Suva_13.2662.472ON8232574561e-48
Klac_YGOB_Anc_7.168b7.168ON7792614551e-48
KAFR0A007402.472ON7842574551e-48
NDAI0E035807.168ON7822624532e-48
KLLA0B03234g4.259ON8042454532e-48
TPHA0B007304.259ON7763114523e-48
SAKL0H02750g4.259ON7762944523e-48
NCAS0E020207.168ON7732644523e-48
CAGL0J01353g2.472ON8272554533e-48
YMR089C (YTA12)2.472ON8252574524e-48
Smik_13.2732.472ON8272574524e-48
TBLA0D044907.168ON7822944505e-48
NDAI0H022102.472ON8032574507e-48
KLTH0D14586g4.259ON7742674488e-48
NCAS0A078202.472ON7912574489e-48
TPHA0C015207.168ON7842644489e-48
KLLA0F13706g2.472ON8422574491e-47
Suva_5.1097.168ON7612594471e-47
SAKL0F03894g7.168ON7422634471e-47
SAKL0E03014g2.472ON8302574481e-47
YLR397C (AFG2)4.259ON7802494471e-47
Kpol_467.232.472ON8592574481e-47
Suva_10.5144.259ON7802424453e-47
ABL041W2.472ON8182564453e-47
NDAI0J023204.259ON7782424443e-47
KNAG0C033207.430ON7662544443e-47
CAGL0H09416g7.168ON7502644434e-47
TDEL0H027707.168ON7442644434e-47
KAFR0K020607.430ON7262544407e-47
Smik_5.1387.168ON7602594418e-47
NCAS0A146407.430ON7502544409e-47
TPHA0G031302.472ON7922664419e-47
Kwal_23.41944.259ON7742774419e-47
Smik_12.4844.259ON7802664419e-47
Skud_5.1217.168ON7622594401e-46
ZYRO0F13024g7.430ON7402544391e-46
KLLA0E06711g7.430ON7692544391e-46
Skud_12.4824.259ON7772714392e-46
YLL034C (RIX7)4.23ON8372574402e-46
Ecym_71237.430ON7272554372e-46
YER017C (AFG3)7.168ON7612594382e-46
Ecym_62184.23ON8382574392e-46
Smik_12.224.23ON8372574383e-46
Suva_10.384.23ON8372574383e-46
Skud_12.334.23ON8372574383e-46
ZYRO0G03212g2.472ON8302554374e-46
SAKL0H25630g4.23ON8302584374e-46
KAFR0G028007.168ON7832624364e-46
KNAG0E025502.472ON8452574365e-46
NDAI0A013907.430ON7122554335e-46
SAKL0F13376g7.430ON7412544346e-46
NCAS0A029404.23ON8572884366e-46
Suva_16.3517.430ON7472544347e-46
CAGL0K05093g7.430ON7452544338e-46
TDEL0C029307.430ON7402544329e-46
TBLA0F014707.430ON8022544331e-45
YPR024W (YME1)7.430ON7472544321e-45
CAGL0D02838g4.23ON8342574331e-45
Smik_16.2657.430ON7472544311e-45
TDEL0E011104.259ON7782684321e-45
ZYRO0B12606g4.259ON7772784322e-45
AGL274W7.430ON7322544302e-45
Skud_16.3097.430ON7472544302e-45
KLLA0E00837g4.23ON8142574313e-45
ZYRO0G08008g4.23ON8262884313e-45
Kpol_1044.154.23ON8392574313e-45
KLTH0C05742g7.430ON7442544293e-45
KNAG0E010404.23ON7852574294e-45
TPHA0E006607.430ON7822554284e-45
TPHA0K022204.23ON8202484286e-45
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0B02550
         (463 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0B02550 Chr2 (583789..585180) [1392 bp, 463 aa] {ON} Anc_5.2...   839   0.0  
Kpol_1032.87 s1032 complement(185143..186537) [1395 bp, 464 aa] ...   789   0.0  
TDEL0E03750 Chr5 (709088..710503) [1416 bp, 471 aa] {ON} Anc_5.2...   778   0.0  
CAGL0E06490g Chr5 (649826..651244) [1419 bp, 472 aa] {ON} highly...   778   0.0  
Skud_11.82 Chr11 (160364..161770) [1407 bp, 468 aa] {ON} YKL145W...   777   0.0  
YKL145W Chr11 (174213..175616) [1404 bp, 467 aa] {ON}  RPT1One o...   776   0.0  
NCAS0F02300 Chr6 complement(456422..457846) [1425 bp, 474 aa] {O...   776   0.0  
Smik_11.91 Chr11 (160113..161519) [1407 bp, 468 aa] {ON} YKL145W...   775   0.0  
ACR050C Chr3 complement(447221..448648) [1428 bp, 475 aa] {ON} S...   775   0.0  
Ecym_8250 Chr8 (512209..513579) [1371 bp, 456 aa] {ON} similar t...   773   0.0  
TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.2...   773   0.0  
SAKL0G11484g Chr7 (982362..982478,982604..983857) [1371 bp, 456 ...   771   0.0  
ZYRO0A10560g Chr1 (854410..855816) [1407 bp, 468 aa] {ON} highly...   771   0.0  
KLTH0G07524g Chr7 (610689..610802,611037..612260) [1338 bp, 445 ...   769   0.0  
Suva_11.80 Chr11 (160287..161702) [1416 bp, 471 aa] {ON} YKL145W...   764   0.0  
KAFR0H03630 Chr8 (691036..692382) [1347 bp, 448 aa] {ON} Anc_5.2...   762   0.0  
KNAG0H02300 Chr8 (417868..419301) [1434 bp, 477 aa] {ON} Anc_5.2...   753   0.0  
KLLA0E13773g Chr5 complement(1215253..1216680) [1428 bp, 475 aa]...   736   0.0  
Kwal_23.2849 s23 (40940..42169) [1230 bp, 409 aa] {ON} YKL145W (...   716   0.0  
NDAI0C03780 Chr3 complement(860828..861985) [1158 bp, 385 aa] {O...   651   0.0  
Suva_7.227 Chr7 complement(402610..403827) [1218 bp, 405 aa] {ON...   308   e-100
Skud_7.236 Chr7 complement(412698..413915) [1218 bp, 405 aa] {ON...   307   e-100
Smik_7.235 Chr7 complement(401584..402801) [1218 bp, 405 aa] {ON...   307   e-100
YGL048C Chr7 complement(410069..411286) [1218 bp, 405 aa] {ON}  ...   307   e-100
KLLA0A04752g Chr1 complement(425610..426824) [1215 bp, 404 aa] {...   307   e-100
KLTH0D03806g Chr4 complement(371457..372674) [1218 bp, 405 aa] {...   303   9e-99
Kwal_26.7474 s26 complement(379608..380825) [1218 bp, 405 aa] {O...   303   9e-99
CAGL0D06292g Chr4 (593556..594758) [1203 bp, 400 aa] {ON} highly...   301   4e-98
ZYRO0G22330g Chr7 complement(1835777..1836994) [1218 bp, 405 aa]...   301   6e-98
AGL043C Chr7 complement(625438..626655) [1218 bp, 405 aa] {ON} S...   301   6e-98
Kpol_1041.42 s1041 (110852..112063) [1212 bp, 403 aa] {ON} (1108...   301   8e-98
SAKL0H23672g Chr8 (2045883..2047109) [1227 bp, 408 aa] {ON} high...   301   9e-98
NCAS0A05880 Chr1 complement(1154364..1155587) [1224 bp, 407 aa] ...   300   1e-97
TDEL0E05660 Chr5 complement(1051545..1052765) [1221 bp, 406 aa] ...   299   4e-97
KAFR0F03100 Chr6 complement(617330..618547) [1218 bp, 405 aa] {O...   299   6e-97
KNAG0D03200 Chr4 complement(573942..575144) [1203 bp, 400 aa] {O...   298   7e-97
NDAI0D02850 Chr4 (659572..660789) [1218 bp, 405 aa] {ON} Anc_4.57     298   9e-97
TBLA0B09880 Chr2 (2356110..2357315) [1206 bp, 401 aa] {ON} Anc_4...   298   1e-96
TPHA0F00440 Chr6 complement(106389..107600) [1212 bp, 403 aa] {O...   297   2e-96
Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {...   281   1e-89
SAKL0H05764g Chr8 (514898..516163) [1266 bp, 421 aa] {ON} highly...   280   2e-89
KLLA0C09592g Chr3 (833061..834365) [1305 bp, 434 aa] {ON} highly...   280   2e-89
Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {...   279   7e-89
KNAG0G02720 Chr7 complement(606758..608092) [1335 bp, 444 aa] {O...   279   1e-88
Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON...   278   2e-88
KLTH0D11990g Chr4 complement(976271..977572) [1302 bp, 433 aa] {...   277   5e-88
YOR259C Chr15 complement(812395..813708) [1314 bp, 437 aa] {ON} ...   276   6e-88
AAL113W Chr1 (146143..147441) [1299 bp, 432 aa] {ON} Syntenic ho...   276   7e-88
CAGL0K08910g Chr11 (893007..894317) [1311 bp, 436 aa] {ON} highl...   276   8e-88
Ecym_2365 Chr2 (712020..713303) [1284 bp, 427 aa] {ON} similar t...   275   1e-87
KAFR0A04010 Chr1 complement(809423..810697) [1275 bp, 424 aa] {O...   275   2e-87
NCAS0B01150 Chr2 (192406..193686) [1281 bp, 426 aa] {ON} Anc_8.708    275   2e-87
TDEL0A06530 Chr1 complement(1140292..1141599) [1308 bp, 435 aa] ...   275   2e-87
Kwal_26.8912 s26 complement(1003260..1004564) [1305 bp, 434 aa] ...   274   4e-87
TBLA0D01240 Chr4 (310540..311871) [1332 bp, 443 aa] {ON} Anc_8.7...   274   9e-87
NDAI0E01020 Chr5 (206043..207374) [1332 bp, 443 aa] {ON} Anc_8.708    274   1e-86
Kpol_1064.22 s1064 complement(38724..40022) [1299 bp, 432 aa] {O...   273   1e-86
NCAS0A10180 Chr1 complement(2028343..2029656) [1314 bp, 437 aa] ...   273   2e-86
KLLA0E21209g Chr5 complement(1893904..1895202) [1299 bp, 432 aa]...   270   1e-85
ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {...   271   2e-85
TPHA0D01470 Chr4 complement(302134..303501) [1368 bp, 455 aa] {O...   271   2e-85
NDAI0A07290 Chr1 (1663036..1664166) [1131 bp, 376 aa] {ON} Anc_3...   268   2e-85
YDL007W Chr4 (438047..439360) [1314 bp, 437 aa] {ON}  RPT2One of...   270   2e-85
Ecym_5527 Chr5 (1069222..1070520) [1299 bp, 432 aa] {ON} similar...   270   2e-85
KAFR0F02440 Chr6 (477459..478769) [1311 bp, 436 aa] {ON} Anc_3.2...   270   2e-85
SAKL0G02376g Chr7 (198787..200091) [1305 bp, 434 aa] {ON} highly...   270   3e-85
NCAS0F03330 Chr6 (674144..675448) [1305 bp, 434 aa] {ON} Anc_5.428    270   3e-85
Smik_4.229 Chr4 (417215..418528) [1314 bp, 437 aa] {ON} YDL007W ...   270   3e-85
TDEL0D04060 Chr4 (744364..745677) [1314 bp, 437 aa] {ON} Anc_3.2...   270   3e-85
KNAG0K01530 Chr11 complement(315711..317018) [1308 bp, 435 aa] {...   269   4e-85
TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.2...   269   4e-85
Suva_4.246 Chr4 (435306..436619) [1314 bp, 437 aa] {ON} YDL007W ...   269   4e-85
ZYRO0A04224g Chr1 (341547..342860) [1314 bp, 437 aa] {ON} highly...   269   6e-85
Kpol_1010.74 s1010 complement(182279..183592) [1314 bp, 437 aa] ...   269   7e-85
KLTH0F16214g Chr6 complement(1313746..1315050) [1305 bp, 434 aa]...   268   1e-84
Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007...   266   1e-84
KNAG0C04960 Chr3 complement(957096..958367) [1272 bp, 423 aa] {O...   267   2e-84
Kwal_55.21453 s55 complement(844026..845330) [1305 bp, 434 aa] {...   268   2e-84
SAKL0C11440g Chr3 complement(1028353..1029660,1029734..1029736) ...   268   2e-84
CAGL0A02750g Chr1 (292470..293759) [1290 bp, 429 aa] {ON} highly...   267   2e-84
CAGL0I04884g Chr9 (446336..447637) [1302 bp, 433 aa] {ON} highly...   267   2e-84
Ecym_5286 Chr5 (578258..579571) [1314 bp, 437 aa] {ON} similar t...   267   2e-84
TPHA0A04270 Chr1 (962488..963801) [1314 bp, 437 aa] {ON} Anc_3.2...   267   4e-84
Smik_15.295 Chr15 (506228..507532) [1305 bp, 434 aa] {ON} YOR117...   266   4e-84
Skud_4.247 Chr4 (429639..430952) [1314 bp, 437 aa] {ON} YDL007W ...   266   5e-84
KAFR0E03890 Chr5 (770235..771539) [1305 bp, 434 aa] {ON} Anc_5.4...   266   5e-84
YOR117W Chr15 (545029..546333) [1305 bp, 434 aa] {ON}  RPT5One o...   266   5e-84
AEL011W Chr5 (613775..615088) [1314 bp, 437 aa] {ON} Syntenic ho...   266   5e-84
Suva_8.170 Chr8 (302825..304129) [1305 bp, 434 aa] {ON} YOR117W ...   266   5e-84
TBLA0F00690 Chr6 (177827..179131) [1305 bp, 434 aa] {ON} Anc_3.2...   266   6e-84
Kpol_1062.33 s1062 complement(71197..72501) [1305 bp, 434 aa] {O...   266   7e-84
Skud_15.280 Chr15 (501467..502771) [1305 bp, 434 aa] {ON} YOR117...   265   1e-83
TDEL0E01970 Chr5 complement(371140..372444) [1305 bp, 434 aa] {O...   265   1e-83
AER254W Chr5 (1106478..1107860) [1383 bp, 460 aa] {ON} Syntenic ...   266   1e-83
NDAI0B05620 Chr2 (1374568..1376016) [1449 bp, 482 aa] {ON} Anc_5...   266   3e-83
TBLA0A03740 Chr1 (935676..936980) [1305 bp, 434 aa] {ON} Anc_5.4...   264   4e-83
KLLA0F14707g Chr6 (1361964..1363268) [1305 bp, 434 aa] {ON} high...   264   6e-83
KLTH0G16698g Chr7 complement(1451637..1452941,1453023..1453085) ...   264   8e-83
ZYRO0F09900g Chr6 (804272..805576) [1305 bp, 434 aa] {ON} highly...   263   2e-82
Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON} (37962..3...   253   4e-79
ZYRO0D11528g Chr4 (970060..971421) [1362 bp, 453 aa] {ON} highly...   253   1e-78
KLLA0C06534g Chr3 (572219..573505) [1287 bp, 428 aa] {ON} highly...   251   3e-78
NCAS0A11980 Chr1 (2374708..2375988) [1281 bp, 426 aa] {ON} Anc_5...   251   3e-78
NDAI0A04290 Chr1 complement(967063..968343) [1281 bp, 426 aa] {O...   251   4e-78
Ecym_4548 Chr4 complement(1081534..1082811) [1278 bp, 425 aa] {O...   250   7e-78
Smik_4.668 Chr4 (1182472..1183758) [1287 bp, 428 aa] {ON} YDR394...   250   9e-78
YDR394W Chr4 (1261681..1262967) [1287 bp, 428 aa] {ON}  RPT3One ...   250   9e-78
CAGL0K09526g Chr11 (939503..940798) [1296 bp, 431 aa] {ON} highl...   249   1e-77
Skud_4.668 Chr4 (1183563..1184849) [1287 bp, 428 aa] {ON} YDR394...   249   1e-77
TBLA0D01860 Chr4 complement(456813..458102) [1290 bp, 429 aa] {O...   249   1e-77
AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic ...   251   2e-77
KAFR0E03580 Chr5 complement(720946..722223) [1278 bp, 425 aa] {O...   249   2e-77
TPHA0J02860 Chr10 (633666..634961) [1296 bp, 431 aa] {ON} Anc_5....   249   3e-77
SAKL0G03828g Chr7 (315123..316400) [1278 bp, 425 aa] {ON} highly...   248   4e-77
Suva_2.571 Chr2 (1012937..1014223) [1287 bp, 428 aa] {ON} YDR394...   248   5e-77
KNAG0C04590 Chr3 complement(901771..903069) [1299 bp, 432 aa] {O...   248   5e-77
TDEL0A03500 Chr1 (623972..625252) [1281 bp, 426 aa] {ON} Anc_5.4...   240   4e-74
KLTH0G02662g Chr7 (206550..207827) [1278 bp, 425 aa] {ON} highly...   238   5e-73
Kpol_1020.9 s1020 complement(19429..21867) [2439 bp, 812 aa] {ON...   207   3e-58
TBLA0J00640 Chr10 (149521..152079) [2559 bp, 852 aa] {ON} Anc_7....   207   3e-58
TDEL0H01560 Chr8 complement(267940..270456) [2517 bp, 838 aa] {O...   206   5e-58
NCAS0E03580 Chr5 (711229..713034) [1806 bp, 601 aa] {ON} Anc_7.288    202   7e-58
TBLA0C04840 Chr3 (1172444..1174987) [2544 bp, 847 aa] {ON} Anc_7...   205   1e-57
Kpol_2000.15 s2000 complement(25249..27720) [2472 bp, 823 aa] {O...   204   2e-57
KLLA0F05676g Chr6 complement(553406..555898) [2493 bp, 830 aa] {...   204   2e-57
SAKL0F09834g Chr6 (753930..756458) [2529 bp, 842 aa] {ON} highly...   204   2e-57
KLTH0A05324g Chr1 (442339..444837) [2499 bp, 832 aa] {ON} highly...   204   2e-57
NCAS0A13760 Chr1 (2701600..2704077) [2478 bp, 825 aa] {ON}            204   2e-57
NDAI0A03040 Chr1 complement(680017..682545) [2529 bp, 842 aa] {O...   204   3e-57
KNAG0B02940 Chr2 complement(564664..567180) [2517 bp, 838 aa] {O...   204   3e-57
NDAI0A02280 Chr1 complement(512577..515054) [2478 bp, 825 aa] {O...   203   5e-57
Smik_4.111 Chr4 complement(212808..215315) [2508 bp, 835 aa] {ON...   203   5e-57
Kwal_23.5996 s23 (1408496..1410991) [2496 bp, 831 aa] {ON} YDL12...   203   6e-57
Ecym_8037 Chr8 (84479..86989) [2511 bp, 836 aa] {ON} similar to ...   203   7e-57
KAFR0L01190 Chr12 (222427..224901) [2475 bp, 824 aa] {ON} Anc_7....   202   8e-57
Suva_4.119 Chr4 complement(224752..227262) [2511 bp, 836 aa] {ON...   202   9e-57
Skud_4.129 Chr4 complement(231893..234400) [2508 bp, 835 aa] {ON...   202   9e-57
YDL126C Chr4 complement(236157..238664) [2508 bp, 835 aa] {ON}  ...   202   9e-57
AFR158W Chr6 (720212..722710) [2499 bp, 832 aa] {ON} Syntenic ho...   202   1e-56
CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa] ...   202   1e-56
ZYRO0C09262g Chr3 (703476..705968) [2493 bp, 830 aa] {ON} highly...   202   1e-56
TPHA0A03260 Chr1 complement(718294..720774) [2481 bp, 826 aa] {O...   201   3e-56
NCAS0E04050 Chr5 (792784..796773) [3990 bp, 1329 aa] {ON} Anc_5.34    194   3e-53
KAFR0D01900 Chr4 complement(382890..386675) [3786 bp, 1261 aa] {...   194   4e-53
ZYRO0D07414g Chr4 complement(643893..648155) [4263 bp, 1420 aa] ...   192   1e-52
TDEL0G00590 Chr7 complement(120616..124500) [3885 bp, 1294 aa] {...   191   4e-52
NDAI0B00780 Chr2 complement(178836..182882) [4047 bp, 1348 aa] {...   191   5e-52
Kwal_47.18848 s47 complement(997574..998479) [906 bp, 302 aa] {O...   179   6e-52
Ecym_4769 Chr4 complement(1496524..1500543) [4020 bp, 1339 aa] {...   189   1e-51
TPHA0L02210 Chr12 (459500..463702) [4203 bp, 1400 aa] {ON} Anc_5...   189   2e-51
KLTH0B09130g Chr2 (742805..746806) [4002 bp, 1333 aa] {ON} simil...   189   2e-51
SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa] ...   189   3e-51
Kpol_513.19 s513 (53678..57811) [4134 bp, 1377 aa] {ON} (53678.....   189   3e-51
TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON} Anc_...   188   3e-51
KNAG0K00280 Chr11 complement(43553..47779) [4227 bp, 1408 aa] {O...   188   3e-51
CAGL0G00528g Chr7 complement(54617..58570) [3954 bp, 1317 aa] {O...   188   4e-51
KLLA0A09823g Chr1 (858458..862417) [3960 bp, 1319 aa] {ON} simil...   187   6e-51
ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic h...   187   6e-51
Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}...   186   7e-51
Smik_16.38 Chr16 complement(65946..70115) [4170 bp, 1389 aa] {ON...   186   1e-50
Skud_7.603 Chr7 (1001881..1006041) [4161 bp, 1386 aa] {ON} YGR27...   186   2e-50
ZYRO0D15290g Chr4 complement(1283982..1286165) [2184 bp, 727 aa]...   184   2e-50
TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {O...   184   3e-50
Kwal_23.4253 s23 complement(640328..644317) [3990 bp, 1329 aa] {...   186   3e-50
Ecym_1258 Chr1 (530600..532843) [2244 bp, 747 aa] {ON} similar t...   183   5e-50
KNAG0L01060 Chr12 complement(193013..195154) [2142 bp, 713 aa] {...   182   7e-50
KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa] ...   183   7e-50
Skud_13.245 Chr13 complement(419466..421940) [2475 bp, 824 aa] {...   183   9e-50
KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]...   182   1e-49
YGR270W Chr7 (1027370..1031509) [4140 bp, 1379 aa] {ON}  YTA7Pro...   184   1e-49
Kpol_401.3 s401 complement(5130..7490) [2361 bp, 786 aa] {ON} co...   182   1e-49
Suva_7.566 Chr7 (982174..986370) [4197 bp, 1398 aa] {ON} YGR270W...   183   2e-49
Kwal_26.7749 s26 (497057..499501) [2445 bp, 814 aa] {ON} YMR089C...   182   2e-49
NCAS0J01550 Chr10 complement(274194..276512) [2319 bp, 772 aa] {...   181   3e-49
Ecym_7400 Chr7 complement(822595..825009) [2415 bp, 804 aa] {ON}...   181   4e-49
AAR025C Chr1 complement(385327..387507) [2181 bp, 726 aa] {ON} S...   180   4e-49
TDEL0A02480 Chr1 (443736..446186) [2451 bp, 816 aa] {ON} Anc_2.4...   181   4e-49
KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} simila...   180   7e-49
CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly...   180   7e-49
KAFR0A05890 Chr1 (1195474..1197792) [2319 bp, 772 aa] {ON} Anc_4...   180   8e-49
Suva_13.266 Chr13 complement(427123..429594) [2472 bp, 823 aa] {...   180   1e-48
Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2...   179   1e-48
KAFR0A00740 Chr1 (132072..134426) [2355 bp, 784 aa] {ON} Anc_2.4...   179   1e-48
NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168    179   2e-48
KLLA0B03234g Chr2 (293919..296333) [2415 bp, 804 aa] {ON} simila...   179   2e-48
TPHA0B00730 Chr2 (165929..168259) [2331 bp, 776 aa] {ON} Anc_4.2...   178   3e-48
SAKL0H02750g Chr8 (273630..275960) [2331 bp, 776 aa] {ON} highly...   178   3e-48
NCAS0E02020 Chr5 (386327..388648) [2322 bp, 773 aa] {ON} Anc_7.168    178   3e-48
CAGL0J01353g Chr10 (124994..127477) [2484 bp, 827 aa] {ON} simil...   179   3e-48
YMR089C Chr13 complement(445609..448086) [2478 bp, 825 aa] {ON} ...   178   4e-48
Smik_13.273 Chr13 complement(429460..431943) [2484 bp, 827 aa] {...   178   4e-48
TBLA0D04490 Chr4 complement(1111512..1113860) [2349 bp, 782 aa] ...   177   5e-48
NDAI0H02210 Chr8 complement(538548..540959) [2412 bp, 803 aa] {O...   177   7e-48
KLTH0D14586g Chr4 complement(1190295..1192619) [2325 bp, 774 aa]...   177   8e-48
NCAS0A07820 Chr1 complement(1556553..1558928) [2376 bp, 791 aa] ...   177   9e-48
TPHA0C01520 Chr3 (349034..351388) [2355 bp, 784 aa] {ON} Anc_7.1...   177   9e-48
KLLA0F13706g Chr6 complement(1269550..1272078) [2529 bp, 842 aa]...   177   1e-47
Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON...   176   1e-47
SAKL0F03894g Chr6 (312042..314270) [2229 bp, 742 aa] {ON} simila...   176   1e-47
SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {...   177   1e-47
YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON} ...   176   1e-47
Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON} (50661..5...   177   1e-47
Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {...   176   3e-47
ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic ho...   176   3e-47
NDAI0J02320 Chr10 complement(562320..564656) [2337 bp, 778 aa] {...   175   3e-47
KNAG0C03320 Chr3 complement(654346..656646) [2301 bp, 766 aa] {O...   175   3e-47
CAGL0H09416g Chr8 (921571..923823) [2253 bp, 750 aa] {ON} highly...   175   4e-47
TDEL0H02770 Chr8 (458980..461214) [2235 bp, 744 aa] {ON} Anc_7.1...   175   4e-47
KAFR0K02060 Chr11 (418631..420811) [2181 bp, 726 aa] {ON} Anc_7....   174   7e-47
Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON...   174   8e-47
NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON} Anc_7...   174   9e-47
TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.4...   174   9e-47
Kwal_23.4194 s23 (612204..614528) [2325 bp, 774 aa] {ON} YLR397C...   174   9e-47
Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {...   174   9e-47
Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON...   174   1e-46
ZYRO0F13024g Chr6 (1063334..1065556) [2223 bp, 740 aa] {ON} simi...   173   1e-46
KLLA0E06711g Chr5 complement(607187..609496) [2310 bp, 769 aa] {...   173   1e-46
Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {...   173   2e-46
YLL034C Chr12 complement(70633..73146) [2514 bp, 837 aa] {ON}  R...   174   2e-46
Ecym_7123 Chr7 complement(247275..249458) [2184 bp, 727 aa] {ON}...   172   2e-46
YER017C Chr5 complement(189503..191788) [2286 bp, 761 aa] {ON}  ...   173   2e-46
Ecym_6218 Chr6 complement(409972..412488) [2517 bp, 838 aa] {ON}...   173   2e-46
Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}...   173   3e-46
Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}...   173   3e-46
Skud_12.33 Chr12 complement(61780..64293) [2514 bp, 837 aa] {ON}...   173   3e-46
ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} simila...   172   4e-46
SAKL0H25630g Chr8 (2244348..2246840) [2493 bp, 830 aa] {ON} high...   172   4e-46
KAFR0G02800 Chr7 complement(581262..583613) [2352 bp, 783 aa] {O...   172   4e-46
KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.4...   172   5e-46
NDAI0A01390 Chr1 complement(310386..312524) [2139 bp, 712 aa] {O...   171   5e-46
SAKL0F13376g Chr6 (1058414..1060639) [2226 bp, 741 aa] {ON} high...   171   6e-46
NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23     172   6e-46
Suva_16.351 Chr16 (616052..618295) [2244 bp, 747 aa] {ON} YPR024...   171   7e-46
CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highl...   171   8e-46
TDEL0C02930 Chr3 (516526..518748) [2223 bp, 740 aa] {ON} Anc_7.4...   171   9e-46
TBLA0F01470 Chr6 (359540..361948) [2409 bp, 802 aa] {ON} Anc_7.4...   171   1e-45
YPR024W Chr16 (610481..612724) [2244 bp, 747 aa] {ON}  YME1Catal...   171   1e-45
CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {...   171   1e-45
Smik_16.265 Chr16 (486410..488653) [2244 bp, 747 aa] {ON} YPR024...   170   1e-45
TDEL0E01110 Chr5 (227041..229377) [2337 bp, 778 aa] {ON} Anc_4.2...   171   1e-45
ZYRO0B12606g Chr2 complement(1013826..1016159) [2334 bp, 777 aa]...   171   2e-45
AGL274W Chr7 (191481..193679) [2199 bp, 732 aa] {ON} Syntenic ho...   170   2e-45
Skud_16.309 Chr16 (575130..577373) [2244 bp, 747 aa] {ON} YPR024...   170   2e-45
KLLA0E00837g Chr5 complement(84426..86870) [2445 bp, 814 aa] {ON...   170   3e-45
ZYRO0G08008g Chr7 complement(649595..652075) [2481 bp, 826 aa] {...   170   3e-45
Kpol_1044.15 s1044 complement(29676..32195) [2520 bp, 839 aa] {O...   170   3e-45
KLTH0C05742g Chr3 complement(499428..501662) [2235 bp, 744 aa] {...   169   3e-45
KNAG0E01040 Chr5 complement(195972..198329) [2358 bp, 785 aa] {O...   169   4e-45
TPHA0E00660 Chr5 complement(125411..127759) [2349 bp, 782 aa] {O...   169   4e-45
TPHA0K02220 Chr11 (473969..476431) [2463 bp, 820 aa] {ON} Anc_4....   169   6e-45
TBLA0E01450 Chr5 complement(327199..329784) [2586 bp, 861 aa] {O...   169   9e-45
TBLA0A06380 Chr1 (1566622..1569048) [2427 bp, 808 aa] {ON} Anc_4...   168   1e-44
TDEL0G01680 Chr7 (329761..332181) [2421 bp, 806 aa] {ON} Anc_4.2...   167   2e-44
Kpol_1045.11 s1045 complement(28898..30985) [2088 bp, 695 aa] {O...   166   2e-44
KAFR0L00260 Chr12 (44832..47216) [2385 bp, 794 aa] {ON} Anc_4.23...   167   3e-44
KLTH0E06006g Chr5 complement(542954..545413) [2460 bp, 819 aa] {...   167   4e-44
NDAI0E03960 Chr5 complement(877738..880071) [2334 bp, 777 aa] {O...   166   5e-44
AFR188W Chr6 (778329..780812) [2484 bp, 827 aa] {ON} Syntenic ho...   165   2e-43
NDAI0D04890 Chr4 (1160943..1163555) [2613 bp, 870 aa] {ON} Anc_7...   165   2e-43
Kwal_55.20644 s55 complement(502435..504876) [2442 bp, 813 aa] {...   164   2e-43
CAGL0D02574g Chr4 (263063..266116) [3054 bp, 1017 aa] {ON} simil...   162   2e-42
TBLA0I00550 Chr9 (96744..99863) [3120 bp, 1039 aa] {ON} Anc_3.9 ...   162   3e-42
NCAS0E01270 Chr5 complement(243168..246005) [2838 bp, 945 aa] {O...   162   3e-42
NDAI0G01370 Chr7 (306715..309921) [3207 bp, 1068 aa] {ON} Anc_3.9     160   1e-41
Klac_YGOB_Anc_7.168 Chr2 (1011211..1012734) [1524 bp, 507 aa] {O...   155   2e-41
KLLA0E02003g Chr5 complement(187814..190816) [3003 bp, 1000 aa] ...   159   3e-41
Kwal_55.22137 s55 (1127242..1130358) [3117 bp, 1038 aa] {ON} YNL...   157   1e-40
KLTH0F19646g Chr6 (1592186..1595320) [3135 bp, 1044 aa] {ON} sim...   157   1e-40
KAFR0A08620 Chr1 (1727701..1730850) [3150 bp, 1049 aa] {ON} Anc_...   156   3e-40
Smik_14.3 Chr14 complement(3964..7053) [3090 bp, 1029 aa] {ON} Y...   155   3e-40
Skud_14.12 Chr14 complement(12962..16126) [3165 bp, 1054 aa] {ON...   155   5e-40
Kpol_1014.31 s1014 (54948..58082) [3135 bp, 1044 aa] {ON} (54948...   154   1e-39
Suva_14.12 Chr14 complement(14684..17773) [3090 bp, 1029 aa] {ON...   154   1e-39
AER065C Chr5 complement(753980..756304) [2325 bp, 774 aa] {ON} S...   153   1e-39
TDEL0A00280 Chr1 complement(46558..49620) [3063 bp, 1020 aa] {ON...   153   2e-39
KNAG0K02600 Chr11 (517667..520744) [3078 bp, 1025 aa] {ON} Anc_3...   153   3e-39
YNL329C Chr14 complement(19541..22633) [3093 bp, 1030 aa] {ON}  ...   152   5e-39
ZYRO0G04510g Chr7 complement(363004..366159) [3156 bp, 1051 aa] ...   151   1e-38
TPHA0P01580 Chr16 (324418..327516) [3099 bp, 1032 aa] {ON} Anc_3...   150   2e-38
AGR394W Chr7 (1452410..1455475) [3066 bp, 1021 aa] {ON} Syntenic...   150   3e-38
Ecym_3259 Chr3 (495875..498199) [2325 bp, 774 aa] {ON} similar t...   148   9e-38
ZYRO0C03476g Chr3 (274719..277805) [3087 bp, 1028 aa] {ON} simil...   148   1e-37
SAKL0C13684g Chr3 (1204367..1207471) [3105 bp, 1034 aa] {ON} sim...   147   2e-37
KLLA0B06094g Chr2 complement(541408..542490) [1083 bp, 360 aa] {...   141   2e-37
KLLA0B06523g Chr2 complement(579869..582862) [2994 bp, 997 aa] {...   142   1e-35
Ecym_3161 Chr3 complement(308085..311240) [3156 bp, 1051 aa] {ON...   142   1e-35
KNAG0F03850 Chr6 complement(729019..730323) [1305 bp, 434 aa] {O...   135   1e-34
NCAS0A01990 Chr1 (381080..382165) [1086 bp, 361 aa] {ON}              133   2e-34
Kpol_385.7 s385 (17541..18629) [1089 bp, 362 aa] {ON} (17541..18...   133   2e-34
SAKL0F15884g Chr6 complement(1285496..1286782) [1287 bp, 428 aa]...   134   4e-34
CAGL0K03971g Chr11 (367761..368840) [1080 bp, 359 aa] {ON} highl...   132   5e-34
TBLA0E00840 Chr5 (182594..183883) [1290 bp, 429 aa] {ON} Anc_7.5...   133   1e-33
SAKL0D12606g Chr4 (1044200..1047274) [3075 bp, 1024 aa] {ON} sim...   136   2e-33
Skud_16.478 Chr16 complement(829027..830340) [1314 bp, 437 aa] {...   132   2e-33
Kwal_23.5338 s23 complement(1116675..1117961) [1287 bp, 428 aa] ...   132   2e-33
CAGL0H09174g Chr8 complement(898883..901978) [3096 bp, 1031 aa] ...   135   2e-33
Smik_16.438 Chr16 complement(749208..750521) [1314 bp, 437 aa] {...   132   2e-33
YPR173C Chr16 complement(886524..887837) [1314 bp, 437 aa] {ON} ...   132   2e-33
TPHA0I03200 Chr9 complement(706938..708236) [1299 bp, 432 aa] {O...   132   2e-33
NDAI0D03930 Chr4 (928651..929715) [1065 bp, 354 aa] {ON}              130   3e-33
TBLA0B02000 Chr2 complement(463205..466300) [3096 bp, 1031 aa] {...   135   4e-33
TDEL0F00540 Chr6 complement(90867..93965) [3099 bp, 1032 aa] {ON...   135   4e-33
NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1....   134   6e-33
NDAI0J00290 Chr10 complement(47691..49028) [1338 bp, 445 aa] {ON...   131   7e-33
KAFR0B00410 Chr2 (88947..90221) [1275 bp, 424 aa] {ON} Anc_7.530...   130   7e-33
Suva_16.506 Chr16 complement(869082..870395) [1314 bp, 437 aa] {...   130   7e-33
SAKL0B03894g Chr2 (345902..346978) [1077 bp, 358 aa] {ON} highly...   129   7e-33
KLTH0A00968g Chr1 (96149..97432) [1284 bp, 427 aa] {ON} highly s...   130   8e-33
Kpol_1013.42 s1013 (96318..97610) [1293 bp, 430 aa] {ON} (96318....   130   8e-33
NCAS0A15130 Chr1 complement(2978192..2979496) [1305 bp, 434 aa] ...   130   8e-33
NDAI0D01440 Chr4 (335388..338645) [3258 bp, 1085 aa] {ON} Anc_1....   134   9e-33
Ecym_8344 Chr8 (694173..695261) [1089 bp, 362 aa] {ON} similar t...   128   2e-32
Suva_11.25 Chr11 complement(54969..58109) [3141 bp, 1046 aa] {ON...   133   2e-32
Kwal_27.10012 s27 complement(158559..161615) [3057 bp, 1018 aa] ...   132   3e-32
Suva_7.309 Chr7 (527237..528325) [1089 bp, 362 aa] {ON} YGR028W ...   127   3e-32
CAGL0I06402g Chr9 (620231..621529) [1299 bp, 432 aa] {ON} highly...   129   4e-32
KAFR0E00340 Chr5 complement(77112..80087) [2976 bp, 991 aa] {ON}...   131   4e-32
Ecym_2804 Chr2 complement(1561704..1563005) [1302 bp, 433 aa] {O...   128   5e-32
YKL197C Chr11 complement(70734..73865) [3132 bp, 1043 aa] {ON}  ...   131   7e-32
TBLA0I02090 Chr9 complement(474394..477000) [2607 bp, 868 aa] {O...   131   7e-32
TPHA0F00980 Chr6 (222909..223991) [1083 bp, 360 aa] {ON} Anc_4.1...   126   7e-32
KLLA0B10846g Chr2 complement(949338..950630) [1293 bp, 430 aa] {...   127   9e-32
TDEL0H00410 Chr8 (63535..64839) [1305 bp, 434 aa] {ON} Anc_7.530...   127   1e-31
KLTH0C02684g Chr3 complement(242904..245963) [3060 bp, 1019 aa] ...   130   1e-31
YGR028W Chr7 (542203..543291) [1089 bp, 362 aa] {ON}  MSP1Mitoch...   125   2e-31
KLLA0C14520g Chr3 complement(1269505..1271799) [2295 bp, 764 aa]...   129   2e-31
Smik_11.25 Chr11 complement(55016..58147) [3132 bp, 1043 aa] {ON...   130   2e-31
CAGL0E04642g Chr5 complement(447934..450141) [2208 bp, 735 aa] {...   129   2e-31
Skud_11.21 Chr11 complement(54078..57206) [3129 bp, 1042 aa] {ON...   129   2e-31
YPL074W Chr16 (415763..418027) [2265 bp, 754 aa] {ON}  YTA6Putat...   129   3e-31
SAKL0B06402g Chr2 complement(548471..550795) [2325 bp, 774 aa] {...   129   3e-31
AEL265W Chr5 (140797..142092) [1296 bp, 431 aa] {ON} Syntenic ho...   125   4e-31
AFR371W Chr6 (1105757..1108837) [3081 bp, 1026 aa] {ON} Syntenic...   129   4e-31
Skud_7.320 Chr7 (540689..541897) [1209 bp, 402 aa] {ON} YGR028W ...   125   6e-31
KLTH0G17930g Chr7 complement(1553688..1554764) [1077 bp, 358 aa]...   124   6e-31
Smik_6.97 Chr6 (172621..173709) [1089 bp, 362 aa] {ON} YGR028W (...   124   6e-31
Skud_16.208 Chr16 (387144..389408) [2265 bp, 754 aa] {ON} YPL074...   127   8e-31
Kpol_1056.21 s1056 complement(47832..51026) [3195 bp, 1064 aa] {...   128   8e-31
Suva_16.238 Chr16 (426245..428506) [2262 bp, 753 aa] {ON} YPL074...   127   1e-30
ZYRO0D01210g Chr4 (93236..94519) [1284 bp, 427 aa] {ON} highly s...   124   1e-30
Smik_16.162 Chr16 (298702..301230) [2529 bp, 842 aa] {ON} YPL074...   127   1e-30
TBLA0G03290 Chr7 complement(873305..875593) [2289 bp, 762 aa] {O...   127   2e-30
ZYRO0A12342g Chr1 (979094..980185) [1092 bp, 363 aa] {ON} highly...   122   2e-30
Kpol_1052.6 s1052 (16325..18616) [2292 bp, 763 aa] {ON} (16325.....   126   2e-30
KNAG0D03870 Chr4 (704252..705331) [1080 bp, 359 aa] {ON} Anc_4.1...   122   2e-30
TDEL0D02860 Chr4 complement(543697..544785) [1089 bp, 362 aa] {O...   122   3e-30
Smik_2.213 Chr2 complement(380313..382589) [2277 bp, 758 aa] {ON...   126   3e-30
YBR080C Chr2 complement(398614..400890) [2277 bp, 758 aa] {ON}  ...   125   4e-30
KNAG0G00290 Chr7 complement(45891..48884) [2994 bp, 997 aa] {ON}...   125   4e-30
AER169C Chr5 complement(951174..953462) [2289 bp, 762 aa] {ON} S...   125   4e-30
ZYRO0G12738g Chr7 complement(1012482..1014773) [2292 bp, 763 aa]...   125   5e-30
TPHA0A03890 Chr1 (856900..859182) [2283 bp, 760 aa] {ON} Anc_3.3...   125   5e-30
Suva_4.320 Chr4 complement(565994..568270) [2277 bp, 758 aa] {ON...   125   6e-30
NDAI0A07600 Chr1 complement(1741778..1744060) [2283 bp, 760 aa] ...   124   1e-29
CAGL0M01782g Chr13 (208704..210980) [2277 bp, 758 aa] {ON} highl...   124   2e-29
Skud_2.204 Chr2 complement(366362..368638) [2277 bp, 758 aa] {ON...   124   2e-29
TDEL0D03210 Chr4 (598442..600721) [2280 bp, 759 aa] {ON} Anc_3.3...   123   2e-29
TPHA0O01090 Chr15 complement(208519..211680) [3162 bp, 1053 aa] ...   122   4e-29
ABR036W Chr2 (464427..465509) [1083 bp, 360 aa] {ON} Syntenic ho...   118   6e-29
KAFR0C00290 Chr3 (54829..57111) [2283 bp, 760 aa] {ON} Anc_3.304...   122   7e-29
NCAS0I01400 Chr9 (256606..258882) [2277 bp, 758 aa] {ON} Anc_3.304    121   1e-28
KLTH0E14190g Chr5 complement(1255261..1257552) [2292 bp, 763 aa]...   121   1e-28
Ecym_7426 Chr7 complement(873420..875714) [2295 bp, 764 aa] {ON}...   121   1e-28
Kwal_27.12376 s27 complement(1199810..1202056) [2247 bp, 749 aa]...   120   2e-28
ZYRO0D03938g Chr4 (320521..322578) [2058 bp, 685 aa] {ON} simila...   120   2e-28
Kwal_YGOB_27.12376 s27 complement(1199780..1202056) [2277 bp, 75...   120   2e-28
KAFR0F03780 Chr6 (743830..744903) [1074 bp, 357 aa] {ON} Anc_4.1...   117   2e-28
KNAG0J02320 Chr10 complement(431036..433312) [2277 bp, 758 aa] {...   120   3e-28
TDEL0B03040 Chr2 (541376..543619) [2244 bp, 747 aa] {ON} Anc_8.5...   118   8e-28
NDAI0E02810 Chr5 (595594..597864) [2271 bp, 756 aa] {ON} Anc_8.542    118   9e-28
Kwal_14.1321 s14 (278328..279404) [1077 bp, 358 aa] {ON} YGR028W...   115   9e-28
NCAS0C02100 Chr3 (396101..398377) [2277 bp, 758 aa] {ON} Anc_8.542    118   1e-27
Kpol_1048.61 s1048 (176743..179121) [2379 bp, 792 aa] {ON} (1767...   117   2e-27
SAKL0H10032g Chr8 (858355..860484) [2130 bp, 709 aa] {ON} simila...   117   3e-27
CAGL0H05357g Chr8 complement(514513..516825) [2313 bp, 770 aa] {...   116   4e-27
TBLA0B04610 Chr2 (1068676..1072083) [3408 bp, 1135 aa] {ON} Anc_...   114   2e-26
Kpol_1018.113 s1018 (297316..298503,298553..298561,298604..29955...   114   2e-26
AEL244W Chr5 (178664..180736) [2073 bp, 690 aa] {ON} Syntenic ho...   113   5e-26
TPHA0I01900 Chr9 (427715..429883) [2169 bp, 722 aa] {ON} Anc_8.5...   112   9e-26
KAFR0E00920 Chr5 (196279..198699) [2421 bp, 806 aa] {ON} Anc_8.5...   112   1e-25
Ecym_7036 Chr7 complement(74300..76435) [2136 bp, 711 aa] {ON} s...   112   1e-25
KLLA0E23409g Chr5 complement(2082115..2084106) [1992 bp, 663 aa]...   109   1e-24
KAFR0L00730 Chr12 complement(137874..140522) [2649 bp, 882 aa] {...   108   2e-24
KLTH0E12562g Chr5 complement(1114263..1116410) [2148 bp, 715 aa]...   108   2e-24
Kwal_27.12039 s27 complement(1059119..1061275) [2157 bp, 718 aa]...   108   3e-24
KNAG0A01960 Chr1 (155185..157449) [2265 bp, 754 aa] {ON} Anc_8.5...   107   3e-24
Kwal_27.10646 s27 complement(433603..434793) [1191 bp, 397 aa] {...   105   4e-24
CAGL0J02728g Chr10 complement(269575..272382) [2808 bp, 935 aa] ...   106   1e-23
Kwal_YGOB_27.10642 s27 complement(432707..433537,433540..434793)...   105   1e-23
SAKL0F08008g Chr6 complement(612481..614844) [2364 bp, 787 aa] {...   105   2e-23
Kwal_47.18123 s47 complement(697417..699792) [2376 bp, 791 aa] {...   104   4e-23
Kwal_55.21051 s55 complement(666773..667849) [1077 bp, 358 aa] {...   102   4e-23
KLLA0E04379g Chr5 complement(396027..398216) [2190 bp, 729 aa] {...   104   5e-23
Smik_5.172 Chr5 complement(248542..251214) [2673 bp, 890 aa] {ON...   104   5e-23
KLTH0A03696g Chr1 complement(318721..321066) [2346 bp, 781 aa] {...   103   6e-23
ZYRO0D16346g Chr4 complement(1361550..1364075) [2526 bp, 841 aa]...   103   8e-23
ADL109W Chr4 (491872..494088) [2217 bp, 738 aa] {ON} Syntenic ho...   103   1e-22
Kpol_1070.24 s1070 (55367..58012) [2646 bp, 881 aa] {ON} (55367....   103   1e-22
KNAG0L01320 Chr12 complement(236592..239342) [2751 bp, 916 aa] {...   102   2e-22
YER047C Chr5 complement(243810..246503) [2694 bp, 897 aa] {ON}  ...   102   2e-22
TPHA0C01280 Chr3 (291235..293799) [2565 bp, 854 aa] {ON} Anc_7.2...   100   7e-22
TDEL0H02310 Chr8 (386966..389599) [2634 bp, 877 aa] {ON} Anc_7.2...   100   1e-21
Skud_5.157 Chr5 complement(241636..244311) [2676 bp, 891 aa] {ON...   100   1e-21
TBLA0D04260 Chr4 (1051964..1054561) [2598 bp, 865 aa] {ON} Anc_7...    99   2e-21
NCAS0E01710 Chr5 (334984..337224) [2241 bp, 746 aa] {ON}               99   3e-21
NDAI0G01900 Chr7 (427004..429964) [2961 bp, 986 aa] {ON} Anc_7.2...    99   3e-21
Suva_5.149 Chr5 complement(220370..223057) [2688 bp, 895 aa] {ON...    97   1e-20
Kwal_47.18846 s47 complement(997109..997450) [342 bp, 113 aa] {O...    64   1e-11
ACR200C Chr3 complement(700324..701658) [1335 bp, 444 aa] {ON} S...    60   3e-09
NCAS0H02120 Chr8 complement(412484..413905) [1422 bp, 473 aa] {O...    57   4e-08
Kwal_55.21054 s55 complement(667988..668956) [969 bp, 323 aa] {O...    57   4e-08
KLLA0E02487g Chr5 complement(227048..228388) [1341 bp, 446 aa] {...    56   1e-07
ZYRO0G01716g Chr7 complement(131297..132646) [1350 bp, 449 aa] {...    55   2e-07
TBLA0A02720 Chr1 (660311..661660) [1350 bp, 449 aa] {ON} Anc_5.4...    55   2e-07
TDEL0D02530 Chr4 (488653..490011) [1359 bp, 452 aa] {ON} Anc_5.4...    55   2e-07
Ecym_4643 Chr4 (1254526..1255857) [1332 bp, 443 aa] {ON} similar...    54   3e-07
KLTH0F15730g Chr6 (1282421..1283773) [1353 bp, 450 aa] {ON} high...    54   3e-07
KNAG0B04170 Chr2 (793281..794642) [1362 bp, 453 aa] {ON} Anc_5.4...    53   7e-07
TPHA0E01660 Chr5 (337199..338557) [1359 bp, 452 aa] {ON} Anc_5.4...    53   9e-07
KAFR0D05090 Chr4 complement(1001713..1003098) [1386 bp, 461 aa] ...    53   9e-07
SAKL0G02816g Chr7 complement(231094..232560) [1467 bp, 488 aa] {...    52   1e-06
Kpol_1062.18 s1062 (44220..45560) [1341 bp, 446 aa] {ON} (44220....    52   1e-06
NCAS0C02020 Chr3 (375594..377126,377196..377351) [1689 bp, 562 a...    52   2e-06
CAGL0A02992g Chr1 complement(308689..310062) [1374 bp, 457 aa] {...    52   2e-06
Smik_4.643 Chr4 complement(1145612..1147033) [1422 bp, 473 aa] {...    52   2e-06
Suva_2.548 Chr2 complement(975787..977157) [1371 bp, 456 aa] {ON...    52   2e-06
Skud_4.645 Chr4 complement(1148035..1149405) [1371 bp, 456 aa] {...    52   2e-06
YDR375C Chr4 complement(1225166..1226536) [1371 bp, 456 aa] {ON}...    52   2e-06
NDAI0C01530 Chr3 (325097..326557) [1461 bp, 486 aa] {ON} Anc_5.4...    52   3e-06
Kwal_55.21381 s55 (809652..811004) [1353 bp, 450 aa] {ON} YDR375...    51   3e-06
KLTH0E12936g Chr5 complement(1145066..1146700) [1635 bp, 544 aa]...    49   2e-05
Kwal_27.12113 s27 complement(1090541..1092061) [1521 bp, 506 aa]...    48   3e-05
KLTH0B08052g Chr2 complement(652928..654538) [1611 bp, 536 aa] {...    46   1e-04
SAKL0H09658g Chr8 (828107..829639) [1533 bp, 510 aa] {OFF} simil...    46   1e-04
Sklu_YGOB_09658g Chr8 (828107..829591,829654..829791) [1623 bp, ...    46   1e-04
KLLA0E23783g Chr5 complement(2115721..2115885,2115988..2117484) ...    46   2e-04
KAFR0E00840 Chr5 (176559..178121,178220..178348) [1692 bp, 563 a...    44   5e-04
KNAG0A01880 Chr1 (135396..137078) [1683 bp, 560 aa] {ON} Anc_8.5...    44   9e-04
Ecym_7051 Chr7 complement(103898..104056,104172..105644) [1632 b...    43   0.001
AEL258W Chr5 (152451..153911,153967..154086) [1581 bp, 526 aa] {...    43   0.001
CAGL0M06435g Chr13 (668126..669691) [1566 bp, 521 aa] {OFF} simi...    42   0.003
Cgla_YGOB_M06435 Chr13 (668126..669628,669749..669895) [1650 bp,...    42   0.003
Suva_4.437 Chr4 (770299..771957) [1659 bp, 552 aa] {ON} YBR186W ...    41   0.005
KNAG0F00930 Chr6 (170493..172262) [1770 bp, 589 aa] {ON} Anc_2.2...    41   0.006
NDAI0E02730 Chr5 (573056..574554,574636..574771) [1635 bp, 544 a...    41   0.007
Kwal_23.4480 s23 (737809..739470) [1662 bp, 553 aa] {ON} YNL218W...    40   0.007
Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa...    40   0.007
ABL183W Chr2 (63196..64839) [1644 bp, 547 aa] {ON} Syntenic homo...    40   0.008
Skud_2.312 Chr2 (567925..569382,569566..569712) [1605 bp, 534 aa...    40   0.008
TDEL0B02870 Chr2 (512594..514168,514238..514384) [1722 bp, 573 a...    40   0.012
ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]...    40   0.012
Zrou_YGOB_A13310g Chr1 complement(1049931..1050068,1050140..1051...    40   0.015
TBLA0H03710 Chr8 complement(902121..903824) [1704 bp, 567 aa] {O...    39   0.023
SAKL0E13926g Chr5 complement(1147571..1149223) [1653 bp, 550 aa]...    37   0.079
YBR186W Chr2 (600553..602103,602217..602360) [1695 bp, 564 aa] {...    37   0.10 
CAGL0K04983g Chr11 complement(483181..484860) [1680 bp, 559 aa] ...    37   0.12 
TPHA0I01820 Chr9 (404763..406295,406384..406530) [1680 bp, 559 a...    37   0.15 
NCAS0G01450 Chr7 (262021..263730) [1710 bp, 569 aa] {ON} Anc_2.2...    36   0.17 
TPHA0P01680 Chr16 complement(350606..352414) [1809 bp, 602 aa] {...    36   0.18 
Ecym_6466 Chr6 complement(901576..903330) [1755 bp, 584 aa] {ON}...    36   0.18 
Smik_2.369 Chr2 complement(659801..661306) [1506 bp, 501 aa] {ON...    36   0.20 
TPHA0J01840 Chr10 complement(422152..423738) [1587 bp, 528 aa] {...    36   0.20 
Skud_2.358 Chr2 complement(642328..643905) [1578 bp, 525 aa] {ON...    36   0.21 
CAGL0K06919g Chr11 complement(675277..676926) [1650 bp, 549 aa] ...    36   0.22 
KLLA0D19360g Chr4 complement(1629360..1631039) [1680 bp, 559 aa]...    36   0.23 
YBR227C Chr2 complement(673572..675134) [1563 bp, 520 aa] {ON}  ...    36   0.24 
Kpol_1014.42 s1014 complement(81164..82876) [1713 bp, 570 aa] {O...    35   0.30 
KAFR0A07880 Chr1 complement(1577607..1579292) [1686 bp, 561 aa] ...    35   0.32 
TBLA0G00290 Chr7 (53122..55110) [1989 bp, 662 aa] {ON} Anc_2.26 ...    35   0.38 
NDAI0F01880 Chr6 complement(456673..458262) [1590 bp, 529 aa] {O...    35   0.44 
Suva_4.482 Chr4 complement(843869..845419) [1551 bp, 516 aa] {ON...    35   0.55 
TDEL0G03460 Chr7 (638931..640466) [1536 bp, 511 aa] {ON} Anc_6.1...    35   0.58 
ACR102W Chr3 (535740..538262) [2523 bp, 840 aa] {ON} Syntenic ho...    35   0.58 
CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 ...    35   0.62 
AEL196W Chr5 (264744..265745) [1002 bp, 333 aa] {ON} Syntenic ho...    34   0.63 
TDEL0A00690 Chr1 (116066..117724) [1659 bp, 552 aa] {ON} Anc_2.2...    34   0.64 
NCAS0H01380 Chr8 (263394..264977) [1584 bp, 527 aa] {ON} Anc_6.1...    34   0.69 
KLLA0B01892g Chr2 (162844..165855) [3012 bp, 1003 aa] {ON} weakl...    34   0.82 
NDAI0F03710 Chr6 complement(882364..884193) [1830 bp, 609 aa] {O...    34   0.95 
ZYRO0F15136g Chr6 complement(1238898..1240598) [1701 bp, 566 aa]...    33   1.1  
YMR078C Chr13 complement(422503..424728) [2226 bp, 741 aa] {ON} ...    33   1.3  
ZYRO0B11880g Chr2 (950091..951908) [1818 bp, 605 aa] {ON} simila...    33   1.3  
KAFR0A01930 Chr1 complement(401199..403541) [2343 bp, 780 aa] {O...    33   1.4  
ZYRO0F06446g Chr6 (533651..536176) [2526 bp, 841 aa] {ON} simila...    33   1.6  
Suva_14.124 Chr14 (232456..234216) [1761 bp, 586 aa] {ON} YNL218...    33   1.6  
TDEL0E05510 Chr5 complement(1010410..1013400) [2991 bp, 996 aa] ...    33   1.6  
KAFR0G02200 Chr7 (458391..459896) [1506 bp, 501 aa] {ON} Anc_6.1...    33   1.7  
Kwal_14.1761 s14 (457092..458609) [1518 bp, 505 aa] {ON} YBR227C...    33   1.7  
ZYRO0C04884g Chr3 (383579..385573) [1995 bp, 664 aa] {ON} simila...    33   1.8  
AFL121W Chr6 (209373..211949) [2577 bp, 858 aa] {ON} Non-synteni...    33   1.8  
Ecym_8322 Chr8 (654654..657074) [2421 bp, 806 aa] {ON} similar t...    33   1.8  
ZYRO0E07458g Chr5 complement(572497..575538) [3042 bp, 1013 aa] ...    33   1.9  
YNL218W Chr14 (238238..240001) [1764 bp, 587 aa] {ON}  MGS1Prote...    33   1.9  
Kpol_1048.53 s1048 (151366..153024) [1659 bp, 552 aa] {ON} (1513...    33   1.9  
TPHA0F03230 Chr6 (704126..706663) [2538 bp, 845 aa] {ON} Anc_8.6...    33   2.0  
KLTH0H06380g Chr8 (559500..561026) [1527 bp, 508 aa] {ON} simila...    33   2.0  
KLLA0F09691g Chr6 complement(892208..893725) [1518 bp, 505 aa] {...    33   2.0  
SAKL0E02486g Chr5 complement(196218..198395) [2178 bp, 725 aa] {...    33   2.1  
KAFR0A08290 Chr1 complement(1662119..1663117) [999 bp, 332 aa] {...    32   2.2  
Kwal_56.24172 s56 complement(887183..890167) [2985 bp, 994 aa] {...    33   2.3  
Skud_14.118 Chr14 (226974..228740) [1767 bp, 588 aa] {ON} YNL218...    33   2.3  
Ecym_2429 Chr2 (833794..836133) [2340 bp, 779 aa] {ON} similar t...    33   2.5  
Ecym_2174 Chr2 (338477..341560) [3084 bp, 1027 aa] {ON} similar ...    33   2.6  
Kwal_47.18662 s47 complement(919990..921402) [1413 bp, 470 aa] {...    32   2.7  
Smik_14.114 Chr14 (217529..219280) [1752 bp, 583 aa] {ON} YNL218...    32   2.8  
AFR013C Chr6 complement(458057..461230) [3174 bp, 1057 aa] {ON} ...    32   3.5  
ZYRO0E01826g Chr5 (134806..136320) [1515 bp, 504 aa] {ON} simila...    32   3.5  
ZYRO0G03806g Chr7 (304402..306522) [2121 bp, 706 aa] {ON} simila...    32   3.5  
Kpol_223.4 s223 (4546..6036) [1491 bp, 496 aa] {ON} (4546..6036)...    32   3.6  
Skud_13.235 Chr13 complement(396755..398980) [2226 bp, 741 aa] {...    32   3.7  
SAKL0A03806g Chr1 (353414..356539) [3126 bp, 1041 aa] {ON} weakl...    32   3.8  
NCAS0F00820 Chr6 complement(166312..168531) [2220 bp, 739 aa] {O...    32   4.0  
Kpol_363.12 s363 complement(18968..20512) [1545 bp, 514 aa] {ON}...    32   4.1  
SAKL0C12144g Chr3 complement(1088849..1089838) [990 bp, 329 aa] ...    32   4.3  
KLTH0H03542g Chr8 (320024..322993) [2970 bp, 989 aa] {ON} weakly...    32   4.4  
KLLA0F19888g Chr6 complement(1839682..1854429) [14748 bp, 4915 a...    32   6.1  
YPL235W Chr16 (103232..104647) [1416 bp, 471 aa] {ON}  RVB2ATP-d...    31   6.3  
Suva_16.71 Chr16 (112264..113682) [1419 bp, 472 aa] {ON} YPL235W...    31   6.4  
Smik_6.440 Chr6 complement(719661..721076) [1416 bp, 471 aa] {ON...    31   6.6  
TBLA0A02230 Chr1 complement(537595..539022) [1428 bp, 475 aa] {O...    31   6.9  
Ecym_2154 Chr2 (289010..290413) [1404 bp, 467 aa] {ON} similar t...    31   7.1  
Skud_16.43 Chr16 (76826..78241) [1416 bp, 471 aa] {ON} YPL235W (...    31   7.1  
ZYRO0E07282g Chr5 (555489..559088) [3600 bp, 1199 aa] {ON} simil...    31   8.1  
KAFR0F01270 Chr6 (243255..246236) [2982 bp, 993 aa] {ON}               31   8.8  
KAFR0H01930 Chr8 (360162..361544) [1383 bp, 460 aa] {ON} Anc_8.3...    31   9.3  

>TPHA0B02550 Chr2 (583789..585180) [1392 bp, 463 aa] {ON} Anc_5.251
           YKL145W
          Length = 463

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/463 (90%), Positives = 417/463 (90%)

Query: 1   MAPKEDWEKYKAPVEGKDSKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVIE 60
           MAPKEDWEKYKAPVEGKDSKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVIE
Sbjct: 1   MAPKEDWEKYKAPVEGKDSKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVIE 60

Query: 61  GKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXXXXXXXXXXXX 120
           GKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKK            
Sbjct: 61  GKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKSSENGDESNSES 120

Query: 121 XXXXXXXXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIE 180
                              KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIE
Sbjct: 121 TEGNGTANTNTAADDNEEAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIE 180

Query: 181 LPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPK 240
           LPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPK
Sbjct: 181 LPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPK 240

Query: 241 GILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKAC 300
           GILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKAC
Sbjct: 241 GILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKAC 300

Query: 301 IIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPA 360
           IIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPA
Sbjct: 301 IIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPA 360

Query: 361 LLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCT 420
           LLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCT
Sbjct: 361 LLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCT 420

Query: 421 EAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           EAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN
Sbjct: 421 EAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463

>Kpol_1032.87 s1032 complement(185143..186537) [1395 bp, 464 aa]
           {ON} complement(185143..186537) [1395 nt, 465 aa]
          Length = 464

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/465 (84%), Positives = 409/465 (87%), Gaps = 3/465 (0%)

Query: 1   MAPKEDWEKYKAPVEGKDSK--PNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKV 58
           M PKEDWEKYKAP+EGK+++    ++KI PL+E DIQVLK+YGAAPY SK+KETEKDLK 
Sbjct: 1   MPPKEDWEKYKAPLEGKENEDVSKDEKITPLTESDIQVLKTYGAAPYASKLKETEKDLKD 60

Query: 59  IEGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXXXXXXXXXX 118
           IE +IKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKK          
Sbjct: 61  IELRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKSSSTEGENDN 120

Query: 119 XXXXXXXXXXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYH 178
                                KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYH
Sbjct: 121 GNGENGESASANDADDDEEA-KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYH 179

Query: 179 IELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDP 238
           IELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK+QIEKLREVVELPLLSPERFATLGIDP
Sbjct: 180 IELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKEQIEKLREVVELPLLSPERFATLGIDP 239

Query: 239 PKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKK 298
           PKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKK
Sbjct: 240 PKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKK 299

Query: 299 ACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLD 358
           ACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLD
Sbjct: 300 ACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLD 359

Query: 359 PALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSV 418
           PALLRPGRIDRKVEFSLPDLEGRANIFRIHTK+MSVERGIRWELISRLCPNSTGAELRSV
Sbjct: 360 PALLRPGRIDRKVEFSLPDLEGRANIFRIHTKAMSVERGIRWELISRLCPNSTGAELRSV 419

Query: 419 CTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           CTEAGMFAIRARRKVATEKDFLKAVDKVI+GYKKFSSTSRYMQYN
Sbjct: 420 CTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 464

>TDEL0E03750 Chr5 (709088..710503) [1416 bp, 471 aa] {ON} Anc_5.251
           YKL145W
          Length = 471

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/471 (82%), Positives = 402/471 (85%), Gaps = 8/471 (1%)

Query: 1   MAPKEDWEKYKAPVEGKDSKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVIE 60
           M PKEDWEKYKAP E    K N++K  PL+EGDIQVLK+YGAAPY  K+KETEKDLK IE
Sbjct: 1   MPPKEDWEKYKAPAEEDKEKSNDEKNTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDIE 60

Query: 61  GKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXXXXXXXXXXXX 120
            +IKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKII+             
Sbjct: 61  NRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDGL 120

Query: 121 XXXXXXXXXXXXXX--------XXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 172
                                      KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV
Sbjct: 121 DTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 180

Query: 173 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFA 232
           DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QIEKLREVVELPLLSPERFA
Sbjct: 181 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFA 240

Query: 233 TLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 292
            LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE
Sbjct: 241 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 300

Query: 293 MARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATN 352
           MARTKKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATN
Sbjct: 301 MARTKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATN 360

Query: 353 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 412
           RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG
Sbjct: 361 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 420

Query: 413 AELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           AELRSVCTEAGMFAIRARRKVATEKDFLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 421 AELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471

>CAGL0E06490g Chr5 (649826..651244) [1419 bp, 472 aa] {ON} highly
           similar to uniprot|P33299 Saccharomyces cerevisiae
           YKL145w YTA3
          Length = 472

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/472 (83%), Positives = 404/472 (85%), Gaps = 9/472 (1%)

Query: 1   MAPKEDWEKYKAPVEGKDSKPNEDKI-IPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVI 59
           MAPKEDWEKYKAPVE  D    +D   IPL+EGDIQVLK+YGAAPY +K+KETEKDLK I
Sbjct: 1   MAPKEDWEKYKAPVESDDDNKLKDDKSIPLTEGDIQVLKTYGAAPYAAKLKETEKDLKEI 60

Query: 60  EGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXXXXXXXXXXX 119
           E +IKEK+G+KESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK            
Sbjct: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSSASNEVSDESA 120

Query: 120 XXXXXXXXXXXXXX--------XXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 171
                                       KYVINLKQIAKFVVGLGERVSPTDIEEGMRVG
Sbjct: 121 VNGANTTNSATTGSGNDGDAEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 180

Query: 172 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERF 231
           VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QIEKLREVVELPLLSPERF
Sbjct: 181 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 240

Query: 232 ATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 291
           ATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF
Sbjct: 241 ATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 300

Query: 292 EMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 351
           EMARTKKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFAT
Sbjct: 301 EMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFAT 360

Query: 352 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST 411
           NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISRLCPNST
Sbjct: 361 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERNIRWELISRLCPNST 420

Query: 412 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           GAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVI+GYKKFSSTSRYMQYN
Sbjct: 421 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 472

>Skud_11.82 Chr11 (160364..161770) [1407 bp, 468 aa] {ON} YKL145W
           (REAL)
          Length = 468

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/468 (84%), Positives = 407/468 (86%), Gaps = 5/468 (1%)

Query: 1   MAPKEDWEKYKAPVEGKDSKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVIE 60
           M PKEDWEKYKAP++  D KP++DKI+PL+EGDIQVLKSYGAAPY +K+K+TE DLK IE
Sbjct: 1   MPPKEDWEKYKAPLDDDDKKPDDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIE 60

Query: 61  GKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKX-----XXXXXX 115
            +IKEKAGVKESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK             
Sbjct: 61  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGSGENDDSTTDNN 120

Query: 116 XXXXXXXXXXXXXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 175
                                   KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 121 NDSVNGNSNSNQESADVDEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180

Query: 176 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLG 235
           KY+IELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCKDQIEKLREVVELPLLSPERFATLG
Sbjct: 181 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 240

Query: 236 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 295
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300

Query: 296 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 355
           TKKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 301 TKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360

Query: 356 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAEL 415
           TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420

Query: 416 RSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           RSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN
Sbjct: 421 RSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 468

>YKL145W Chr11 (174213..175616) [1404 bp, 467 aa] {ON}  RPT1One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; required for optimal CDC20 transcription;
           interacts with Rpn12p and Ubr1p; mutant has aneuploidy
           tolerance
          Length = 467

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/467 (84%), Positives = 407/467 (87%), Gaps = 4/467 (0%)

Query: 1   MAPKEDWEKYKAPVEGKDSKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVIE 60
           M PKEDWEKYKAP+E  D KP++DKI+PL+EGDIQVLKSYGAAPY +K+K+TE DLK IE
Sbjct: 1   MPPKEDWEKYKAPLEDDDKKPDDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIE 60

Query: 61  GKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK----KXXXXXXXX 116
            +IKEKAGVKESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK             
Sbjct: 61  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTDNN 120

Query: 117 XXXXXXXXXXXXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK 176
                                  KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK
Sbjct: 121 NSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK 180

Query: 177 YHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGI 236
           Y+IELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCKDQIEKLREVVELPLLSPERFATLGI
Sbjct: 181 YNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGI 240

Query: 237 DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART 296
           DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART
Sbjct: 241 DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART 300

Query: 297 KKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT 356
           KKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT
Sbjct: 301 KKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT 360

Query: 357 LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELR 416
           LDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAELR
Sbjct: 361 LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELR 420

Query: 417 SVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           SVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN
Sbjct: 421 SVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 467

>NCAS0F02300 Chr6 complement(456422..457846) [1425 bp, 474 aa] {ON}
           Anc_5.251
          Length = 474

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/474 (82%), Positives = 406/474 (85%), Gaps = 11/474 (2%)

Query: 1   MAPKEDWEKYKAPVEGKDSK--PNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKV 58
           M PKEDWEKYKAPV+ +D K    EDKI+PLSEGDIQVLK+YGAAPY +K+KE EKDLK 
Sbjct: 1   MPPKEDWEKYKAPVDAEDEKEKAKEDKIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60

Query: 59  IEGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXXXXXXXXXX 118
           IE KIKEK+GV+ESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK           
Sbjct: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSNGNEEEQEGE 120

Query: 119 XXXXXXXXX---------XXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMR 169
                                         KYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 121 GESAASATSTTNNASTTGSGENGEDEDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180

Query: 170 VGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPE 229
           VGVDRSKY+IELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCKDQIEKLREVVELPLLSPE
Sbjct: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240

Query: 230 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 289
           RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300

Query: 290 LFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 349
           LFEMARTKKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 301 LFEMARTKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 360

Query: 350 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPN 409
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISRLCPN
Sbjct: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420

Query: 410 STGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           +TGAELRSVCTEAGMFAIRARRKVA+EKDFLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474

>Smik_11.91 Chr11 (160113..161519) [1407 bp, 468 aa] {ON} YKL145W
           (REAL)
          Length = 468

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/468 (84%), Positives = 407/468 (86%), Gaps = 5/468 (1%)

Query: 1   MAPKEDWEKYKAPVEGKDSKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVIE 60
           M PKEDWEKYKAP+E  D KPN+DKI+PL+EGDIQVLKSYGAAPY +K+K+TE DLK IE
Sbjct: 1   MPPKEDWEKYKAPLEDDDKKPNDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTESDLKDIE 60

Query: 61  GKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXX-----XXXXX 115
            +IKEKAGVKESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK             
Sbjct: 61  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGENDDPTTDNN 120

Query: 116 XXXXXXXXXXXXXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 175
                                   KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 121 SNSGNENSNSNQQSADADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180

Query: 176 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLG 235
           KY+IELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCKDQIEKLREVVELPLLSPERFATLG
Sbjct: 181 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 240

Query: 236 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 295
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300

Query: 296 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 355
           TKKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 301 TKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360

Query: 356 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAEL 415
           TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420

Query: 416 RSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           RSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN
Sbjct: 421 RSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 468

>ACR050C Chr3 complement(447221..448648) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL145W
           (RPT1)
          Length = 475

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/464 (83%), Positives = 403/464 (86%), Gaps = 12/464 (2%)

Query: 1   MAPKEDWEKYKAPVEGKDSKPNED-KIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVI 59
           M PKEDWEKYKAPVE ++ +   D KI PLSEGDIQVLK+YGAAPY +K+K TEKDLK I
Sbjct: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82

Query: 60  EGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXXXXXXXXXXX 119
           E +IKEKAGVKESDTGLAPSHLWDIMGDRQ+LSE HPLQVARCTKII+            
Sbjct: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASRSGA 142

Query: 120 XXXXXXXXXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHI 179
                               KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKY I
Sbjct: 143 NTGEDDEDA-----------KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFI 191

Query: 180 ELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPP 239
           ELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QIEKLREVVELPLLSPERFATLGIDPP
Sbjct: 192 ELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPP 251

Query: 240 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA 299
           KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA
Sbjct: 252 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA 311

Query: 300 CIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP 359
           CIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP
Sbjct: 312 CIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP 371

Query: 360 ALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVC 419
           ALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVC
Sbjct: 372 ALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVC 431

Query: 420 TEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           TEAGMFAIR+RRKVATEKDFLKAVDKVI+GYKKFSSTSRYMQYN
Sbjct: 432 TEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475

>Ecym_8250 Chr8 (512209..513579) [1371 bp, 456 aa] {ON} similar to
           Ashbya gossypii ACR050C
          Length = 456

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/464 (83%), Positives = 403/464 (86%), Gaps = 9/464 (1%)

Query: 1   MAPKEDWEKYKAPVEGKD-SKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVI 59
           M+PKEDWEKYK PVE +D  K  +DKI PL+EGDIQVLK+YGAAPY +K+K TEKDLK I
Sbjct: 1   MSPKEDWEKYKPPVETEDEQKQADDKIKPLTEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 60

Query: 60  EGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXXXXXXXXXXX 119
           E +IKEKAGVKESDTGLAPSHLWDI+GDRQ+LSE HPLQVARCTKIIK            
Sbjct: 61  EQRIKEKAGVKESDTGLAPSHLWDILGDRQKLSERHPLQVARCTKIIKSEPSRDSAGGSS 120

Query: 120 XXXXXXXXXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHI 179
                               KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKY I
Sbjct: 121 SATTVGDDDEDA--------KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFI 172

Query: 180 ELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPP 239
           ELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QIEKLREVVELPLLSPERFA LGIDPP
Sbjct: 173 ELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPP 232

Query: 240 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA 299
           KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA
Sbjct: 233 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA 292

Query: 300 CIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP 359
           CIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP
Sbjct: 293 CIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP 352

Query: 360 ALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVC 419
           ALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVC
Sbjct: 353 ALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVC 412

Query: 420 TEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           TEAGMFAIR+RRKVATEKDFLKAVDKVI+GYKKFSSTSRYMQYN
Sbjct: 413 TEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 456

>TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.251
           YKL145W
          Length = 468

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/469 (82%), Positives = 401/469 (85%), Gaps = 7/469 (1%)

Query: 1   MAPKEDWEKYKAPVEGKDSKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVIE 60
           MAPKEDW+KYKAP+E  D    ++KI PLSEGDIQVLK+YGAAP   K+K+TEKDLK I 
Sbjct: 1   MAPKEDWDKYKAPIE-DDKTTVDEKITPLSEGDIQVLKTYGAAPCAGKLKQTEKDLKEIR 59

Query: 61  GKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXXXXXXXXXXXX 120
            +IKEK GVKESDTGLAPSHLWDIMGDRQRLS EHPLQVARCTKIIK             
Sbjct: 60  KRIKEKGGVKESDTGLAPSHLWDIMGDRQRLSSEHPLQVARCTKIIKANSDLENSNSMDN 119

Query: 121 XXXXXX------XXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR 174
                                    KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR
Sbjct: 120 NSTNNTPLDDTNHNNNIDEDNDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR 179

Query: 175 SKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATL 234
           SKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATL
Sbjct: 180 SKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATL 239

Query: 235 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 294
           GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA
Sbjct: 240 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 299

Query: 295 RTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 354
           RTKKACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRP
Sbjct: 300 RTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 359

Query: 355 NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAE 414
           NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAE
Sbjct: 360 NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAE 419

Query: 415 LRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           LRSVCTEAGMFAIRARRKVA+EKDFL+AV+KVI+GYKKFSSTSRYMQYN
Sbjct: 420 LRSVCTEAGMFAIRARRKVASEKDFLQAVEKVINGYKKFSSTSRYMQYN 468

>SAKL0G11484g Chr7 (982362..982478,982604..983857) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 456

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/463 (83%), Positives = 406/463 (87%), Gaps = 7/463 (1%)

Query: 1   MAPKEDWEKYKAPVEGKDSKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVIE 60
           M PKE+WEKY AP+E ++++  + K++PLSEGDIQVLK+YGAAPY +K+KE EKDLK IE
Sbjct: 1   MPPKENWEKYTAPIEEEETEEEK-KVVPLSEGDIQVLKTYGAAPYANKLKEIEKDLKDIE 59

Query: 61  GKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXXXXXXXXXXXX 120
            +IKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK             
Sbjct: 60  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK------GDSSSSS 113

Query: 121 XXXXXXXXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIE 180
                              KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIE
Sbjct: 114 PEDTQSNSSPNSEEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIE 173

Query: 181 LPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPK 240
           LPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QI+KLREVVELPLLSPERFATLGIDPPK
Sbjct: 174 LPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFATLGIDPPK 233

Query: 241 GILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKAC 300
           GILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKAC
Sbjct: 234 GILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKAC 293

Query: 301 IIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPA 360
           IIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPA
Sbjct: 294 IIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPA 353

Query: 361 LLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCT 420
           LLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCT
Sbjct: 354 LLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCT 413

Query: 421 EAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           EAGMFAIRARRKVATEKDFLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 414 EAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 456

>ZYRO0A10560g Chr1 (854410..855816) [1407 bp, 468 aa] {ON} highly
           similar to uniprot|P33299 Saccharomyces cerevisiae
           YKL145W RPT1 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 468

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/468 (82%), Positives = 403/468 (86%), Gaps = 5/468 (1%)

Query: 1   MAPKEDWEKYKAPVEGKDSKPNED-KIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVI 59
           M P+EDWEKYKAP+EG   +  ED K  PLSEGDIQVLK+YGAAPY +K+KETEKDLK I
Sbjct: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60

Query: 60  EGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXXXXXXXXX-- 117
           E +IKEK+G+KESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK            
Sbjct: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL 120

Query: 118 --XXXXXXXXXXXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 175
                                   KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 121 DGAAGPGATSENRDADDAEEDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180

Query: 176 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLG 235
           KYHIELPLPPRIDPSVTMMTVEEKPDVTY+DVGG KDQIEKLREVVELPLLSPERFA LG
Sbjct: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240

Query: 236 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 295
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300

Query: 296 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 355
           +KKACI+FFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 301 SKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360

Query: 356 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAEL 415
           TLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIH+KSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420

Query: 416 RSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           RSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSSTSRYMQYN
Sbjct: 421 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468

>KLTH0G07524g Chr7 (610689..610802,611037..612260) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 445

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/465 (83%), Positives = 403/465 (86%), Gaps = 22/465 (4%)

Query: 1   MAPKEDWEKYKAPVE--GKDSKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKV 58
           M PKEDWEK+KAP E   ++ KPN    +PL+EGDIQVLK+YGAAPY  K+KETEKDLK 
Sbjct: 1   MPPKEDWEKFKAPAEEEKQEEKPN----VPLTEGDIQVLKTYGAAPYADKLKETEKDLKD 56

Query: 59  IEGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXXXXXXXXXX 118
           IE +IKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK           
Sbjct: 57  IEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKPEASDESPADE 116

Query: 119 XXXXXXXXXXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYH 178
                                KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYH
Sbjct: 117 DEEDS----------------KYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYH 160

Query: 179 IELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDP 238
           IELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QI+KLREVVELPLLSPERFA LGIDP
Sbjct: 161 IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDP 220

Query: 239 PKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKK 298
           PKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART+K
Sbjct: 221 PKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRK 280

Query: 299 ACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLD 358
           ACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLD
Sbjct: 281 ACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLD 340

Query: 359 PALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSV 418
           PALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAELRSV
Sbjct: 341 PALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSV 400

Query: 419 CTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           CTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSSTSRYMQYN
Sbjct: 401 CTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445

>Suva_11.80 Chr11 (160287..161702) [1416 bp, 471 aa] {ON} YKL145W
           (REAL)
          Length = 471

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/471 (83%), Positives = 404/471 (85%), Gaps = 8/471 (1%)

Query: 1   MAPKEDWEKYKAPVEGKDSKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVIE 60
           M PKE+WEKYKAP+E  D K +EDKI+PL+EGDIQVLKSYGAAPY +K+K+TE DLK IE
Sbjct: 1   MPPKENWEKYKAPLEDDDKKSDEDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIE 60

Query: 61  GKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIK--------KXXXX 112
            +IKEKAGVKESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK             
Sbjct: 61  ARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGENDDSTTNNN 120

Query: 113 XXXXXXXXXXXXXXXXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 172
                                      KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV
Sbjct: 121 NDINSSNNNNSNSNQESADADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGV 180

Query: 173 DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFA 232
           DRSKY+IELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCKDQIEKLREVVELPLLSPERFA
Sbjct: 181 DRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFA 240

Query: 233 TLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 292
            LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE
Sbjct: 241 ALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFE 300

Query: 293 MARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATN 352
           MARTKKACIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATN
Sbjct: 301 MARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATN 360

Query: 353 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTG 412
           RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISRLCPNSTG
Sbjct: 361 RPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNSTG 420

Query: 413 AELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           AELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN
Sbjct: 421 AELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 471

>KAFR0H03630 Chr8 (691036..692382) [1347 bp, 448 aa] {ON} Anc_5.251
           YKL145W
          Length = 448

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/464 (82%), Positives = 403/464 (86%), Gaps = 17/464 (3%)

Query: 1   MAPKEDWEKYKAPVEGKDSKPNED-KIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVI 59
           M PK+DWEKYK P++ + SK  ++ +I PL+EGDIQVLK+YGAAPY  K+K TE+DLK I
Sbjct: 1   MPPKQDWEKYKTPIDEESSKEKKEEQIAPLTEGDIQVLKTYGAAPYADKLKVTEEDLKKI 60

Query: 60  EGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXXXXXXXXXXX 119
           E +IKEKAGVKESDTGLAPSH+WD+MGDRQRLSEEHPLQVARCTKIIK            
Sbjct: 61  EARIKEKAGVKESDTGLAPSHMWDVMGDRQRLSEEHPLQVARCTKIIKSSSEEGAEGNED 120

Query: 120 XXXXXXXXXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHI 179
                               KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHI
Sbjct: 121 EDDA----------------KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHI 164

Query: 180 ELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPP 239
           ELPLPPRIDP+VTMMTVEEKPDVTY+DVGGCK+QIEKLREVVELPLLSPERFATLGIDPP
Sbjct: 165 ELPLPPRIDPTVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPP 224

Query: 240 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA 299
           KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA
Sbjct: 225 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA 284

Query: 300 CIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP 359
           CIIFFDEI               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP
Sbjct: 285 CIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP 344

Query: 360 ALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVC 419
           ALLRPGRIDRKVEFSLPDLEGRANIFRIH+K+MSVER IRWELISRLCPNSTGAELRSVC
Sbjct: 345 ALLRPGRIDRKVEFSLPDLEGRANIFRIHSKAMSVERNIRWELISRLCPNSTGAELRSVC 404

Query: 420 TEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           TEAGMFAIRARRKVATEKDFLKAVDKVI+GYKKFSSTSRYMQYN
Sbjct: 405 TEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 448

>KNAG0H02300 Chr8 (417868..419301) [1434 bp, 477 aa] {ON} Anc_5.251
           YKL145W
          Length = 477

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/478 (80%), Positives = 398/478 (83%), Gaps = 16/478 (3%)

Query: 1   MAPKEDWEKYKAPVEGKD---SKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLK 57
           M PKEDWEK K  VE  +   +K  ED + PL+E DIQVLK+YG APY  K+KETE DLK
Sbjct: 1   MPPKEDWEKQKPAVENAEDDAAKKGED-VAPLTEDDIQVLKTYGVAPYAVKLKETENDLK 59

Query: 58  VIEGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXXXXXXXXX 117
            IE +IKEKAGV+ESDTGLAPSHLWDIMGDRQRL EEHPLQVARCTKIIK          
Sbjct: 60  EIEARIKEKAGVRESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKSGEGDGNGSG 119

Query: 118 XXXXXXXXXXXXXXXXXXXXX------------XKYVINLKQIAKFVVGLGERVSPTDIE 165
                                             KYVINLKQIAKFVVGLGERVSPTDIE
Sbjct: 120 NNSNGAAADGAGAAAAAGENAAQAAGADDDEDDSKYVINLKQIAKFVVGLGERVSPTDIE 179

Query: 166 EGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPL 225
           EGMRVGVDRSKYHIELPLPPRIDP+VTMMTVEEKPDVTY+DVGGCKDQIEKLREVVELPL
Sbjct: 180 EGMRVGVDRSKYHIELPLPPRIDPTVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPL 239

Query: 226 LSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGAR 285
           LSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGAR
Sbjct: 240 LSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGAR 299

Query: 286 MVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNI 345
           MVRELFEMARTK+ACIIFFDEI               NEVQRTMLELITQLDGFDPRGNI
Sbjct: 300 MVRELFEMARTKRACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNI 359

Query: 346 KVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISR 405
           KVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISR
Sbjct: 360 KVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISR 419

Query: 406 LCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           LCPN+TGAELRSVCTEAGMFAIRARRKVA+EKDFLKAVDKVI+GYKKFSSTSRYMQYN
Sbjct: 420 LCPNATGAELRSVCTEAGMFAIRARRKVASEKDFLKAVDKVINGYKKFSSTSRYMQYN 477

>KLLA0E13773g Chr5 complement(1215253..1216680) [1428 bp, 475 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 475

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/476 (80%), Positives = 398/476 (83%), Gaps = 14/476 (2%)

Query: 1   MAPKEDWEKYKAPVEGKDSKPNEDKIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVIE 60
           M PKEDWEKYKAP+E  +    E K++PLSEGDI+VLK+YGAAPY  K+K  E DLK IE
Sbjct: 1   MPPKEDWEKYKAPIE-DEESKEEKKVVPLSEGDIEVLKTYGAAPYAKKLKSIENDLKEIE 59

Query: 61  GKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKXXXXXXXXX--- 117
            KIKEKAGVKESDTGLAPSHLWDI+GDRQRLSEE PLQVARCTKIIK             
Sbjct: 60  KKIKEKAGVKESDTGLAPSHLWDIVGDRQRLSEEQPLQVARCTKIIKAEKPQRSGNALGG 119

Query: 118 ----------XXXXXXXXXXXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVSPTDIEEG 167
                                           KYVINLKQIAKFVVGLGERVSPTDIEEG
Sbjct: 120 DADGNGVAAAAAAAAAAAAAASGTEDEDDDDAKYVINLKQIAKFVVGLGERVSPTDIEEG 179

Query: 168 MRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLS 227
           MRVGVDRSKY IELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QIEKLREVVELPLLS
Sbjct: 180 MRVGVDRSKYQIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLS 239

Query: 228 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 287
           PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV
Sbjct: 240 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 299

Query: 288 RELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 347
           RELFEMARTKKACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKV
Sbjct: 300 RELFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKV 359

Query: 348 MFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLC 407
           MFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLC
Sbjct: 360 MFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLC 419

Query: 408 PNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463
           PNSTGAELRSVCTEAGMFAIRARRKV TEKDFLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 420 PNSTGAELRSVCTEAGMFAIRARRKVTTEKDFLKAVEKVINGYKKFSSTSRYMQYN 475

>Kwal_23.2849 s23 (40940..42169) [1230 bp, 409 aa] {ON} YKL145W
           (RPT1) - putative ATPase, 26S protease subunit component
           [contig 246] FULL
          Length = 409

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/423 (84%), Positives = 369/423 (87%), Gaps = 16/423 (3%)

Query: 41  GAAPYDSKIKETEKDLKVIEGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 100
           GAAPY  K+K  +KDLK IE KIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA
Sbjct: 3   GAAPYADKLKAIDKDLKDIEAKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62

Query: 101 RCTKIIKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKYVINLKQIAKFVVGLGERVS 160
           RCTKIIK                                KY+INLKQIAKFVVGLGERVS
Sbjct: 63  RCTKIIKPEASEDNTGEEDEEDS----------------KYIINLKQIAKFVVGLGERVS 106

Query: 161 PTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREV 220
           PTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QI+KLREV
Sbjct: 107 PTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREV 166

Query: 221 VELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYV 280
           VELPLLSPERFA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYV
Sbjct: 167 VELPLLSPERFAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYV 226

Query: 281 GEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFD 340
           GEGARMVRELFEMART+KACIIFFDEI               NEVQRTMLELITQLDGFD
Sbjct: 227 GEGARMVRELFEMARTRKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFD 286

Query: 341 PRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRW 400
           PRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRW
Sbjct: 287 PRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRW 346

Query: 401 ELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYM 460
           ELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFL+AV+KVI+GYKKFSSTS+YM
Sbjct: 347 ELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYM 406

Query: 461 QYN 463
           QYN
Sbjct: 407 QYN 409

>NDAI0C03780 Chr3 complement(860828..861985) [1158 bp, 385 aa] {ON}
           Anc_5.251
          Length = 385

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/385 (84%), Positives = 332/385 (86%), Gaps = 6/385 (1%)

Query: 85  MGDRQRLSEEHPLQVARCTKIIKKXXXXXXX------XXXXXXXXXXXXXXXXXXXXXXX 138
           MGDRQRLSEEHPLQVARCTKIIK                                     
Sbjct: 1   MGDRQRLSEEHPLQVARCTKIIKGNAASATEGEDGGDEQINPTSTSNNSNAENAEEDEED 60

Query: 139 XKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE 198
            KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE
Sbjct: 61  NKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEE 120

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           KPD+TY+DVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA
Sbjct: 121 KPDITYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 180

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
           VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI           
Sbjct: 181 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAIGGARFDDG 240

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL
Sbjct: 241 AGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 300

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
           EGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVA+EKD
Sbjct: 301 EGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVASEKD 360

Query: 439 FLKAVDKVISGYKKFSSTSRYMQYN 463
           FLKAV+KVI+GYKKFSSTSRYMQYN
Sbjct: 361 FLKAVEKVINGYKKFSSTSRYMQYN 385

>Suva_7.227 Chr7 complement(402610..403827) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  308 bits (789), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 154/309 (49%), Positives = 208/309 (67%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
            RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGMFA+R RR   T++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDF 382

Query: 440 LKAVDKVIS 448
             AV KV++
Sbjct: 383 ELAVGKVMN 391

>Skud_7.236 Chr7 complement(412698..413915) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  307 bits (786), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/309 (49%), Positives = 208/309 (67%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
            RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 382

Query: 440 LKAVDKVIS 448
             AV KV++
Sbjct: 383 ELAVGKVMN 391

>Smik_7.235 Chr7 complement(401584..402801) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  307 bits (786), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/309 (49%), Positives = 208/309 (67%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
            RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 382

Query: 440 LKAVDKVIS 448
             AV KV++
Sbjct: 383 ELAVGKVMN 391

>YGL048C Chr7 complement(410069..411286) [1218 bp, 405 aa] {ON}
           RPT6One of six ATPases of the 19S regulatory particle of
           the 26S proteasome involved in the degradation of
           ubiquitinated substrates; bound by ubiquitin-protein
           ligases Ubr1p and Ufd4p; localized mainly to the nucleus
           throughout the cell cycle
          Length = 405

 Score =  307 bits (786), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/309 (49%), Positives = 208/309 (67%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKV 142

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 202

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSG 262

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVA 322

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
            RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++DF
Sbjct: 323 ARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 382

Query: 440 LKAVDKVIS 448
             AV KV++
Sbjct: 383 ELAVGKVMN 391

>KLLA0A04752g Chr1 complement(425610..426824) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates
          Length = 404

 Score =  307 bits (786), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 208/309 (67%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ 
Sbjct: 82  KVLVKVQPEGKYIVDVAKDINVKDLKVSQRVCLKSDSYQLHKVLENKVDPLVSLMMVEKV 141

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 142 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 201

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 202 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSG 261

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 262 GGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVA 321

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
            R  I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++DF
Sbjct: 322 ARTEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDF 381

Query: 440 LKAVDKVIS 448
             AV KV++
Sbjct: 382 ELAVAKVMN 390

>KLTH0D03806g Chr4 complement(371457..372674) [1218 bp, 405 aa] {ON}
           highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 405

 Score =  303 bits (777), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 204/301 (67%), Gaps = 1/301 (0%)

Query: 149 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVG 208
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKASQRVCLKSDSYALHKILENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 209 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 268
           G   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 269 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 327
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFIMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 328 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 387
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA I RI
Sbjct: 271 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRI 330

Query: 388 HTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVI 447
           H++ M++ RGI    I+      +GA+++ VCTEAGMFA+R RR   T++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVM 390

Query: 448 S 448
           +
Sbjct: 391 N 391

>Kwal_26.7474 s26 complement(379608..380825) [1218 bp, 405 aa] {ON}
           YGL048C (RPT6) - ATPase [contig 51] FULL
          Length = 405

 Score =  303 bits (777), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 204/301 (67%), Gaps = 1/301 (0%)

Query: 149 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVG 208
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKTSQRVCLKSDSYTLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 209 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 268
           G   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 269 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 327
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 328 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 387
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA I RI
Sbjct: 271 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRI 330

Query: 388 HTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVI 447
           H++ M++ RGI    I+      +GA+++ VCTEAGMFA+R RR   T++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVM 390

Query: 448 S 448
           +
Sbjct: 391 N 391

>CAGL0D06292g Chr4 (593556..594758) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q01939 Saccharomyces cerevisiae
           YGL048c SUG1 26S proteasome regulatory subunit
          Length = 400

 Score =  301 bits (772), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 154/311 (49%), Positives = 208/311 (66%), Gaps = 2/311 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 76  KVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLVNKADPLVSLMMVEKV 135

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 136 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 195

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXX--XXXXXXXX 317
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 196 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGG 255

Query: 318 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 377
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 256 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPT 315

Query: 378 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           +  RA I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 316 VAARAEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 375

Query: 438 DFLKAVDKVIS 448
           DF  AV KV++
Sbjct: 376 DFELAVGKVMN 386

>ZYRO0G22330g Chr7 complement(1835777..1836994) [1218 bp, 405 aa]
           {ON} highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 405

 Score =  301 bits (771), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 152/318 (47%), Positives = 211/318 (66%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 83  KVLVKVQPEGKYIVDISKDINIKDLKPSQRVCLKSDSYTLHKILENKADPLVSLMMVEKV 142

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           PD TY  +GG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 143 PDSTYDMLGGLTKQIKEIKEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLARAV 202

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 203 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMARENAPSIIFMDEIDSIGSSRVEGSG 262

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P + 
Sbjct: 263 GGDSEVQRTMLELLNQLDGFETSKNIKIVMATNRLDILDPALLRPGRIDRKIEFPPPTVA 322

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
            R  I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D 
Sbjct: 323 ARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDL 382

Query: 440 LKAVDKVISGYKKFSSTS 457
             AV KV++  ++ + +S
Sbjct: 383 ELAVGKVMNRNQETAISS 400

>AGL043C Chr7 complement(625438..626655) [1218 bp, 405 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL048C
           (RPT6)
          Length = 405

 Score =  301 bits (771), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 203/301 (67%), Gaps = 1/301 (0%)

Query: 149 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVG 208
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKVSQRVCLKSDSYVLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 209 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 268
           G   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 269 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 327
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 328 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 387
           TMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RI
Sbjct: 271 TMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRI 330

Query: 388 HTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVI 447
           H++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVM 390

Query: 448 S 448
           +
Sbjct: 391 N 391

>Kpol_1041.42 s1041 (110852..112063) [1212 bp, 403 aa] {ON}
           (110852..112063) [1212 nt, 404 aa]
          Length = 403

 Score =  301 bits (770), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 151/301 (50%), Positives = 202/301 (67%), Gaps = 1/301 (0%)

Query: 149 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVG 208
            K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ PD TY  VG
Sbjct: 89  GKYIVDVAKDINVKDLKPSQRVCLKSDTYMLHKVLENKADPLVSLMMVEKVPDSTYDMVG 148

Query: 209 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 268
           G   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 149 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 208

Query: 269 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 327
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 209 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 268

Query: 328 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 387
           TMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RI
Sbjct: 269 TMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRI 328

Query: 388 HTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVI 447
           H++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+
Sbjct: 329 HSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVSKVM 388

Query: 448 S 448
           +
Sbjct: 389 N 389

>SAKL0H23672g Chr8 (2045883..2047109) [1227 bp, 408 aa] {ON} highly
           similar to uniprot|Q01939 Saccharomyces cerevisiae
           YGL048C RPT6 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 408

 Score =  301 bits (770), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 151/301 (50%), Positives = 203/301 (67%), Gaps = 1/301 (0%)

Query: 149 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVG 208
            K++V + + +   D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 94  GKYIVDIAKDIDVKDLKTSQRVCLKSDSYTLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 153

Query: 209 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 268
           G   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 154 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 213

Query: 269 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 327
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 214 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 273

Query: 328 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 387
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RI
Sbjct: 274 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTIAARTEILRI 333

Query: 388 HTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVI 447
           H++ M++ RGI  + I+      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+
Sbjct: 334 HSRKMNLTRGINLKKIAEQMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVM 393

Query: 448 S 448
           +
Sbjct: 394 N 394

>NCAS0A05880 Chr1 complement(1154364..1155587) [1224 bp, 407 aa]
           {ON} Anc_4.57
          Length = 407

 Score =  300 bits (769), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 207/310 (66%), Gaps = 1/310 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 84  KVLVKVQPEGKYIVDIAKDINVKDLKTSQRVCLKSDSYMLHKILENKADPLVSLMMVEKV 143

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 144 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 203

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 204 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGS 263

Query: 320 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
              + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 264 GGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 323

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
             R  I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D
Sbjct: 324 AARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 383

Query: 439 FLKAVDKVIS 448
           F  AV KV++
Sbjct: 384 FELAVGKVMN 393

>TDEL0E05660 Chr5 complement(1051545..1052765) [1221 bp, 406 aa]
           {ON} Anc_4.57 YGL048C
          Length = 406

 Score =  299 bits (766), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 149/300 (49%), Positives = 201/300 (67%)

Query: 149 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVG 208
            K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+ PD TY  +G
Sbjct: 93  GKYIVDISKDINIKELKPSQRVCLKSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMLG 152

Query: 209 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 268
           G   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 153 GLTKQIKEIKEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 212

Query: 269 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRT 328
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               +EVQRT
Sbjct: 213 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSGGGDSEVQRT 272

Query: 329 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH 388
           MLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RIH
Sbjct: 273 MLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTQILRIH 332

Query: 389 TKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVIS 448
           ++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D   AV KV++
Sbjct: 333 SRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDLELAVGKVMN 392

>KAFR0F03100 Chr6 complement(617330..618547) [1218 bp, 405 aa] {ON}
           Anc_4.57 YGL048C
          Length = 405

 Score =  299 bits (765), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 207/310 (66%), Gaps = 1/310 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 82  KVLVKVQPEGKYIVDVAKDINVKDLKVSQRVCLKSDSYMLHKILENKADPLVSLMMVEKV 141

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 142 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 201

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 202 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVESGS 261

Query: 320 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
              + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 262 GGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 321

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
             R  I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D
Sbjct: 322 AARTEILRIHSRKMNLTRGINLRKIADKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 381

Query: 439 FLKAVDKVIS 448
           F  AV KV++
Sbjct: 382 FELAVGKVMN 391

>KNAG0D03200 Chr4 complement(573942..575144) [1203 bp, 400 aa] {ON}
           Anc_4.57 YGL048C
          Length = 400

 Score =  298 bits (764), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 153/313 (48%), Positives = 206/313 (65%), Gaps = 4/313 (1%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           K ++ ++   K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 74  KVLVKVQPEGKYIVDVAKDINVKELKVSQRVCLKSDSYMLHKVLENKADPLVSLMMVEKV 133

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 134 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 193

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXX----XXXXXX 315
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 194 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVESSS 253

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                  +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  
Sbjct: 254 GGGGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPA 313

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVAT 435
           P L  R  I RIH++ M++ RGI    I       +GA+++ VCTEAGM+A+R RR   T
Sbjct: 314 PTLAARTEILRIHSRKMNLTRGINLRKIVEKMNGCSGADVKGVCTEAGMYALRERRIHVT 373

Query: 436 EKDFLKAVDKVIS 448
           ++DF  AV KV++
Sbjct: 374 QEDFELAVGKVMN 386

>NDAI0D02850 Chr4 (659572..660789) [1218 bp, 405 aa] {ON} Anc_4.57
          Length = 405

 Score =  298 bits (764), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 151/310 (48%), Positives = 207/310 (66%), Gaps = 1/310 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           K ++ ++   K++V + + +   +++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 82  KVLVKVQPEGKYIVDVAKDIDIKNLKPSQRVCLKSDSYMLHKVLENKSDPLVSLMMVEKV 141

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 142 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 201

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 202 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMARQHAPSIIFMDEIDSIGSSRVEGGS 261

Query: 320 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
              + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 262 GGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 321

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
             RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++D
Sbjct: 322 AARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 381

Query: 439 FLKAVDKVIS 448
           F  AV KV++
Sbjct: 382 FELAVGKVMN 391

>TBLA0B09880 Chr2 (2356110..2357315) [1206 bp, 401 aa] {ON} Anc_4.57
           YGL048C
          Length = 401

 Score =  298 bits (763), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 151/310 (48%), Positives = 207/310 (66%), Gaps = 1/310 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           + ++ ++   K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+ 
Sbjct: 78  RVLVKIQPEGKYIVDVAKDINIKELKPSQRVCLKSDSYLLHKVLKNKSDPLVSLMMVEKV 137

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           PD TY  VGG   QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAV
Sbjct: 138 PDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAV 197

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI            
Sbjct: 198 AHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGS 257

Query: 320 XXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
              + EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +
Sbjct: 258 GGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTV 317

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
             R  I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D
Sbjct: 318 AARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQED 377

Query: 439 FLKAVDKVIS 448
           F  AV KV++
Sbjct: 378 FELAVAKVMN 387

>TPHA0F00440 Chr6 complement(106389..107600) [1212 bp, 403 aa] {ON}
           Anc_4.57 YGL048C
          Length = 403

 Score =  297 bits (761), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 150/301 (49%), Positives = 202/301 (67%), Gaps = 1/301 (0%)

Query: 149 AKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVG 208
            K++V +   ++  +++   RV +    Y +   L  + DP V++M VE+ PD TY  VG
Sbjct: 89  GKYIVDVAPDINVKELKPSQRVCLKSDSYLLHKVLDNKADPLVSLMMVEKVPDSTYDMVG 148

Query: 209 GCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 268
           G   QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 149 GLTKQIREIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 208

Query: 269 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN-EVQR 327
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DEI               + EVQR
Sbjct: 209 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 268

Query: 328 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 387
           TMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA I +I
Sbjct: 269 TMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILKI 328

Query: 388 HTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVI 447
           H++ M++ RGI  + ++      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+
Sbjct: 329 HSRKMNLTRGINLKKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVM 388

Query: 448 S 448
           +
Sbjct: 389 N 389

>Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  281 bits (719), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 146/322 (45%), Positives = 200/322 (62%), Gaps = 1/322 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++T+  +GG  DQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT+ +       +E   ++     GA++R+  TEAG FAIR  R   T  D 
Sbjct: 356 GRLEIFKIHTEKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIREDRDHITSDDL 415

Query: 440 LKAVDKVISGYKKFSSTSRYMQ 461
           +KAV KV +  KK   T  Y +
Sbjct: 416 MKAVRKV-AEVKKLEGTIEYQK 436

>SAKL0H05764g Chr8 (514898..516163) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259C RPT4 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 421

 Score =  280 bits (716), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 146/322 (45%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E 
Sbjct: 100 KYIVKASSGPRYIVGVRNSVDRSKLKKGIRVTLDITTLTIMRILPRETDPLVYNMTTFEP 159

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++++  +GG  DQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 160 GEISFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIQPPKGVLLYGPPGTGKTLLAKAV 219

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 220 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 279

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 280 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 339

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 340 GRLEIFKIHTAHVKKSGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIQDDL 399

Query: 440 LKAVDKVISGYKKFSSTSRYMQ 461
           +KAV KV S  KK      Y +
Sbjct: 400 MKAVRKV-SEVKKLEGKLEYQK 420

>KLLA0C09592g Chr3 (833061..834365) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259C RPT4 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 434

 Score =  280 bits (717), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 141/307 (45%), Positives = 196/307 (63%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 113 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 172

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 173 GEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLYGPPGTGKTLLAKAV 232

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 233 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 292

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 293 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 352

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT ++       +E   ++     GA++R+  TEAG FAIR  R    ++D 
Sbjct: 353 GRLEIFKIHTSNVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDYINQEDL 412

Query: 440 LKAVDKV 446
           +KAV KV
Sbjct: 413 MKAVRKV 419

>Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  279 bits (713), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V+ + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVNRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++T+  +GG  DQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R      D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDL 415

Query: 440 LKAVDKVISGYKKFSSTSRYMQ 461
           +KAV KV +  KK   T  Y +
Sbjct: 416 MKAVRKV-AEVKKLEGTIEYQK 436

>KNAG0G02720 Chr7 complement(606758..608092) [1335 bp, 444 aa] {ON}
           Anc_8.708 YOR259C
          Length = 444

 Score =  279 bits (713), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 201/322 (62%), Gaps = 1/322 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  T +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 123 KYIVKASSGPRYIVGVRNSVDRTKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 182

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 183 GEITFDGIGGLTEQIRELREVIELPLKNPEIFQRIGIKPPKGVLLYGPPGTGKTLLAKAV 242

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 243 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 302

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 303 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNEA 362

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT ++       ++   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 363 GRLEIFKIHTANVKKHGEFDFDAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDM 422

Query: 440 LKAVDKVISGYKKFSSTSRYMQ 461
           +KAV KV S  KK   T  Y +
Sbjct: 423 MKAVRKV-SETKKLEGTIEYQK 443

>Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  278 bits (710), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++T+  +GG  DQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRIGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKLEIPLPNEA 355

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPEDL 415

Query: 440 LKAVDKVISGYKKFSSTSRYMQ 461
           +KAV KV +  KK   T  Y +
Sbjct: 416 MKAVRKV-AEVKKLEGTIEYQK 436

>KLTH0D11990g Chr4 complement(976271..977572) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 433

 Score =  277 bits (708), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 140/307 (45%), Positives = 194/307 (63%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 112 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRVLPRETDPLVYNMTSFEQ 171

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            D+T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 172 GDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 231

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 232 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 291

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 292 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNET 351

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 352 GRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIQDDL 411

Query: 440 LKAVDKV 446
           +KAV KV
Sbjct: 412 MKAVRKV 418

>YOR259C Chr15 complement(812395..813708) [1314 bp, 437 aa] {ON}
           RPT4One of six ATPases of the 19S regulatory particle of
           the 26S proteasome involved in degradation of
           ubiquitinated substrates; contributes preferentially to
           ERAD; required for spindle pole body duplication; mainly
           nuclear localization
          Length = 437

 Score =  276 bits (707), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R      D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDL 415

Query: 440 LKAVDKVISGYKKFSSTSRYMQ 461
           +KAV KV +  KK   T  Y +
Sbjct: 416 MKAVRKV-AEVKKLEGTIEYQK 436

>AAL113W Chr1 (146143..147441) [1299 bp, 432 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR259C (RPT4)
          Length = 432

 Score =  276 bits (706), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 138/307 (44%), Positives = 193/307 (62%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+      + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 111 KYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 170

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI  PKG+LLYGPPGTGKTL A+AV
Sbjct: 171 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTGKTLLAKAV 230

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 231 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 290

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 291 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 350

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           G   IF+IHT  +       +E   ++C    GA++R+  TEAG FAIR  R    ++D 
Sbjct: 351 GMLEIFKIHTAKVKKSGEFDFEAAVKMCDGFNGADIRNCVTEAGFFAIRDDRDYIIQEDL 410

Query: 440 LKAVDKV 446
           +KAV KV
Sbjct: 411 MKAVRKV 417

>CAGL0K08910g Chr11 (893007..894317) [1311 bp, 436 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259c CRL13
          Length = 436

 Score =  276 bits (706), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 115 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 174

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++++  +GG  DQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 175 GEISFEGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 234

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 235 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 294

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 295 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 354

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT  +       ++   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 355 GRLEIFKIHTSKVKKSGEFDFDAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 414

Query: 440 LKAVDKVISGYKKFSSTSRYMQ 461
           +KAV KV +  KK   T  Y +
Sbjct: 415 MKAVRKV-AEVKKLEGTLEYQK 435

>Ecym_2365 Chr2 (712020..713303) [1284 bp, 427 aa] {ON} similar to
           Ashbya gossypii AAL113W
          Length = 427

 Score =  275 bits (704), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 138/307 (44%), Positives = 194/307 (63%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+      + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 106 KYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 165

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI+ PKG+LLYGPPGTGKTL A+AV
Sbjct: 166 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGINSPKGVLLYGPPGTGKTLLAKAV 225

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 226 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 285

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 286 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 345

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R    ++D 
Sbjct: 346 GRLEIFKIHTAKVKKTGEFDFEATVKMSDGFNGADIRNCVTEAGFFAIRDDRDYIIQEDL 405

Query: 440 LKAVDKV 446
           +KAV KV
Sbjct: 406 MKAVRKV 412

>KAFR0A04010 Chr1 complement(809423..810697) [1275 bp, 424 aa] {ON}
           Anc_8.708 YOR259C
          Length = 424

 Score =  275 bits (703), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 200/322 (62%), Gaps = 1/322 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 103 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 162

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 163 GEISFNGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 222

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           +    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 223 SATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 282

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 283 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 342

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT ++       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 343 GRLEIFKIHTANVKKVGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDL 402

Query: 440 LKAVDKVISGYKKFSSTSRYMQ 461
           +KAV KV S  KK   T  Y +
Sbjct: 403 MKAVRKV-SEVKKLEGTLEYQK 423

>NCAS0B01150 Chr2 (192406..193686) [1281 bp, 426 aa] {ON} Anc_8.708
          Length = 426

 Score =  275 bits (703), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 200/322 (62%), Gaps = 1/322 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 105 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 164

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 165 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 224

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 225 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 284

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 285 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 344

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT  +  +    +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 345 GRLEIFKIHTAKVKKQGDFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 404

Query: 440 LKAVDKVISGYKKFSSTSRYMQ 461
           +KAV KV +  KK   +  Y +
Sbjct: 405 MKAVRKV-AEVKKLEGSLEYQK 425

>TDEL0A06530 Chr1 complement(1140292..1141599) [1308 bp, 435 aa]
           {ON} Anc_8.708 YOR259C
          Length = 435

 Score =  275 bits (703), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 114 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 173

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            D+++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 174 GDISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQPPKGVLLYGPPGTGKTLLAKAV 233

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 234 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 293

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 294 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 353

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 354 GRLEIFKIHTVHVKKSGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIPEDL 413

Query: 440 LKAVDKVISGYKKFSSTSRYMQ 461
           +KAV KV +  KK   +  Y +
Sbjct: 414 MKAVRKV-AEVKKLEGSLDYQK 434

>Kwal_26.8912 s26 complement(1003260..1004564) [1305 bp, 434 aa]
           {ON} YOR259C (RPT4) - ATPase; component of the 26S
           proteasome cap subunit [contig 68] FULL
          Length = 434

 Score =  274 bits (701), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 139/307 (45%), Positives = 193/307 (62%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 113 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 172

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            D+T+  +GG  +QI +LREV+ELPL +PE F  +GI  PKG+LLYGPPGTGKTL A+AV
Sbjct: 173 GDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTGKTLLAKAV 232

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 233 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 292

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 293 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNET 352

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 353 GRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIQDDL 412

Query: 440 LKAVDKV 446
           +KAV KV
Sbjct: 413 MKAVRKV 419

>TBLA0D01240 Chr4 (310540..311871) [1332 bp, 443 aa] {ON} Anc_8.708
           YOR259C
          Length = 443

 Score =  274 bits (700), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 142/320 (44%), Positives = 199/320 (62%), Gaps = 1/320 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 122 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTAFEQ 181

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 182 GEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLYGPPGTGKTLLAKAV 241

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 242 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 301

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 302 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 361

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR +IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 362 GRLDIFKIHTSKVKKVGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDL 421

Query: 440 LKAVDKVISGYKKFSSTSRY 459
           +KAV KV S  KK   +  Y
Sbjct: 422 MKAVRKV-SEVKKLEGSLEY 440

>NDAI0E01020 Chr5 (206043..207374) [1332 bp, 443 aa] {ON} Anc_8.708
          Length = 443

 Score =  274 bits (700), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V    +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 122 KYIVKASSGPRYIVGVRNSVDRKKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 181

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            +VT+  +GG  +QI  LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 182 GEVTFDGIGGLTEQIRALREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 241

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 242 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 301

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 302 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 361

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT+ +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 362 GRLEIFKIHTEKVKKIGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 421

Query: 440 LKAVDKVISGYKKFSSTSRYMQ 461
           +KAV KV +  KK   +  Y +
Sbjct: 422 MKAVRKV-AEVKKLEGSLEYQK 442

>Kpol_1064.22 s1064 complement(38724..40022) [1299 bp, 432 aa] {ON}
           complement(38724..40022) [1299 nt, 433 aa]
          Length = 432

 Score =  273 bits (698), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 198/320 (61%), Gaps = 1/320 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 111 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 170

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 171 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 230

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 231 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 290

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 291 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 350

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 351 GRLEIFKIHTAHVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIPEDL 410

Query: 440 LKAVDKVISGYKKFSSTSRY 459
           +KAV KV +  KK   +  Y
Sbjct: 411 MKAVRKV-AEVKKLEGSLEY 429

>NCAS0A10180 Chr1 complement(2028343..2029656) [1314 bp, 437 aa]
           {ON} Anc_3.216
          Length = 437

 Score =  273 bits (697), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 133/297 (44%), Positives = 196/297 (65%)

Query: 151 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGC 210
           F V +   V    +E G  V +      I   L    DP V++M +++ P  +Y+D+GG 
Sbjct: 128 FYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKIDKSPTESYSDIGGL 187

Query: 211 KDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 270
           + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 188 ESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 247

Query: 271 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 330
           +GSEL+QKY+G+G R+ R++F++A  +   IIF DEI                E+QRTML
Sbjct: 248 VGSELIQKYLGDGPRLCRQIFKVAGEQAPSIIFIDEIDAIGTKRYDSNSGGEREIQRTML 307

Query: 331 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTK 390
           EL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRIDRK+ F  PDL  +  I  IHT 
Sbjct: 308 ELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKRKILGIHTS 367

Query: 391 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVI 447
            M++ + + +E +     + +GA+++++CTEAG+ A+R RR   T +DF +A ++V+
Sbjct: 368 KMNLSKDVDFETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTGEDFKQAKERVM 424

>KLLA0E21209g Chr5 complement(1893904..1895202) [1299 bp, 432 aa]
           {ON} highly similar to uniprot|P33297 Saccharomyces
           cerevisiae YOR117W RPT5 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates recruited to
           the GAL1-10 promoter region upon induction of
           transcription
          Length = 432

 Score =  270 bits (691), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 129 MVGL---VDPVKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 185

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 186 KQIEELVEAIVLPMKQGEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 245

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 246 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 305

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 306 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 365

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V +  +
Sbjct: 366 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNAQSTIKHEDFVEAIGEVQA--R 423

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 424 KSKSVSFY 431

>ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 444

 Score =  271 bits (692), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 140/322 (43%), Positives = 197/322 (61%), Gaps = 1/322 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  ++
Sbjct: 123 KYIVKASSGPRYIVGVRNSVERSKLKKGVRVTLDITTLTIMRVLPRETDPLVYNMTSFDQ 182

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++++  +GG  DQI +LREV+ELPL +PE F  +GI  P G+LLYGPPGTGKTL A+AV
Sbjct: 183 DNISFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKSPTGVLLYGPPGTGKTLLAKAV 242

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEI            
Sbjct: 243 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 302

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 303 SADREIQRTLMELLTQMDGFDSLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 362

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  +F+IHT ++       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 363 GRLEVFKIHTTNVKKAGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDM 422

Query: 440 LKAVDKVISGYKKFSSTSRYMQ 461
           +KAV KV    KK   T  Y +
Sbjct: 423 MKAVRKVAES-KKLEGTVDYQK 443

>TPHA0D01470 Chr4 complement(302134..303501) [1368 bp, 455 aa] {ON}
           Anc_8.708 YOR259C
          Length = 455

 Score =  271 bits (693), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 139/320 (43%), Positives = 199/320 (62%), Gaps = 1/320 (0%)

Query: 140 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEK 199
           KY++      +++VG+   +  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 134 KYIVKASSGPRYIVGVRNSIDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 193

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 194 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 253

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 254 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKDHEPCIIFMDEVDAIGGRRFSEGT 313

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
               E+QRT++EL+TQ+DGF+  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 314 SADREIQRTLMELLTQMDGFENLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 373

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDF 439
           GR  IF+IHT+ +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 374 GRLEIFKIHTEKVKKIGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIREDRNHIIPEDL 433

Query: 440 LKAVDKVISGYKKFSSTSRY 459
           +KAV KV +  KK   +  Y
Sbjct: 434 MKAVRKV-AEVKKLEGSLEY 452

>NDAI0A07290 Chr1 (1663036..1664166) [1131 bp, 376 aa] {ON}
           Anc_3.216
          Length = 376

 Score =  268 bits (685), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 128/281 (45%), Positives = 186/281 (66%)

Query: 167 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLL 226
           G  V +      I   L   +DP V++M +++ P  +Y D+GG + QI++++E VELPL 
Sbjct: 83  GCAVSLHHKTMSIVGVLQDDVDPMVSVMKIDKSPTESYGDIGGLEAQIQEIKEAVELPLT 142

Query: 227 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 286
            PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+
Sbjct: 143 HPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRL 202

Query: 287 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 346
           VR++F++A      IIF DEI                E+QRTMLEL+ QLDGFD    +K
Sbjct: 203 VRQIFKVASENSPSIIFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDTSEVK 262

Query: 347 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRL 406
           V+ ATN+  TLDPAL+RPGRIDRK+ F  PDL  +  I  IHT  M++   + +E +   
Sbjct: 263 VIMATNKIETLDPALIRPGRIDRKILFENPDLSTKRKILGIHTSKMNLSSDVDFETLVTT 322

Query: 407 CPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVI 447
             + +GA+++++CTEAG+ A+R RR   T +DF +A ++V+
Sbjct: 323 KDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVM 363

>YDL007W Chr4 (438047..439360) [1314 bp, 437 aa] {ON}  RPT2One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; required for normal peptide hydrolysis by
           the core 20S particle
          Length = 437

 Score =  270 bits (690), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 182/260 (70%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           DP V++M +++ P  +Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 428 RARRKVATEKDFLKAVDKVI 447
           R RR   T +DF +A ++V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>Ecym_5527 Chr5 (1069222..1070520) [1299 bp, 432 aa] {ON} similar to
           Ashbya gossypii AER254W
          Length = 432

 Score =  270 bits (690), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 194/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V+P  ++    VGV++  Y +   LP   D  V  M V++KP  TY+DVGG  
Sbjct: 129 MVGL---VNPKKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDDKPTETYSDVGGLD 185

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 186 KQIEELVEAIVLPMKQAEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 245

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 246 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 305

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 306 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 365

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  + V   +DF++A+ +V +  +
Sbjct: 366 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSVVKHEDFVEAISEVQA--R 423

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 424 KTKSVSFY 431

>KAFR0F02440 Chr6 (477459..478769) [1311 bp, 436 aa] {ON} Anc_3.216
           YDL007W
          Length = 436

 Score =  270 bits (690), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 182/260 (70%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           DP V++M +++ P  +Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 164 DPMVSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 223

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 224 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 283

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 284 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 343

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 344 DRKILFENPDLSTKRKILGIHTSKMNLSSDVDLEKLVTSKDDLSGADIQAMCTEAGLLAL 403

Query: 428 RARRKVATEKDFLKAVDKVI 447
           R RR   T +DF +A ++V+
Sbjct: 404 RERRMQVTSEDFEQAKERVL 423

>SAKL0G02376g Chr7 (198787..200091) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117W RPT5 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates recruited to the
           GAL1-10 promoter region upon induction of transcription
          Length = 434

 Score =  270 bits (689), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 131 MVGL---VDPNKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKQSEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  E RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEEARAQILQIHSRK 367

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V +  +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEVQA--R 425

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 426 KTKSVSFY 433

>NCAS0F03330 Chr6 (674144..675448) [1305 bp, 434 aa] {ON} Anc_5.428
          Length = 434

 Score =  270 bits (689), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V PT ++    VGV++  Y I   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 131 MVGL---VDPTKLKPNDLVGVNKDSYLILEKLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  +GRA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDGRAQILQIHSRK 367

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V +  +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGIGEVQA--R 425

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Smik_4.229 Chr4 (417215..418528) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  270 bits (689), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 182/260 (70%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           DP V++M +++ P  +Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKRKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 428 RARRKVATEKDFLKAVDKVI 447
           R RR   T +DF +A ++V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>TDEL0D04060 Chr4 (744364..745677) [1314 bp, 437 aa] {ON} Anc_3.216
           YDL007W
          Length = 437

 Score =  270 bits (689), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 125/273 (45%), Positives = 187/273 (68%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           DP +++M +++ P  +Y+D+GG ++QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMISVMKIDKSPTESYSDIGGLENQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 284

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 285 DAIGTKRYESNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 344

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           DRK+ F  PDL  +  I  IHT  MS+   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLGTKRKILGIHTSKMSLSSDVHLEELVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 428 RARRKVATEKDFLKAVDKVISGYKKFSSTSRYM 460
           R RR   T +DF +A ++V+    + +    YM
Sbjct: 405 RERRMQVTAEDFKQAKERVMKNKVEENLEGLYM 437

>KNAG0K01530 Chr11 complement(315711..317018) [1308 bp, 435 aa] {ON}
           Anc_3.216 YDL007W
          Length = 435

 Score =  269 bits (688), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 182/260 (70%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           DP V++M +++ P  +Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 163 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 222

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 223 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGDNAPSIVFIDEI 282

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 283 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 342

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA++++VCTEAG+ A+
Sbjct: 343 DRKILFESPDLATKKKILGIHTSKMNLSADVDLEKLVTSKDDLSGADIQAVCTEAGLLAL 402

Query: 428 RARRKVATEKDFLKAVDKVI 447
           R RR   T +DF +A ++V+
Sbjct: 403 RERRMQVTAEDFKQAKERVM 422

>TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.251
           YKL145W
          Length = 434

 Score =  269 bits (688), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P +++    VGV++  Y I   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 131 LVGL---VDPKNLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  E RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEESRAQILQIHSRK 367

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W  ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V +  +
Sbjct: 368 MTTDDDINWSELARSTDEFNGAQLKAVAVEAGMIALRNGQSSVKHEDFVEAISEVQA--R 425

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Suva_4.246 Chr4 (435306..436619) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  269 bits (688), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 182/260 (70%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           DP V++M +++ P  +Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLEAQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEKEIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKRKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 428 RARRKVATEKDFLKAVDKVI 447
           R RR   T +DF +A ++V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>ZYRO0A04224g Chr1 (341547..342860) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007W RPT2 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           normal peptide hydrolysis by the core 20S particle
          Length = 437

 Score =  269 bits (687), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 180/260 (69%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           DP +  M +++ P   Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMIAAMKIDKSPTENYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIRPPKGVILYGA 224

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAEHSPSIVFIDEI 284

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                           EVQRTMLEL+ QLDGFD RG+IKV+ ATNR  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYESNSGGEREVQRTMLELLNQLDGFDDRGDIKVVMATNRIETLDPALIRPGRI 344

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           DRK+ F  PD+  +  I  IHT  M++   +R + +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDMNTKKRILGIHTAKMNLSEDVRLDELVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 428 RARRKVATEKDFLKAVDKVI 447
           R RR   T +DF +A ++V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>Kpol_1010.74 s1010 complement(182279..183592) [1314 bp, 437 aa]
           {ON} complement(182279..183592) [1314 nt, 438 aa]
          Length = 437

 Score =  269 bits (687), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 122/260 (46%), Positives = 182/260 (70%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           DP V++M +++ P  +Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 284

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 344

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           DRK+ F  PDL+ +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFEQPDLQTKRKILTIHTSKMNLSEDVNLEQLVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 428 RARRKVATEKDFLKAVDKVI 447
           R RR   T +DF +  ++V+
Sbjct: 405 RERRMQVTAEDFKQGKERVL 424

>KLTH0F16214g Chr6 complement(1313746..1315050) [1305 bp, 434 aa]
           {ON} highly similar to uniprot|P33297 Saccharomyces
           cerevisiae YOR117W RPT5 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates recruited to
           the GAL1-10 promoter region upon induction of
           transcription
          Length = 434

 Score =  268 bits (685), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LPL   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPLKQAEKFTNMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEG+++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGSKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V +  +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEVQA--R 425

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007W
           (RPT2) - (putative) 26S protease subunit [contig 31]
           FULL
          Length = 376

 Score =  266 bits (679), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 130/310 (41%), Positives = 196/310 (63%)

Query: 151 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGC 210
           F V +   V    +E G  V +      I   L    DP + +M +++ P  +Y+D+GG 
Sbjct: 67  FYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDTDPMINVMKIDKSPTESYSDIGGL 126

Query: 211 KDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 270
           + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 127 ESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 186

Query: 271 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 330
           +GSEL+QKY+G+G R+ R++F+ A      I+F DEI                E+QRTML
Sbjct: 187 VGSELIQKYLGDGPRLCRQIFKAAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 246

Query: 331 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTK 390
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  I  IHT 
Sbjct: 247 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDISTKRKILTIHTS 306

Query: 391 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGY 450
            M++   +  E +     + +GA+++++CTEAG+ A+R RR   T +DF +A ++++   
Sbjct: 307 KMNLAPDVDLENLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTAEDFKQAKERILKNK 366

Query: 451 KKFSSTSRYM 460
            + +  S Y+
Sbjct: 367 VEENLESLYL 376

>KNAG0C04960 Chr3 complement(957096..958367) [1272 bp, 423 aa] {ON}
           Anc_5.428 YOR117W
          Length = 423

 Score =  267 bits (683), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 120 MVGL---VDPDTLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 176

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 177 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 236

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 237 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 296

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF    N+KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 297 LLNQLDGFSSDDNVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 356

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF+ A+ +V +  +
Sbjct: 357 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQASVKHEDFVDAIGEVQA--R 414

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 415 KSKSVSFY 422

>Kwal_55.21453 s55 complement(844026..845330) [1305 bp, 434 aa] {ON}
           YOR117W (RPT5) - 26S protease regulatory subunit [contig
           130] FULL
          Length = 434

 Score =  268 bits (684), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LPL   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPLKQAEKFTNMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEG+++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGSKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V +  +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEVQA--R 425

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>SAKL0C11440g Chr3 complement(1028353..1029660,1029734..1029736)
           [1311 bp, 436 aa] {ON} highly similar to uniprot|P40327
           Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases
           of the 19S regulatory particle of the 26S proteasome
           involved in the degradation of ubiquitinated substrates
           required for normal peptide hydrolysis by the core 20S
           particle
          Length = 436

 Score =  268 bits (684), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 198/310 (63%)

Query: 151 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGC 210
           F V +   V    +E G  V +      I   L    DP V++M +++ P  +Y+D+GG 
Sbjct: 127 FYVSILSFVDKEMLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKIDKSPTESYSDIGGL 186

Query: 211 KDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 270
           + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 187 EAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 246

Query: 271 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 330
           +GSEL+QKY+G+G R+ R++F++A      I+F DEI                E+QRTML
Sbjct: 247 VGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 306

Query: 331 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTK 390
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  I  IHT 
Sbjct: 307 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDISTKRKILGIHTS 366

Query: 391 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGY 450
            M++   I  E +     + +GA+++++CTEAG+ A+R RR   T +DF +A ++V+   
Sbjct: 367 KMNLSGDIDLENLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNK 426

Query: 451 KKFSSTSRYM 460
            + +  S Y+
Sbjct: 427 VEENLESLYL 436

>CAGL0A02750g Chr1 (292470..293759) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117w YTA1
          Length = 429

 Score =  267 bits (683), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 126 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 182

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 183 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 242

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 243 APQLVQMFIGEGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 302

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 303 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 362

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V +  +
Sbjct: 363 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMLALRNGQSSVKHEDFVEAIGEVQA--R 420

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 421 KSKSVSFY 428

>CAGL0I04884g Chr9 (446336..447637) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007w YTA5
          Length = 433

 Score =  267 bits (683), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 182/260 (70%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           DP V++M +++ P  +Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 161 DPMVSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 220

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 221 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 280

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 281 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 340

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 341 DRKILFENPDLSTKRKILGIHTSKMNLSSDVDLENLVTSKDDLSGADIQAMCTEAGLLAL 400

Query: 428 RARRKVATEKDFLKAVDKVI 447
           R RR   T +DF +A ++V+
Sbjct: 401 RERRMQVTAEDFKQAKERVM 420

>Ecym_5286 Chr5 (578258..579571) [1314 bp, 437 aa] {ON} similar to
           Ashbya gossypii AEL011W
          Length = 437

 Score =  267 bits (683), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 130/297 (43%), Positives = 191/297 (64%)

Query: 151 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGC 210
           F V +   V    +E G  V +      I   L    DP V++M +++ P  +Y D+GG 
Sbjct: 128 FYVSILSFVDKELLEPGCSVLLHHKTMSIVGALQDDADPMVSVMKIDKSPAESYNDIGGL 187

Query: 211 KDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 270
           + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 188 EAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 247

Query: 271 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 330
           +GSEL+QKY+G+G R+ R++F++A      I+F DEI                E+QRTML
Sbjct: 248 VGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 307

Query: 331 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTK 390
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  I  IHT 
Sbjct: 308 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDITTKRKILGIHTS 367

Query: 391 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVI 447
            M++   +  E +       +GA+++++CTEAG+ A+R RR   T +DF +A ++V+
Sbjct: 368 KMNLSEDVNLETLVTSKDELSGADIKAMCTEAGLLALRERRMQVTVEDFKQAKERVM 424

>TPHA0A04270 Chr1 (962488..963801) [1314 bp, 437 aa] {ON} Anc_3.216
           YDL007W
          Length = 437

 Score =  267 bits (682), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 181/260 (69%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           DP V++M +++ P  +Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKKKILGIHTSKMNLAEDVDLETLVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 428 RARRKVATEKDFLKAVDKVI 447
           R RR   T +DF +  ++V+
Sbjct: 405 RERRMQVTAEDFKQGKERVL 424

>Smik_15.295 Chr15 (506228..507532) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  266 bits (681), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V +  +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQA--R 425

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Skud_4.247 Chr4 (429639..430952) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  266 bits (681), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 182/260 (70%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           DP V++M +++ P  +Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLEAQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKRKILGIHTSKMNLCEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 428 RARRKVATEKDFLKAVDKVI 447
           R RR   T +DF +A ++V+
Sbjct: 405 RERRMQVTGEDFKQAKERVM 424

>KAFR0E03890 Chr5 (770235..771539) [1305 bp, 434 aa] {ON} Anc_5.428
           YOR117W
          Length = 434

 Score =  266 bits (681), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMQRADKFKDLGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 367

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V +  +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEAIGEVQA--R 425

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>YOR117W Chr15 (545029..546333) [1305 bp, 434 aa] {ON}  RPT5One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; recruited to the GAL1-10 promoter region
           upon induction of transcription; similar to human TBP1
          Length = 434

 Score =  266 bits (681), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V +  +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQA--R 425

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>AEL011W Chr5 (613775..615088) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL007W (RPT2)
          Length = 437

 Score =  266 bits (681), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 130/297 (43%), Positives = 192/297 (64%)

Query: 151 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGC 210
           F V +   V    +E G  V +      I   L    DP V++M +++ P  +Y D+GG 
Sbjct: 128 FYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKIDKSPTESYNDIGGL 187

Query: 211 KDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 270
           + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 188 EAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 247

Query: 271 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 330
           +GSEL+QKY+G+G R+ R++F++A      I+F DEI                E+QRTML
Sbjct: 248 VGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 307

Query: 331 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTK 390
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  I  IHT 
Sbjct: 308 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDVSTKRKILGIHTS 367

Query: 391 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVI 447
            M++   +  E +     + +GA+++++CTEAG+ A+R RR   T +DF +A ++V+
Sbjct: 368 KMNLSADVDLETLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTVEDFKQAKERVM 424

>Suva_8.170 Chr8 (302825..304129) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  266 bits (680), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V +  +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQA--R 425

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>TBLA0F00690 Chr6 (177827..179131) [1305 bp, 434 aa] {ON} Anc_3.216
           YDL007W
          Length = 434

 Score =  266 bits (680), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 180/260 (69%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           DP V++M +++ P  TY+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 162 DPMVSVMKMDKSPTETYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 221

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+VR++F++A      I+F DEI
Sbjct: 222 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLVRQIFKVAGENAPSIVFIDEI 281

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                           E+QRTMLEL+ QLDGFD   ++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 282 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDTSDVKVIMATNKIESLDPALIRPGRI 341

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           DRK+ F  PDL  +  I  IHT  MS+   +  + +     + +GA+++++CTEAG+ A+
Sbjct: 342 DRKILFENPDLSTKRKILAIHTSKMSLSEDVSLDELVTSKDDLSGADIQAMCTEAGLLAL 401

Query: 428 RARRKVATEKDFLKAVDKVI 447
           R RR   T KDF +  ++V+
Sbjct: 402 RERRMQVTAKDFEQGKERVL 421

>Kpol_1062.33 s1062 complement(71197..72501) [1305 bp, 434 aa] {ON}
           complement(71197..72501) [1305 nt, 435 aa]
          Length = 434

 Score =  266 bits (680), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V +  +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVEAIGEVQA--R 425

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Skud_15.280 Chr15 (501467..502771) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  265 bits (678), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 190/308 (61%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+    I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V +  +
Sbjct: 368 MTTADDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEVQA--R 425

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>TDEL0E01970 Chr5 complement(371140..372444) [1305 bp, 434 aa] {ON}
           Anc_5.428 YOR117W
          Length = 434

 Score =  265 bits (678), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 131 MVGL---VDPDTLKPNDLVGVNKDSYLILETLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF+ A+ +V +  +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVDAIGEVQA--R 425

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>AER254W Chr5 (1106478..1107860) [1383 bp, 460 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR117W (RPT5)
          Length = 460

 Score =  266 bits (680), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V++KP  TY+DVGG  
Sbjct: 157 MVGL---VDPKQLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDDKPTETYSDVGGLD 213

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 214 KQIEELVEAIVLPMKQADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 273

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 274 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 333

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 334 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 393

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  + V   +DF++A+ +V +  +
Sbjct: 394 MTSDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSVIKHEDFVEAIGEVQA--R 451

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 452 KTKSVSFY 459

>NDAI0B05620 Chr2 (1374568..1376016) [1449 bp, 482 aa] {ON}
           Anc_5.428
          Length = 482

 Score =  266 bits (679), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V PT ++    VGV++  Y +   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 179 MVGL---VDPTKLKPNDLVGVNKDSYLVLEKLPSEFDSRVKAMEVDEKPTETYSDVGGLD 235

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 236 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 295

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 296 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 355

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 356 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 415

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V +  +
Sbjct: 416 MTTDNDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGIGEVQA--R 473

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 474 KSKSVSFY 481

>TBLA0A03740 Chr1 (935676..936980) [1305 bp, 434 aa] {ON} Anc_5.428
           YOR117W
          Length = 434

 Score =  264 bits (674), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP   Y+DVGG  
Sbjct: 131 MVGL---VDPNKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTENYSDVGGLD 187

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     IKV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRIKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++A+ +V +  +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEAIGEVQA--R 425

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>KLLA0F14707g Chr6 (1361964..1363268) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007W RPT2 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           normal peptide hydrolysis by the core 20S particle
          Length = 434

 Score =  264 bits (674), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 121/260 (46%), Positives = 181/260 (69%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           DP V++M +++ P   Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 162 DPMVSVMKMDKSPTENYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 221

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DEI
Sbjct: 222 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 281

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 282 DAIGTKRYESNSGGEKEIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 341

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           DRK+ F  PD+  +  I  IHT  M++   +  + +     + +GA+++++CTEAG+ A+
Sbjct: 342 DRKILFENPDITTKRKIVGIHTSKMNLAEDVDLDNLVTSKDDLSGADIKAMCTEAGLLAL 401

Query: 428 RARRKVATEKDFLKAVDKVI 447
           R RR   T +DF +A ++V+
Sbjct: 402 RERRMQVTAQDFKEAKERVL 421

>KLTH0G16698g Chr7 complement(1451637..1452941,1453023..1453085)
           [1368 bp, 455 aa] {ON} highly similar to uniprot|P40327
           Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases
           of the 19S regulatory particle of the 26S proteasome
           involved in the degradation of ubiquitinated substrates
           required for normal peptide hydrolysis by the core 20S
           particle
          Length = 455

 Score =  264 bits (674), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 127/297 (42%), Positives = 190/297 (63%)

Query: 151 FVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGC 210
           F V +   V    +E G  V +      I   L    DP + +M +++ P   Y+D+GG 
Sbjct: 146 FYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDTDPMINVMKIDKSPTENYSDIGGL 205

Query: 211 KDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 270
           + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A+AVAN+T ATF+R+
Sbjct: 206 ESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRI 265

Query: 271 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTML 330
           +GSEL+QKY+G+G R+ R++F+ A      I+F DEI                E+QRTML
Sbjct: 266 VGSELIQKYLGDGPRLCRQIFKAAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 325

Query: 331 ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTK 390
           EL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  PD+  +  I  IHT 
Sbjct: 326 ELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDITTKRKILAIHTS 385

Query: 391 SMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVI 447
            M++   +  + +     + +GA+++++CTEAG+ A+R RR   T +DF +A ++++
Sbjct: 386 KMNLATDVDLDNLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTAEDFKQAKERIL 442

>ZYRO0F09900g Chr6 (804272..805576) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117W RPT5 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates recruited to the
           GAL1-10 promoter region upon induction of transcription
          Length = 434

 Score =  263 bits (671), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 135/308 (43%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 152 VVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCK 211
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TY+DVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILETLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 212 DQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 271
            QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFTDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 272 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLE 331
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 332 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 391
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF +P  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVVAATNRVDVLDPALLRSGRLDRKIEFPIPSEDSRAQILQIHSRK 367

Query: 392 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYK 451
           M+ +  I W+ ++R      GA+L++V  EAGM A+R  +     +DF++ + +V +  +
Sbjct: 368 MATDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVEGIGEVQA--R 425

Query: 452 KFSSTSRY 459
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON}
           (37962..39248) [1287 nt, 429 aa]
          Length = 428

 Score =  253 bits (647), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 133/278 (47%), Positives = 176/278 (63%), Gaps = 5/278 (1%)

Query: 168 MRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLS 227
           M V + R    +   LPP  D S+++M   EKPDVTY DVGG   Q +++RE VELPL+ 
Sbjct: 135 MSVALHRHSNALVDILPPDSDSSISIMGANEKPDVTYADVGGLDMQKQEIREAVELPLVQ 194

Query: 228 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 287
            + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RMV
Sbjct: 195 ADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRMV 254

Query: 288 RELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 347
           R++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 255 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKV 314

Query: 348 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISRL 406
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S +
Sbjct: 315 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLI 372

Query: 407 CPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 442
             N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 373 VRNDSLSGATIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>ZYRO0D11528g Chr4 (970060..971421) [1362 bp, 453 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 453

 Score =  253 bits (646), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 134/280 (47%), Positives = 176/280 (62%), Gaps = 5/280 (1%)

Query: 168 MRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLS 227
           M V + R    + + LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL  
Sbjct: 160 MSVALHRHSNALVVILPPDSDSSISIMNESEKPDVTYSDVGGLDIQKQEIREAVELPLTQ 219

Query: 228 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 287
            + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RMV
Sbjct: 220 ADLYQQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTSAAFIRVNGSEFVHKYLGEGPRMV 279

Query: 288 RELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 347
           R++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 280 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELMTQMDGFDQSTNVKV 339

Query: 348 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISRL 406
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S +
Sbjct: 340 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLI 397

Query: 407 CPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKAVD 444
             N   +GA + ++  EAG+ A+R  R V  + D  +A D
Sbjct: 398 IRNDSLSGAVIAAIMQEAGLRAVRRNRYVILQSDLEEAYD 437

>KLLA0C06534g Chr3 (572219..573505) [1287 bp, 428 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates
          Length = 428

 Score =  251 bits (641), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 170/262 (64%), Gaps = 3/262 (1%)

Query: 183 LPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 242
           LPP  D S+++M   EKPDVTY DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 150 LPPDSDSSISIMAANEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 209

Query: 243 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 302
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 210 LLYGPPGTGKTMLVKAVANATEAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSII 269

Query: 303 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 362
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 270 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 329

Query: 363 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 420
           RPGR+DRK+EF SL D   R  IF      MS+      + LI R  P S GA + ++  
Sbjct: 330 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEADLDSLIIRNDPLS-GALIAAIMQ 388

Query: 421 EAGMFAIRARRKVATEKDFLKA 442
           EAG+ A+R  R V  + D  +A
Sbjct: 389 EAGLRAVRKNRYVILQSDLEEA 410

>NCAS0A11980 Chr1 (2374708..2375988) [1281 bp, 426 aa] {ON}
           Anc_5.486
          Length = 426

 Score =  251 bits (641), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 176/279 (63%), Gaps = 5/279 (1%)

Query: 167 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLL 226
            M V + R    +   LPP  D S+++M   EKPDVTY DVGG   Q +++RE VELPL+
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 191

Query: 227 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 286
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RM
Sbjct: 192 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRM 251

Query: 287 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 346
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 347 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 405
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 369

Query: 406 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 442
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 370 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>NDAI0A04290 Chr1 complement(967063..968343) [1281 bp, 426 aa] {ON}
           Anc_5.486
          Length = 426

 Score =  251 bits (641), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 167 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLL 226
            M V + R    +   LPP  D S+++M   EKPDVTY DVGG   Q +++RE VELPL+
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISVMGSNEKPDVTYADVGGLDMQKQEIREAVELPLV 191

Query: 227 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 286
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 192 QGDLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 251

Query: 287 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 346
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 347 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 405
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTVASKMSL--APEADLDSL 369

Query: 406 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 442
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 370 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>Ecym_4548 Chr4 complement(1081534..1082811) [1278 bp, 425 aa] {ON}
           similar to Ashbya gossypii AFR394W
          Length = 425

 Score =  250 bits (639), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 172/262 (65%), Gaps = 3/262 (1%)

Query: 183 LPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 242
           LPP  D S++++   EKPDVTY DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISILGNNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 243 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 302
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 303 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 362
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRHDTLDPALL 326

Query: 363 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 420
           RPGR+DRK+EF SL D   R  IF      MS+   +  + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEVDLDSLIIRNDPLS-GALIAAIMQ 385

Query: 421 EAGMFAIRARRKVATEKDFLKA 442
           EAG+ A+R  R V  ++D  +A
Sbjct: 386 EAGLRAVRKNRYVILQRDLEEA 407

>Smik_4.668 Chr4 (1182472..1183758) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  250 bits (638), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 174/279 (62%), Gaps = 5/279 (1%)

Query: 167 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLL 226
            M V + R    +   LPP  D S+++M   EKPDVTY DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 227 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 286
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 287 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 346
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 347 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 405
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 406 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 442
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>YDR394W Chr4 (1261681..1262967) [1287 bp, 428 aa] {ON}  RPT3One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; substrate of N-acetyltransferase B
          Length = 428

 Score =  250 bits (638), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 174/279 (62%), Gaps = 5/279 (1%)

Query: 167 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLL 226
            M V + R    +   LPP  D S+++M   EKPDVTY DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 227 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 286
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 287 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 346
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 347 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 405
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 406 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 442
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>CAGL0K09526g Chr11 (939503..940798) [1296 bp, 431 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394w YTA2 26S proteasome regulatory subunit
          Length = 431

 Score =  249 bits (637), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 170/263 (64%), Gaps = 5/263 (1%)

Query: 183 LPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 242
           LPP  D S+++M   EKPDVTY DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 153 LPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGV 212

Query: 243 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 302
           LLYGPPGTGKT+  +AVAN T A FIRV GSE VQKY+GEG RMVR++F +AR     I+
Sbjct: 213 LLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVQKYLGEGPRMVRDVFRLARENSPSIV 272

Query: 303 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 362
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 273 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 332

Query: 363 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNS--TGAELRSVC 419
           RPGR+DRK+EF SL D   R  IF      MS+      +L S +  N   +GA + ++ 
Sbjct: 333 RPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSLIIRNDAISGAVIAAIM 390

Query: 420 TEAGMFAIRARRKVATEKDFLKA 442
            EAG+ A+R  R V  + D  +A
Sbjct: 391 QEAGLRAVRKNRYVILQSDLEEA 413

>Skud_4.668 Chr4 (1183563..1184849) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  249 bits (637), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 174/279 (62%), Gaps = 5/279 (1%)

Query: 167 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLL 226
            M V + R    +   LPP  D S+++M   EKPDVTY DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 227 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 286
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 287 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 346
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 347 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 405
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 406 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 442
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>TBLA0D01860 Chr4 complement(456813..458102) [1290 bp, 429 aa] {ON}
           Anc_5.486 YDR394W
          Length = 429

 Score =  249 bits (637), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 174/279 (62%), Gaps = 5/279 (1%)

Query: 167 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLL 226
            M V + R    +   LPP  D S++++   EKPDVTY DVGG   Q +++RE VELPL+
Sbjct: 135 SMSVALHRHSNALVDILPPDSDSSISILGSGEKPDVTYADVGGLDMQKQEIREAVELPLV 194

Query: 227 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 286
             + +  +GIDPP G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 195 QADLYEQIGIDPPSGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 254

Query: 287 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 346
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 255 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 314

Query: 347 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 405
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 315 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSL 372

Query: 406 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 442
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 373 IIRNDSLSGATIAAIMQEAGLRAVRKNRYVILQNDLEEA 411

>AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR394W (RPT3)
          Length = 472

 Score =  251 bits (640), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 131/259 (50%), Positives = 169/259 (65%), Gaps = 3/259 (1%)

Query: 183 LPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 242
           LPP  D S+++M   EKPDVTY DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 189 LPPDSDSSISIMGNNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 248

Query: 243 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 302
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 249 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 308

Query: 303 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 362
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 309 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRHDTLDPALL 368

Query: 363 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 420
           RPGR+DRK+EF SL D   R  IF      MS+   +  + LI R  P S GA + ++  
Sbjct: 369 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEVDLDSLIIRNDPLS-GALIAAIMQ 427

Query: 421 EAGMFAIRARRKVATEKDF 439
           EAG+ A+R  R V  + D 
Sbjct: 428 EAGLRAVRKNRYVILQSDL 446

>KAFR0E03580 Chr5 complement(720946..722223) [1278 bp, 425 aa] {ON}
           Anc_5.486 YDR394W
          Length = 425

 Score =  249 bits (635), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 174/279 (62%), Gaps = 5/279 (1%)

Query: 167 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLL 226
            M V + R    +   LPP  D S+++M   EKPDVTY DVGG   Q +++RE VELPL 
Sbjct: 131 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLT 190

Query: 227 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 286
             + +  +G+DPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 191 QADLYEQIGVDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 250

Query: 287 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 346
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 251 VRDVFRLARENAPAIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 310

Query: 347 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 405
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 311 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFSTIAGKMSL--APETDLDSL 368

Query: 406 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 442
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 369 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 407

>TPHA0J02860 Chr10 (633666..634961) [1296 bp, 431 aa] {ON} Anc_5.486
           YDR394W
          Length = 431

 Score =  249 bits (635), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 129/263 (49%), Positives = 172/263 (65%), Gaps = 5/263 (1%)

Query: 183 LPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 242
           LPP  D S+++M   EKPDV+Y+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 153 LPPDSDSSISIMGDNEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGV 212

Query: 243 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 302
           LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 213 LLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 272

Query: 303 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 362
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 273 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 332

Query: 363 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNS--TGAELRSVC 419
           RPGR+DRK+EF SL D   R  IF      MS+      +L S +  N   +GA + ++ 
Sbjct: 333 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLIVRNDSLSGAIIAAIM 390

Query: 420 TEAGMFAIRARRKVATEKDFLKA 442
            EAG+ A+R  R V  + D  +A
Sbjct: 391 QEAGLRAVRKNRYVILQSDLEEA 413

>SAKL0G03828g Chr7 (315123..316400) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 425

 Score =  248 bits (634), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 169/262 (64%), Gaps = 3/262 (1%)

Query: 183 LPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 242
           LPP  D S+++M   EKPDVTY DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMGSGEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 243 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 302
           LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTSAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSII 266

Query: 303 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 362
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 326

Query: 363 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 420
           RPGR+DRK+EF SL D   R  IF      MS+      + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDPLS-GALIAAIMQ 385

Query: 421 EAGMFAIRARRKVATEKDFLKA 442
           EAG+ A+R  R V  + D  +A
Sbjct: 386 EAGLRAVRKNRYVILQSDLEEA 407

>Suva_2.571 Chr2 (1012937..1014223) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  248 bits (633), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 174/279 (62%), Gaps = 5/279 (1%)

Query: 167 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLL 226
            M V + R    +   LPP  D S+++M   EKPDV+Y DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGESEKPDVSYADVGGLDMQKQEIREAVELPLV 193

Query: 227 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 286
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 287 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 346
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 347 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 405
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 406 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 442
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>KNAG0C04590 Chr3 complement(901771..903069) [1299 bp, 432 aa] {ON}
           Anc_5.486 YDR394W
          Length = 432

 Score =  248 bits (634), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 134/296 (45%), Positives = 180/296 (60%), Gaps = 5/296 (1%)

Query: 150 KFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGG 209
            +VV +   +    ++  M V + R    +   LPP  D S+ +M   EKPDVTY DVGG
Sbjct: 121 NYVVRILSTLDREQLKPSMSVALHRHSNALVDILPPDSDSSIAVMGENEKPDVTYADVGG 180

Query: 210 CKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 269
              Q +++RE VELPL   + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIR
Sbjct: 181 LDMQKQEIREAVELPLTQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIR 240

Query: 270 VIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTM 329
           V GSE V KY+GEG RMVR++F +AR     IIF DE+                EVQR +
Sbjct: 241 VNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRIL 300

Query: 330 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIH 388
           +EL+TQ+DGFD   N+KV+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   
Sbjct: 301 IELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTV 360

Query: 389 TKSMSVERGIRWELISRLCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 442
              M++      +L S +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 361 AAKMAL--APEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 414

>TDEL0A03500 Chr1 (623972..625252) [1281 bp, 426 aa] {ON} Anc_5.486
           YDR394W
          Length = 426

 Score =  240 bits (613), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 167 GMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLL 226
            M V + R    +   LPP  D S+++M+  EKPDVTY DVGG   Q +++RE VELPL 
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISIMSENEKPDVTYADVGGLDMQKQEIREAVELPLT 191

Query: 227 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 286
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RM
Sbjct: 192 QADLYQQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRM 251

Query: 287 VRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 346
           VR++F +AR     IIF DE+                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 347 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 405
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APETDLDSL 369

Query: 406 LCPNS--TGAELRSVCTEAGMFAIRARRKVATEKDFLKA 442
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 370 IIRNDSLSGATIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>KLTH0G02662g Chr7 (206550..207827) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 425

 Score =  238 bits (606), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 172/262 (65%), Gaps = 3/262 (1%)

Query: 183 LPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 242
           LPP  D S+++M+  EKPDV+Y+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMSANEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 243 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 302
           LLYGPPGTGKT+  +AVAN T+  FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNVAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 303 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 362
           F DE+                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSINVKVIMATNRADTLDPALL 326

Query: 363 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 420
           RPGR+DRK+EF SL D   R  IF      M++   +  + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTVAAKMALAPEVDLDSLIIRNDPLS-GALIAAIMQ 385

Query: 421 EAGMFAIRARRKVATEKDFLKA 442
           EAG+ A+R  R V  + D  +A
Sbjct: 386 EAGLRAVRKNRYVILQSDLEEA 407

>Kpol_1020.9 s1020 complement(19429..21867) [2439 bp, 812 aa] {ON}
           complement(19429..21867) [2439 nt, 813 aa]
          Length = 812

 Score =  207 bits (526), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           DV Y D+GGC+ Q+ ++RE+VELPL  P+ F T+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 202 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKTIGIKPPRGVLMYGPPGTGKTLMARAVA 261

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 262 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 317

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 318 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 377

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E I+       GA++ S+C+EA M  IR +
Sbjct: 378 GRLEVLRIHTKNMKLADDVDLESIAAETHGFVGADIASLCSEAAMQQIREK 428

 Score =  179 bits (453), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 90/251 (35%), Positives = 142/251 (56%), Gaps = 3/251 (1%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ D+GG  +   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 462 NPSALRETVVENVNVTWDDIGGLDEIKNELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 521

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 522 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 581

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 582 ---DSIAKARGNSQDNVGDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 638

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 639 DQLIYVPLPDETARLSILKAQLRKSPLEPGLDLNAIAKSTQGFSGADLSYIAQRAAKFAI 698

Query: 428 RARRKVATEKD 438
           +   +   E++
Sbjct: 699 KDSIQANIERE 709

>TBLA0J00640 Chr10 (149521..152079) [2559 bp, 852 aa] {ON} Anc_7.288
           YDL126C
          Length = 852

 Score =  207 bits (526), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           DV Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 214 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 273

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 274 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 329

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 330 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGVPDAA 389

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E+I+       GA++ S+C+EA M  IR +
Sbjct: 390 GRLEVLRIHTKNMKLSDDVDLEVIASETHGFVGADIASLCSEAAMQQIREK 440

 Score =  182 bits (461), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 136/241 (56%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ D+GG  D   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 474 NPSALRETVVENVNVTWDDIGGLDDIKNELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 533

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 534 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 593

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 594 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 653

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 654 DQLIYVPLPDEVARESILSAQLRKSPIEPGVDLTAIAKATKGFSGADLSYIAQRAAKFAI 713

Query: 428 R 428
           +
Sbjct: 714 K 714

>TDEL0H01560 Chr8 complement(267940..270456) [2517 bp, 838 aa] {ON}
           Anc_7.288 YDL126C
          Length = 838

 Score =  206 bits (524), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           DV Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 210 DVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 269

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLAEDVDLESLASETHGYVGADIASLCSEAAMQQIREK 436

 Score =  183 bits (465), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 97/272 (35%), Positives = 150/272 (55%), Gaps = 4/272 (1%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ D+GG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I +   +   +E G+    IS+     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSIMKAQLRKAPLEPGLDLNAISKATQGFSGADLSYIVQRAAKFAI 709

Query: 428 R----ARRKVATEKDFLKAVDKVISGYKKFSS 455
           +    A+R++  +K      D  + G  K  S
Sbjct: 710 KDSIEAQRQLEAKKAVKNEEDVEMDGETKQDS 741

>NCAS0E03580 Chr5 (711229..713034) [1806 bp, 601 aa] {ON} Anc_7.288
          Length = 601

 Score =  202 bits (514), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           DV Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 43  DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 102

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 103 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 158

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN +DPAL R GR DR+V+  +PD  
Sbjct: 159 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNAIDPALRRFGRFDREVDIGIPDAV 218

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  I RIHTK+M +   +  E ++       G+++ S+C+EA M  IR +
Sbjct: 219 GRLEILRIHTKNMKLADDVDLEYLANETHGYVGSDVASLCSEAAMQQIREK 269

 Score =  178 bits (452), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 90/250 (36%), Positives = 142/250 (56%), Gaps = 1/250 (0%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 303 NPSALRETVVESVNVTWEDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 362

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 363 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 422

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 423 -DSIAKARGGSMGEGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 481

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I     ++  +E G+   LI++     +GA+L  +   A  FAI
Sbjct: 482 DQLIYVPLPDEVARLSILHAQLRNTPLEPGLDLSLIAKASQGFSGADLSYIVQRAAKFAI 541

Query: 428 RARRKVATEK 437
           +   +   E+
Sbjct: 542 KESIEAQVER 551

>TBLA0C04840 Chr3 (1172444..1174987) [2544 bp, 847 aa] {ON}
           Anc_7.288 YDL126C
          Length = 847

 Score =  205 bits (522), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           D+ Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 217 DIGYDDIGGCRKQMAQIREMVELPLRHPQLFKAVGIKPPRGVLIYGPPGTGKTLMARAVA 276

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 277 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 332

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 333 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGVPDAT 392

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E+I+       GA++ S+C+EA M  IR +
Sbjct: 393 GRLEVLRIHTKNMKLSDDVDLEVIASETHGFVGADIASLCSEAAMQQIREK 443

 Score =  180 bits (457), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 139/241 (57%), Gaps = 2/241 (0%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ D+GG  D   +LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 477 NPSALRETVVENVNVTWDDIGGLDDIKSELRETVEYPVLHPDQYTKFGLAPSKGVLFYGP 536

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 537 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 596

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                          ++  R + +L+T++DG + + N+ V+ ATNRP+ LDPA+LRPGR+
Sbjct: 597 DSIAKARGHNAGDDASD--RVVNQLLTEMDGMNAKKNVFVIGATNRPDQLDPAILRPGRL 654

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 655 DQLIYVPLPDEVARLSILKAQLRKSPLEPGVDLTAIAKATKGFSGADLSYIAQRAAKYAI 714

Query: 428 R 428
           +
Sbjct: 715 K 715

>Kpol_2000.15 s2000 complement(25249..27720) [2472 bp, 823 aa] {ON}
           complement(25249..27720) [2472 nt, 824 aa]
          Length = 823

 Score =  204 bits (520), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           DV Y D+GGC+ Q+ ++RE+VELPL  P+ F T+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 209 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKTIGIKPPRGVLMYGPPGTGKTLMARAVA 268

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 269 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 324

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 325 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 384

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 385 GRLEVLRIHTKNMKLVDDVDLESLAAETHGYVGADIASLCSEAAMQQIREK 435

 Score =  182 bits (461), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 92/254 (36%), Positives = 144/254 (56%), Gaps = 3/254 (1%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ D+GG +D   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 469 NPSALRETVVESVNVTWDDIGGLEDIKNELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 528

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 529 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 588

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 589 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 648

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 649 DQLIYVPLPDEPARLSILNAQLRKTPLEPGLDLGAIAKTTQGFSGADLSYIVQRAAKFAI 708

Query: 428 RAR---RKVATEKD 438
           +     ++V +E+D
Sbjct: 709 KESIEAQRVKSEED 722

>KLLA0F05676g Chr6 complement(553406..555898) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126C CDC48 ATPase in ER nuclear membrane
           and cytosol with homology to mammalian p97 in a complex
           with Npl4p and Ufd1p participates in retrotranslocation
           of ubiquitinated proteins from the ER into the cytosol
           for degradation by the proteasome
          Length = 830

 Score =  204 bits (520), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PPKGIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVA 269

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R NI V+ ATNRPN++DPAL R GR DR+V+  +PD+ 
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGVPDVT 385

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEKLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  182 bits (462), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 140/241 (58%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKDELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD  GR +I     ++  +E G+  + I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDETGRLSILSAQLRNTPLEPGLDLKTIAQATQGFSGADLLYIVQRAAKFAI 709

Query: 428 R 428
           +
Sbjct: 710 K 710

>SAKL0F09834g Chr6 (753930..756458) [2529 bp, 842 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 842

 Score =  204 bits (520), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PPKGIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVA 269

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPSIIFIDEI----DSIAPKRDK 325

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R NI V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  183 bits (464), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 145/255 (56%), Gaps = 4/255 (1%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ D+GG     E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDGIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I +   ++  +E G+    IS+     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDDTARLSILKAQLRNTPLEPGLDLGAISKATQGFSGADLSYIAQRAAKFAI 709

Query: 428 R----ARRKVATEKD 438
           +    A+R+   E++
Sbjct: 710 KDSIEAQRRAQIERE 724

>KLTH0A05324g Chr1 (442339..444837) [2499 bp, 832 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 832

 Score =  204 bits (520), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+GIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVA 269

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  184 bits (467), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 94/262 (35%), Positives = 147/262 (56%), Gaps = 5/262 (1%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ D+GG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSILNAQLRNTPLEPGLELSTIAKATQGFSGADLSYIVQRAAKFAI 709

Query: 428 R-----ARRKVATEKDFLKAVD 444
           +      RR +A ++  +K  D
Sbjct: 710 KDSIEAQRRALAEQQSRVKTED 731

>NCAS0A13760 Chr1 (2701600..2704077) [2478 bp, 825 aa] {ON} 
          Length = 825

 Score =  204 bits (519), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 270

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E I+       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEVLRIHTKNMKLADDVDLEYIASETHGYVGADIASLCSEAAMQQIREK 437

 Score =  181 bits (458), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 139/241 (57%), Gaps = 2/241 (0%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDIGGLDEIKQELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 530

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARASAPTVVFLDEL 590

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 --DSIAKARGNSAGDNGSDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 648

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 649 DQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLNAIAKAAQGFSGADLSYIVQRAAKFAI 708

Query: 428 R 428
           +
Sbjct: 709 K 709

>NDAI0A03040 Chr1 complement(680017..682545) [2529 bp, 842 aa] {ON} 
          Length = 842

 Score =  204 bits (519), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           DV Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 216 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 275

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 276 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 331

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 332 TNGEVERRVVSQLLTLMDGMKTRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAV 391

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  I RIHTK+M +   +  E ++       G+++ S+C+EA M  IR +
Sbjct: 392 GRLEILRIHTKNMKLSDDVDLEYLANETHGYVGSDVASLCSEAAMQQIREK 442

 Score =  185 bits (469), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 92/250 (36%), Positives = 142/250 (56%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 476 NPSALRETVVESVNVTWEDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 535

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 536 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 595

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 596 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNTKKNVFVIGATNRPDQIDPAILRPGRL 655

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I R   +   +E G+  E I++     +GA+L  +   A  FAI
Sbjct: 656 DQLIYVPLPDEIARLSILRAQLRKTPLEPGLELEAIAKASQGFSGADLSYIVQRAAKFAI 715

Query: 428 RARRKVATEK 437
           +   +   EK
Sbjct: 716 KESIEAQKEK 725

>KNAG0B02940 Chr2 complement(564664..567180) [2517 bp, 838 aa] {ON}
           Anc_7.288 YDL126C
          Length = 838

 Score =  204 bits (519), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           DV Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  179 bits (455), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 138/241 (57%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILGAQLRNTPLEPGLDLTAIAKATTGFSGADLSYIAQRAAKYAI 709

Query: 428 R 428
           +
Sbjct: 710 K 710

>NDAI0A02280 Chr1 complement(512577..515054) [2478 bp, 825 aa] {ON}
           Anc_7.288
          Length = 825

 Score =  203 bits (517), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 209 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 268

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 269 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 324

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 325 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 384

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 385 GRLEVLRIHTKNMKLADDVDLEYLANETHGYVGADIASLCSEAAMQQIREK 435

 Score =  185 bits (469), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 142/241 (58%), Gaps = 2/241 (0%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ D+GG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 469 NPSALRETVVESVNVTWNDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 528

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 529 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 588

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                          ++  R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 589 DSIAKARGNSMGDGGSD--RVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 646

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD E R +I R   +   +E G+  E I++     +GA+L  +   A  FAI
Sbjct: 647 DQLIYVPLPDEEARLSILRAQLRKTPLEPGLELEAIAKASQGFSGADLSYIVQRAAKFAI 706

Query: 428 R 428
           +
Sbjct: 707 K 707

>Smik_4.111 Chr4 complement(212808..215315) [2508 bp, 835 aa] {ON}
           YDL126C (REAL)
          Length = 835

 Score =  203 bits (517), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  181 bits (458), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ DVGG  +  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKDELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 428 R----ARRKVATEKD 438
           +    A R+   EK+
Sbjct: 710 KDSIEAHRQHEAEKE 724

>Kwal_23.5996 s23 (1408496..1410991) [2496 bp, 831 aa] {ON} YDL126C
           (CDC48) - microsomal ATPase [contig 12] FULL
          Length = 831

 Score =  203 bits (516), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+GIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVA 269

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  182 bits (461), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 138/241 (57%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ D+GG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSILNAQLRNTPLEPGLELTSIAKATQGFSGADLSYIVQRAAKFAI 709

Query: 428 R 428
           +
Sbjct: 710 K 710

>Ecym_8037 Chr8 (84479..86989) [2511 bp, 836 aa] {ON} similar to
           Ashbya gossypii AFR158W
          Length = 836

 Score =  203 bits (516), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 270

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  I  IHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEILHIHTKNMRLADDVNLETLAAETHGYVGADIASLCSEAAMQQIREK 437

 Score =  187 bits (476), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 145/254 (57%), Gaps = 4/254 (1%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ DVGG  D   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKFGLSPSKGVLFYGP 530

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 590

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 650

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD  GR +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 651 DQLIYVPLPDEVGRISILKAQLRKAPLEPGLDLTAIAKATQGFSGADLSYIVQRAAKFAI 710

Query: 428 R----ARRKVATEK 437
           R    A+++ A EK
Sbjct: 711 RDSIEAQKRSAAEK 724

>KAFR0L01190 Chr12 (222427..224901) [2475 bp, 824 aa] {ON} Anc_7.288
           YDL126C
          Length = 824

 Score =  202 bits (515), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  I RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEILRIHTKNMKLADDVDLETLAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  184 bits (468), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 138/241 (57%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ DVGG  D  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDDIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I     ++  +E G+    IS+     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILNAQLRNTPLEPGLDLSAISKATQGFSGADLSYIVQRAAKYAI 709

Query: 428 R 428
           +
Sbjct: 710 K 710

>Suva_4.119 Chr4 complement(224752..227262) [2511 bp, 836 aa] {ON}
           YDL126C (REAL)
          Length = 836

 Score =  202 bits (515), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  182 bits (461), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGMELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 428 R----ARRKVATEKD 438
           +    A R+   EK+
Sbjct: 710 KDSIEAHRQREAEKE 724

>Skud_4.129 Chr4 complement(231893..234400) [2508 bp, 835 aa] {ON}
           YDL126C (REAL)
          Length = 835

 Score =  202 bits (515), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  181 bits (459), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 137/241 (56%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 428 R 428
           +
Sbjct: 710 K 710

>YDL126C Chr4 complement(236157..238664) [2508 bp, 835 aa] {ON}
           CDC48AAA ATPase involved in multiple processes; subunit
           of a polyubiquitin-selective segregase complex involved
           in ERAD, cell wall integrity during heat stress and
           mitotic spindle disassembly; subunit of a complex
           involved in mitochondria-associated degradation; role in
           mobilizing membrane bound transcription factors by
           regulated ubiquitin/proteasome-dependent processing;
           roles in macroautophagy, PMN, ribophagy, and homotypic
           ER membrane fusion; functional ortholog of p97/VCP
          Length = 835

 Score =  202 bits (515), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  182 bits (462), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 93/255 (36%), Positives = 143/255 (56%), Gaps = 4/255 (1%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 428 R----ARRKVATEKD 438
           +    A R+   EK+
Sbjct: 710 KDSIEAHRQHEAEKE 724

>AFR158W Chr6 (720212..722710) [2499 bp, 832 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL126C (CDC48)
          Length = 832

 Score =  202 bits (515), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 270

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  I  IHTK+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEILNIHTKNMRLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 437

 Score =  186 bits (471), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 138/241 (57%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ DVGG  D   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKFGLSPSKGVLFYGP 530

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 590

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 650

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD  GR +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 651 DQLIYVPLPDEAGRMSILKAQLRKAPLEPGLDLGAIAKATQGFSGADLSYIVQRAAKFAI 710

Query: 428 R 428
           R
Sbjct: 711 R 711

>CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa]
           {ON} highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126c CDC48
          Length = 830

 Score =  202 bits (515), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  181 bits (458), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 138/241 (57%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLTAIAKATQGFSGADLSYIVQRAAKYAI 709

Query: 428 R 428
           +
Sbjct: 710 K 710

>ZYRO0C09262g Chr3 (703476..705968) [2493 bp, 830 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 830

 Score =  202 bits (514), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  183 bits (464), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 145/255 (56%), Gaps = 4/255 (1%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +V++ DVGG ++  E+LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVSWADVGGLEEIKEELRETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNTKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD   R  I +   +   +E G+    ++++    +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEAARLGIMKAQLRKTPLEPGLELSQLAKVTQGFSGADLSYIVQRAAKFAI 709

Query: 428 R----ARRKVATEKD 438
           +    A R+   +K+
Sbjct: 710 KDSIEAHRQAEAKKE 724

>TPHA0A03260 Chr1 complement(718294..720774) [2481 bp, 826 aa] {ON}
           Anc_7.288 YDL126C
          Length = 826

 Score =  201 bits (511), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 142/231 (61%), Gaps = 5/231 (2%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V Y D+GGC+ Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAVGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 261 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX 320
           N T A F  + G E++ K  GE    +R+ FE A      IIF DEI             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 321 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 380 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  + RIHTK+M +   +  E ++       GA++ S+C+E  M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLSDDVDLETLAAETHGYVGADIASLCSEGAMQQIREK 436

 Score =  180 bits (457), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 138/241 (57%), Gaps = 3/241 (1%)

Query: 188 DPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 247
           +PS    TV E  +VT+ D+GG  +   +LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKRELRETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 248 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 307
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 308 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 367
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 ---DSIAKARGNSQDNVGDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 646

Query: 368 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           D+ +   LPD  GR +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 647 DQLIYVPLPDEVGRLSILEAQLRKSPLEPGLDLRAIAKASQGFSGADLSYIAQRAAKFAI 706

Query: 428 R 428
           +
Sbjct: 707 K 707

>NCAS0E04050 Chr5 (792784..796773) [3990 bp, 1329 aa] {ON} Anc_5.34
          Length = 1329

 Score =  194 bits (494), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 108/279 (38%), Positives = 159/279 (56%), Gaps = 25/279 (8%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++ + DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 393 NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 452

Query: 261 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 453 ASCSSDTRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 512

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 513 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 569

Query: 376 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 427
           PDL+ RA I +IHTK  +      + E +++L     GA+LR++CTEA +F+I       
Sbjct: 570 PDLKARAKILQIHTKKWNPPLDPEFIENLAKLTKGYGGADLRALCTEAALFSIQRKFPQI 629

Query: 428 -RARRKVATE--------KDFLKAVDKVISGYKKFSSTS 457
            R+  K+  +         DF+ A++K++    + S  S
Sbjct: 630 YRSSEKLQVDPKLVRVHTTDFMLALEKIVPSSARSSGNS 668

>KAFR0D01900 Chr4 complement(382890..386675) [3786 bp, 1261 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1261

 Score =  194 bits (493), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 107/279 (38%), Positives = 155/279 (55%), Gaps = 25/279 (8%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++++ DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 347 NISFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLVARALA 406

Query: 261 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 407 ASCSSDSKKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 466

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  T+L L   +DG D RG + V+ ATNRP+ LDPAL RPGR DR+  F L
Sbjct: 467 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDALDPALRRPGRFDREFYFPL 523

Query: 376 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR------ 428
           PD + RA I +IHTK+        + E + ++     GA+LR++CTEA +F I+      
Sbjct: 524 PDSKARAKILKIHTKNWHPSLSDEFIENLVKMTKGYGGADLRALCTEAALFCIQRKFPQI 583

Query: 429 ----------ARRKVATEKDFLKAVDKVISGYKKFSSTS 457
                      R    T  DF+ A+DK++    + S  +
Sbjct: 584 YRSDEKLMVNPRHLRVTLNDFILALDKIVPSSARSSGNT 622

>ZYRO0D07414g Chr4 complement(643893..648155) [4263 bp, 1420 aa]
           {ON} similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270W YTA7 Protein of unknown function member of
           CDC48/PAS1/SEC18 family of ATPases potentially
           phosphorylated by Cdc28p
          Length = 1420

 Score =  192 bits (488), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 157/269 (58%), Gaps = 25/269 (9%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V + DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 432 NVKFEDVGGLDNYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 491

Query: 261 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
               +     TF    G++++ K+VGE  R +R LFE A+ ++  +IFFDEI        
Sbjct: 492 ASCSSEGRKITFFMRKGADVLSKWVGEAERQLRLLFEEAKKQQPSVIFFDEIDGLAPVRS 551

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 552 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 608

Query: 376 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 427
           PD+ GR  I +IHTK+      +++ + ++ L     GA+LR++CTEA + +I       
Sbjct: 609 PDVRGREKIIKIHTKNWKPPLSVKFVQNLATLTKGFGGADLRALCTEAALLSIQRQYPQI 668

Query: 428 -RARRKVATE--------KDFLKAVDKVI 447
            R+  K+A +        KDF+ A+ K++
Sbjct: 669 YRSNEKLAVDPNKVKVGVKDFMMALKKIV 697

>TDEL0G00590 Chr7 complement(120616..124500) [3885 bp, 1294 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1294

 Score =  191 bits (485), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 100/234 (42%), Positives = 142/234 (60%), Gaps = 9/234 (3%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 372 NVKFGDIGGLDNFIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 431

Query: 261 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 432 ASCSSEGHKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPAIIFFDEIDGLAPVRS 491

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 492 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 548

Query: 376 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 428
           P+LE RA I RIHTKS        + + ++ L     GA+LR++CTEA + +I+
Sbjct: 549 PNLESRAQILRIHTKSWKTSLSDDFVKHLALLTKGYGGADLRALCTEAALLSIQ 602

>NDAI0B00780 Chr2 complement(178836..182882) [4047 bp, 1348 aa] {ON}
           Anc_5.34
          Length = 1348

 Score =  191 bits (484), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 106/279 (37%), Positives = 159/279 (56%), Gaps = 25/279 (8%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++++ DVGG  + I++L+E+V LPLL PE + T  I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 411 NISFDDVGGLDNYIDQLKEMVALPLLYPELYQTFNITPPRGVLFHGPPGTGKTLMARALA 470

Query: 261 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 471 ASCSSDSQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 530

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 531 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 587

Query: 376 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 427
           PD + R+ I +IHTK  +      + + ++ L     GA+LR++CTEA +F I       
Sbjct: 588 PDEKARSKILKIHTKKWNPPLSDDFIDNLATLTKGYGGADLRALCTEAALFCIQRKFPQI 647

Query: 428 -RARRKV--------ATEKDFLKAVDKVISGYKKFSSTS 457
            R+  K+         T  DF+ A++K++    + + +S
Sbjct: 648 YRSNEKLLVDPKDLKVTPTDFMLALEKIVPSSARSTGSS 686

>Kwal_47.18848 s47 complement(997574..998479) [906 bp, 302 aa] {OFF}
           YDR394W (RPT3) - ATPase (AAA family) component of the
           26S proteasome complex [contig 189] PARTIAL
          Length = 302

 Score =  179 bits (453), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 82/156 (52%), Positives = 108/156 (69%)

Query: 183 LPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGI 242
           LPP  D S+++M   EKPDV+Y+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMGANEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYRQIGIDPPRGV 206

Query: 243 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 302
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 303 FFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 338
           F DE+                EVQR ++EL+TQ+DG
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDG 302

>Ecym_4769 Chr4 complement(1496524..1500543) [4020 bp, 1339 aa] {ON}
           similar to Ashbya gossypii ABR139W
          Length = 1339

 Score =  189 bits (481), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 107/269 (39%), Positives = 152/269 (56%), Gaps = 27/269 (10%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 419 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 478

Query: 261 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
                ++   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 479 VSCSTDKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 538

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 539 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 595

Query: 376 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRARR--- 431
           PD   RA I  IHTK  +      + E ++ L     GA+LR++CTEA + +I+ +    
Sbjct: 596 PDTSARAKILEIHTKKWNPPLPKEFIEKLASLTKGYGGADLRALCTEAALVSIQRKFPQI 655

Query: 432 --------------KVATEKDFLKAVDKV 446
                         KV T KDF+ A+DK+
Sbjct: 656 YQSESKLVINPKDVKVKT-KDFMAAMDKI 683

>TPHA0L02210 Chr12 (459500..463702) [4203 bp, 1400 aa] {ON} Anc_5.34
           YGR270W
          Length = 1400

 Score =  189 bits (480), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 155/270 (57%), Gaps = 27/270 (10%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++ + DVGG  + I++L+E++ LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 429 NINFDDVGGLDNYIDQLKEMITLPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 488

Query: 261 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 489 ASCSSDTRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 548

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 549 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 605

Query: 376 PDLEGRANIFRIHTKSMS--VERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR--- 430
           PD++ RA I  IHT+  +  +++ +  +L + L     GA+LR++CTEA + +I+ +   
Sbjct: 606 PDIDARAKILEIHTRKWNPPLQKPVILQL-ANLTKGYGGADLRALCTEAALISIQHKYPQ 664

Query: 431 -------------RKVATEKDFLKAVDKVI 447
                        +   +  DF+ A++K++
Sbjct: 665 IYRSNDKLDVDPSKITVSTSDFMLALEKIV 694

>KLTH0B09130g Chr2 (742805..746806) [4002 bp, 1333 aa] {ON} similar
           to uniprot|P40340 Saccharomyces cerevisiae YGR270W YTA7
           Protein of unknown function member of CDC48/PAS1/SEC18
           family of ATPases potentially phosphorylated by Cdc28p
          Length = 1333

 Score =  189 bits (479), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 158/289 (54%), Gaps = 45/289 (15%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++ + DVGG  + I++L+E+V LPLL PE +   GI PP+G+L +GPPGTGKTL ARA+A
Sbjct: 405 NIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTLMARALA 464

Query: 261 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
                 +   TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 465 ASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 524

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 525 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFFFPL 581

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWE------LISRLCPNST---GAELRSVCTEAGMFA 426
           PDL  R+ I  IHTK        +W+       I RL   +    GA+LR++CTEA + +
Sbjct: 582 PDLSARSKILEIHTK--------KWDPPLPKPFIDRLASLTKGYGGADLRALCTEAALIS 633

Query: 427 IRARRKV------------------ATEKDFLKAVDKVISGYKKFSSTS 457
           I  +RKV                     +DF+ A++K++    + +  S
Sbjct: 634 I--QRKVPQIYQSEMKLSINLASVNVKARDFMMALEKIVPSSARSAGNS 680

>SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa]
           {ON} similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270W YTA7 Protein of unknown function member of
           CDC48/PAS1/SEC18 family of ATPases potentially
           phosphorylated by Cdc28p
          Length = 1337

 Score =  189 bits (479), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 156/269 (57%), Gaps = 25/269 (9%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++++ +VGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 387 NISFENVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 446

Query: 261 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 447 ASCSTEQRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 506

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 507 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 563

Query: 376 PDLEGRANIFRIHTKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMFAI------- 427
           PDL+ R+ I +IHTK        +  E ++ L     GA+LR++CTEA + +I       
Sbjct: 564 PDLKARSKILQIHTKEWKPPLSQVFVEKLASLTKGYGGADLRALCTEAALISIQRKFPQI 623

Query: 428 -RARRKVATE--------KDFLKAVDKVI 447
            ++  K++ +        +DF+ A+DK+I
Sbjct: 624 YQSNLKLSIDPKDVKVKARDFMIALDKII 652

>Kpol_513.19 s513 (53678..57811) [4134 bp, 1377 aa] {ON}
           (53678..57811) [4134 nt, 1378 aa]
          Length = 1377

 Score =  189 bits (479), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 101/235 (42%), Positives = 145/235 (61%), Gaps = 11/235 (4%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           D+ + +VGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 436 DINFEEVGGLDNYIDQLKEMVTLPLLYPEVYQNFNITPPRGVLFHGPPGTGKTLMARALA 495

Query: 261 ------NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXX 314
                 NR    F+R  G++++ K+VGE  R +R LFE A+ ++  IIFFDEI       
Sbjct: 496 ASCSTGNRKITFFMRK-GADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVR 554

Query: 315 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 374
                   + +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F 
Sbjct: 555 SSKQEQIHSSIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFP 611

Query: 375 LPDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 428
           LPD++ R+ I  IHTK  +     +  + ++RL     GA+LRS+CTEA + +I+
Sbjct: 612 LPDVKARSIILGIHTKKWNPPPNKKLIDDLARLTKGYGGADLRSLCTEAALISIQ 666

>TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1426

 Score =  188 bits (478), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 154/269 (57%), Gaps = 25/269 (9%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++ + DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 436 NINFDDVGGLDNYIDQLKEMVSLPLLYPELYQNFNISPPRGVLFHGPPGTGKTLMARALA 495

Query: 261 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 496 ASCSSDDRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKNQPSIIFFDEIDGLAPVRS 555

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 556 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 612

Query: 376 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 427
           PDLE R  I  IHTK  +      + + ++RL     GA+LR++CT+A + +I       
Sbjct: 613 PDLEAREKIIGIHTKKWNPPLSSEFRKTLARLTKGFGGADLRALCTDAVLISIQRQYPQI 672

Query: 428 -RARRKVATE--------KDFLKAVDKVI 447
            R+ +K+  +         DF+ A++K+I
Sbjct: 673 YRSNKKLKIDPTSVKININDFMIALEKLI 701

>KNAG0K00280 Chr11 complement(43553..47779) [4227 bp, 1408 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1408

 Score =  188 bits (478), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 154/271 (56%), Gaps = 29/271 (10%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++ + DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 445 NINFNDVGGLDSYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 504

Query: 261 ------NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXX 314
                 NR    F+R  G++++ K+VGE  R +R LFE A+ ++  IIFFDEI       
Sbjct: 505 ASCSTENRKITFFMRK-GADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVR 563

Query: 315 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 374
                     +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F 
Sbjct: 564 SSKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFP 620

Query: 375 LPDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------ 427
           LPD + RA I  IHTK         + + ++RL     GA+LRS+CTEA +  I      
Sbjct: 621 LPDEKARARILTIHTKKWDPPLTEEFLQNLARLTKGYGGADLRSLCTEAALLCIQRNFPQ 680

Query: 428 -----------RARRKVATEKDFLKAVDKVI 447
                      +++ KV T KDF+ A+ K++
Sbjct: 681 IYRSDEKLVVDKSKLKVNT-KDFILALQKIV 710

>CAGL0G00528g Chr7 complement(54617..58570) [3954 bp, 1317 aa] {ON}
           similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270w YTA7
          Length = 1317

 Score =  188 bits (477), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 102/236 (43%), Positives = 141/236 (59%), Gaps = 13/236 (5%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++ + DVGG  + IE+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 392 NIKFDDVGGLDNYIEQLKEMVSLPLLYPEVYQKFNITPPRGVLFHGPPGTGKTLMARALA 451

Query: 261 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 452 ASCSSESRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 511

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 512 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 568

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST---GAELRSVCTEAGMFAIR 428
           PD   R  I +IHTK  S    +  ELI RL   +    GA+LR++CTEA + +I+
Sbjct: 569 PDTNARKTILKIHTKKWSPP--LSDELIHRLASLTKGYGGADLRALCTEAALSSIQ 622

>KLLA0A09823g Chr1 (858458..862417) [3960 bp, 1319 aa] {ON} similar
           to uniprot|P40340 Saccharomyces cerevisiae YGR270W YTA7
           Protein of unknown function member of CDC48/PAS1/SEC18
           family of ATPases potentially phosphorylated by Cdc28p
          Length = 1319

 Score =  187 bits (476), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 101/236 (42%), Positives = 141/236 (59%), Gaps = 13/236 (5%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++ + DVGG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 400 NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 459

Query: 261 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 460 ASCSNEKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPAIIFFDEIDGLAPVRS 519

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  TML L   +DG D RG I ++ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 520 SKQEQIHASIVSTMLAL---MDGMDNRGQIIIIGATNRPDAVDPALRRPGRFDREFYFPL 576

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST---GAELRSVCTEAGMFAIR 428
           PDL+ R  I  IHTK  +    I  + IS+L   +    GA+LR++CTEA + +I+
Sbjct: 577 PDLKARDKILHIHTKKWNPP--ISDQFISKLASLTKGYGGADLRALCTEASLISIQ 630

>ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR270W (YTA7)
          Length = 1270

 Score =  187 bits (476), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 99/236 (41%), Positives = 139/236 (58%), Gaps = 9/236 (3%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L YGPPGTGKTL ARA+A
Sbjct: 366 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFYGPPGTGKTLMARALA 425

Query: 261 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 426 ASCSTEKRKITFYMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 485

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 486 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 542

Query: 376 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           PD+  RA I  IHT+         + E ++ L     GA+LR++CTEA + +I+ R
Sbjct: 543 PDIRARAKILEIHTRKWHPPVSSAFIEKLASLTKGYGGADLRALCTEAALNSIQRR 598

>Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}
           complement(51934..54285) [2352 nt, 784 aa]
          Length = 783

 Score =  186 bits (471), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 100/261 (38%), Positives = 143/261 (54%), Gaps = 7/261 (2%)

Query: 172 VDRSKYHIELP----LPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLS 227
           +DRSK  + L         I PS       E P V ++D+GG  D   K++EV++LPL +
Sbjct: 480 IDRSKLQVTLKDVENAMAEIRPSAMREIFLEMPKVYWSDIGGQDDLKRKMKEVIQLPLEA 539

Query: 228 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 287
            E FA LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +
Sbjct: 540 AETFANLGVSAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAI 599

Query: 288 RELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 347
           RE+F  AR     IIFFDEI                     +  L+ ++DG +    + +
Sbjct: 600 REIFRKARAASPSIIFFDEIDAISAARDGGSSTAA--ASHVLTSLLNEIDGVEELNGVVI 657

Query: 348 MFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVE-RGIRWELISRL 406
           + ATNRP+ +DPALLRPGR+DR +  + PD E R  I +  T   ++E   +  E +++ 
Sbjct: 658 VAATNRPDEIDPALLRPGRLDRHIYVAPPDYEARLQILKKRTGKFNLEGSNVNLEELAKH 717

Query: 407 CPNSTGAELRSVCTEAGMFAI 427
               +GAE+  +C EAG+ AI
Sbjct: 718 TEGCSGAEVVLLCQEAGLAAI 738

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 135/230 (58%), Gaps = 8/230 (3%)

Query: 204 YTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRT 263
           Y DVGG K +I+ L + +ELPL  P  F+  GI+PP+G+LL+GPPGTGKT+  R VAN +
Sbjct: 245 YNDVGGLKREIDSLTKTIELPLHQPNLFSDFGINPPRGVLLHGPPGTGKTMLLRCVANSS 304

Query: 264 DATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN 323
           +A  + + G  +V KY+GE    +RE+F+ A+  +  IIF DEI                
Sbjct: 305 NAHVLTINGPSIVSKYLGETEAKLREIFDEAQKYQPSIIFIDEI---DSLAPNRANDDSG 361

Query: 324 EVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRA 382
           EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ R 
Sbjct: 362 EVESRVVATLLTLMDGMGGSGRLVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDVDARF 421

Query: 383 NIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 428
           +I +     MS ER    E     I+       GA+L ++C E+ M  I+
Sbjct: 422 DILKKQFSRMSEERHTLNEDDIKNIASKTHGYVGADLSALCRESVMKTIQ 471

>Smik_16.38 Chr16 complement(65946..70115) [4170 bp, 1389 aa] {ON}
           YGR270W (REAL)
          Length = 1389

 Score =  186 bits (473), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 141/234 (60%), Gaps = 9/234 (3%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 415 NIDFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 474

Query: 261 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 475 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 534

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 535 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 591

Query: 376 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 428
           PD++ R+ I +I T+  S    I + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 592 PDVKARSKILQIQTRKWSAPLSINFIDKLAFLTKGYGGADLRSLCTEAALISIQ 645

>Skud_7.603 Chr7 (1001881..1006041) [4161 bp, 1386 aa] {ON} YGR270W
           (REAL)
          Length = 1386

 Score =  186 bits (472), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 95/234 (40%), Positives = 141/234 (60%), Gaps = 9/234 (3%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 413 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 472

Query: 261 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
               +     TF    G++++ K+VGE  R +R LFE A+  +  +IFFDEI        
Sbjct: 473 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSVIFFDEIDGLAPVRS 532

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 533 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 589

Query: 376 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 428
           PD++ R+ I +I TK  S    + + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 590 PDVKARSKILQIQTKKWSSPLSVNFVDKLAILTKGYGGADLRSLCTEAALISIQ 643

>ZYRO0D15290g Chr4 complement(1283982..1286165) [2184 bp, 727 aa]
           {ON} similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017C AFG3 Component with Yta12p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 727

 Score =  184 bits (466), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 147/264 (55%), Gaps = 12/264 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V++ DV GC +  +++ E V   L  PE++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 251 VSFQDVAGCNEAKQEIMEFVHF-LKKPEKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 309

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
                F+ V GSE V+ +VG GA  VR++FE AR     IIF DEI              
Sbjct: 310 EAGVPFLSVSGSEFVEMFVGVGASRVRDMFEQARQMAPSIIFVDEIDAIGKERGKGGAMG 369

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR V+   PD+E
Sbjct: 370 GANDEREATLNQLLVEMDGFSTSDQVVVLAGTNRPDVLDPALMRPGRFDRHVQIDSPDIE 429

Query: 380 GRANIFRIHTKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  I+ +H   +++         +R +    ++ L P   GA++ + C EA + A R +
Sbjct: 430 GRKAIYLVHLHDLNLAPEYTESKEQRELLAGKLAALTPGFAGADISNACNEAALIAARRQ 489

Query: 431 RKVATEKDFLKAVDKVISGYKKFS 454
               T K F +A+++VI+G +K S
Sbjct: 490 AAHVTLKHFEQAIERVIAGLEKKS 513

>TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {ON}
           Anc_2.472 YMR089C
          Length = 835

 Score =  184 bits (468), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 145/265 (54%), Gaps = 6/265 (2%)

Query: 194 MTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKT 253
              E    + + DV GC +  E++ E V+  L  P R+  +G   P+G +L GPPGTGKT
Sbjct: 341 FNTETAVQIRFNDVAGCDEAKEEIMEFVDF-LKQPSRYEKMGAKIPRGAILSGPPGTGKT 399

Query: 254 LCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXX 313
           L A+A A      F  V GSE V+ +VG GA  VR+LF+ A+     I+F DEI      
Sbjct: 400 LLAKATAGEAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTAKENAPSIVFIDEIDAIGKA 459

Query: 314 XXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVE 372
                    N E + T+ +L+ ++DGF    +I V+  TNRP+ LD ALLRPGR DR V 
Sbjct: 460 RQKGNFSGANDERENTLNQLLVEMDGFSSTDHIVVLAGTNRPDILDRALLRPGRFDRHVN 519

Query: 373 FSLPDLEGRANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRA 429
             LP+LEGR  IF +H K + +  G  ++L +RL    P  +GA++ +VC EA + A R 
Sbjct: 520 IDLPELEGRKAIFGVHLKKIKIA-GTIYDLQNRLAALTPGFSGADISNVCNEAALIAARY 578

Query: 430 RRKVATEKDFLKAVDKVISGYKKFS 454
                    F KA+++VI G ++ S
Sbjct: 579 NSSFVKLSHFEKAIERVIGGVERKS 603

>Kwal_23.4253 s23 complement(640328..644317) [3990 bp, 1329 aa] {ON}
           YGR270W (YTA7) - 26S proteasome ATPase [contig 1] FULL
          Length = 1329

 Score =  186 bits (471), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 101/242 (41%), Positives = 142/242 (58%), Gaps = 25/242 (10%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++ + DVGG  + I++L+E+V LPLL PE +   GI PP+G+L +GPPGTGKTL ARA+A
Sbjct: 411 NIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTLMARALA 470

Query: 261 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
                 +   TF    G++++ K+VGE  R +R LF+ A+ ++  IIFFDEI        
Sbjct: 471 ASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFDEAKKQQPSIIFFDEIDGLAPVRS 530

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 531 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFFFPL 587

Query: 376 PDLEGRANIFRIHTKSMSVERGIRW------ELISRLCPNST---GAELRSVCTEAGMFA 426
           P LE R+ I  IHTK        +W        IS+L   +    GA+LR++CTEA + +
Sbjct: 588 PGLEARSKILTIHTK--------KWNPPLPNHFISKLASLTKGYGGADLRALCTEAALIS 639

Query: 427 IR 428
           I+
Sbjct: 640 IQ 641

>Ecym_1258 Chr1 (530600..532843) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii AAR025C
          Length = 747

 Score =  183 bits (464), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 99/264 (37%), Positives = 148/264 (56%), Gaps = 12/264 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV GC +   ++ E V   L +P+++  LG   P+G +L G PGTGKTL ARA A 
Sbjct: 271 VNFKDVAGCDEAKMEIMEFVHF-LKNPDKYKALGAQIPRGAILSGAPGTGKTLLARATAG 329

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 330 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 389

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF  R  I V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 390 GSNDEREATLNQLLVEMDGFTARDQIVVLAGTNRPDVLDPALLRPGRFDRHIQIDAPDVE 449

Query: 380 GRANIFRIHTKSMSVERGIRWEL---------ISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  I+R+H   ++++  ++            ++ L P  +GA++ + C EA + A R +
Sbjct: 450 GRKAIYRVHLPRLNLQPALKTSTLDLDSFAGRLAALTPGFSGADIANACNEAALIAARHQ 509

Query: 431 RKVATEKDFLKAVDKVISGYKKFS 454
            +    K F +A+++VI+G +K S
Sbjct: 510 DEYVELKHFEQAIERVIAGLEKKS 533

>KNAG0L01060 Chr12 complement(193013..195154) [2142 bp, 713 aa] {ON}
           Anc_7.168 YER017C
          Length = 713

 Score =  182 bits (462), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 96/261 (36%), Positives = 149/261 (57%), Gaps = 9/261 (3%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V++ DV GC +  +++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 237 VSFKDVAGCNEAKQEIMEFVHF-LKNPKKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 295

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXX--XX 319
                F+ V GSE V+ +VG GA  VR+LFE AR+    IIF DEI              
Sbjct: 296 EAAVPFLSVSGSEFVEMFVGVGASRVRDLFEQARSLAPSIIFVDEIDAIGKERGKGGPLG 355

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+ 
Sbjct: 356 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDPALLRPGRFDRHIQIDSPDIT 415

Query: 380 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 433
           GR  I+ +H + ++++  +  +       ++ L P  TGA++ + C EA + A R +   
Sbjct: 416 GRKQIYLVHLERLNLQEKLALDRENLAGKLATLTPGFTGADIANACNEAALIAARHKDAT 475

Query: 434 ATEKDFLKAVDKVISGYKKFS 454
            T   F +A+++VI+G +K S
Sbjct: 476 ITLDHFEQAIERVIAGLEKKS 496

>KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa]
           {ON} Anc_4.259 YLR397C
          Length = 772

 Score =  183 bits (464), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 102/261 (39%), Positives = 147/261 (56%), Gaps = 8/261 (3%)

Query: 187 IDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 246
           + PS       E P V ++D+GG  +   KL+E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 490 VRPSAMREIFLEMPKVYWSDIGGQDELKRKLKEMIQLPLDASETFARLGVSAPKGVLLYG 549

Query: 247 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 306
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 550 PPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 609

Query: 307 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 366
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 610 IDALSPDRDGESTSAANHV---LTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 666

Query: 367 IDRKVEFSLPDLEGRANIFRIHTKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMF 425
           +DR +    PD + R  I R  T   ++E  G+  E +++     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIYVGPPDYDARLQILRKCTSKFNIESSGVDLEALAQKTDGCSGAEVVLLCQEAGLA 726

Query: 426 AIRAR---RKVATEKDFLKAV 443
           +I       KV+TE  F KA+
Sbjct: 727 SIMENVETEKVSTEH-FEKAL 746

 Score =  166 bits (419), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 90/231 (38%), Positives = 128/231 (55%), Gaps = 6/231 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           VTY  VGG   +IE L+  +ELPL  P+ F   G+ PP+GI+L+GPPGTGKT+  R VA+
Sbjct: 236 VTYNSVGGLFSEIEILKNTIELPLRQPQLFTDFGVTPPRGIMLHGPPGTGKTMILRCVAH 295

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
            T+A  + + G  +V KY+GE    +R++F  A   +  I+F DEI              
Sbjct: 296 STNAHVLTIDGPSIVSKYLGETEATLRDIFNEAVKYQPSIVFIDEIDSIAPNRANDDSGE 355

Query: 322 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 381
                R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD E R
Sbjct: 356 AE--SRVVATLLTLMDGMGASGKVVVIGATNRPNSVDPALRRPGRFDQEVEIGIPDAEAR 413

Query: 382 ANIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 428
            +I     + MS +R    E     I+       GA+L ++C EA M  I+
Sbjct: 414 LDILHKQFQRMSSDRQELTEEDIKTIASKTHGYVGADLSALCREAVMKTIQ 464

>Skud_13.245 Chr13 complement(419466..421940) [2475 bp, 824 aa] {ON}
           YMR089C (REAL)
          Length = 824

 Score =  183 bits (464), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           + + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 344 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 402

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 403 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 462

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 463 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 522

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF +H   + +  GI ++L +RL    P  +GA++ +VC EA + A R+       K
Sbjct: 523 RKAIFAVHLHHLKLAGGI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDSVKLK 581

Query: 438 DFLKAVDKVISGYKKFS 454
            F +A+++VI G ++ S
Sbjct: 582 HFEQAIERVIGGVERKS 598

>KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]
           {ON} similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017C AFG3 Component with Yta12p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 739

 Score =  182 bits (461), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 97/263 (36%), Positives = 147/263 (55%), Gaps = 11/263 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV GC +   ++ E V   L  P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 265 VNFKDVAGCNEAKAEIMEFVHF-LQKPDKYKALGAKIPRGAILSGPPGTGKTLLAKATAG 323

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 324 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 383

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 384 GANDEREATLNQLLVEMDGFGTNDQVVVLAGTNRPDVLDPALLRPGRFDRHIQIDAPDVE 443

Query: 380 GRANIFRIHTKSMSV--------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARR 431
           GR  I+++H K +++        E+ +    ++ L P   GA++ + C EA + A R ++
Sbjct: 444 GRKAIYQVHLKKLNLSPRYASPGEKEMLAGKLAALTPGFAGADIANACNEAALIAARYKK 503

Query: 432 KVATEKDFLKAVDKVISGYKKFS 454
                 +F +A+++VI+G +K S
Sbjct: 504 PFVELANFEQAIERVIAGLEKKS 526

>YGR270W Chr7 (1027370..1031509) [4140 bp, 1379 aa] {ON}
           YTA7Protein that localizes to chromatin and has a role
           in regulation of histone gene expression; has a
           bromodomain-like region that interacts with the
           N-terminal tail of histone H3, and an ATPase domain;
           potentially phosphorylated by Cdc28p
          Length = 1379

 Score =  184 bits (466), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 139/234 (59%), Gaps = 9/234 (3%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           +V + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 409 NVNFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 468

Query: 261 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDEI        
Sbjct: 469 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 528

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 529 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 585

Query: 376 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIR 428
           PD++ R  I +I T+  S      + + ++ L     GA+LRS+CTEA + +I+
Sbjct: 586 PDVKARFKILQIQTRKWSSPLSTNFIDKLAFLTKGYGGADLRSLCTEAALISIQ 639

>Kpol_401.3 s401 complement(5130..7490) [2361 bp, 786 aa] {ON}
           complement(5130..7490) [2361 nt, 787 aa]
          Length = 786

 Score =  182 bits (462), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 151/264 (57%), Gaps = 12/264 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           +++ DV GC +  +++ E V   L +P+R+  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 301 ISFKDVAGCAEAKQEIMEFVHF-LKNPQRYTDLGAKIPRGAILSGPPGTGKTLLAKATAG 359

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
                F+ V GSE V+ +VG GA  VR+LFE AR+    IIF DEI              
Sbjct: 360 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARSMSPSIIFIDEIDAIGKERGKGGALG 419

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR +E   PD+E
Sbjct: 420 GANDEREATLNQLLVEMDGFSTTDQVVVLAGTNRPDVLDPALMRPGRFDRHIEIDPPDVE 479

Query: 380 GRANIFRIHTKSMSVE------RGIRWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR +I+ +H   ++++      +  + EL   ++ L P   GA++ + C EA + A R  
Sbjct: 480 GRKSIYLVHLSKLNLDPIFTETKEAKDELAGKLAALTPGFAGADIANACNEAALIAARYN 539

Query: 431 RKVATEKDFLKAVDKVISGYKKFS 454
            K    + F +A+++VI+G +K S
Sbjct: 540 DKYVELRHFEQAIERVIAGLEKKS 563

>Suva_7.566 Chr7 (982174..986370) [4197 bp, 1398 aa] {ON} YGR270W
           (REAL)
          Length = 1398

 Score =  183 bits (465), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 141/236 (59%), Gaps = 13/236 (5%)

Query: 201 DVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 260
           ++ + D+GG  + I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 421 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 480

Query: 261 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXX 315
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDEI        
Sbjct: 481 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 540

Query: 316 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 541 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 597

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIR 428
           PD++ R  I +I TK  +    +  E I++L        GA+LRS+CTEA + +I+
Sbjct: 598 PDVKARYKILQIQTKKWT--SPLSTEFINKLAILTKGYGGADLRSLCTEAALISIQ 651

>Kwal_26.7749 s26 (497057..499501) [2445 bp, 814 aa] {ON} YMR089C
           (YTA12) - mitochondrial membrane ATPase of the
           CDC48/PAS1/SEC18 (AAA) family [contig 55] FULL
          Length = 814

 Score =  182 bits (461), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           VT+ DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 341 VTFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAG 399

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 400 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIVFVDEIDAIGKARQKGNFSG 459

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 460 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELEG 519

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF++H   + +   I  +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 520 RKQIFQVHLSKIKLAGSID-DLKNRLAALTPGFSGADISNVCNEAALTAARCECTSVKLE 578

Query: 438 DFLKAVDKVISGYKKFS 454
            F +A+++VI G ++ S
Sbjct: 579 HFEQAIERVIGGVERKS 595

>NCAS0J01550 Chr10 complement(274194..276512) [2319 bp, 772 aa] {ON}
           Anc_4.259
          Length = 772

 Score =  181 bits (459), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 138/242 (57%), Gaps = 3/242 (1%)

Query: 187 IDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 246
           I PS       E P V ++D+GG ++   K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 489 IRPSAMREIFLEMPKVYWSDIGGQEELKRKMKEMIQLPLEASETFARLGVTAPKGVLLYG 548

Query: 247 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 306
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 549 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 608

Query: 307 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 366
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 609 I--DALSPDRDGGSSSSAASHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 666

Query: 367 IDRKVEFSLPDLEGRANIFRIHTKSMSV-ERGIRWELISRLCPNSTGAELRSVCTEAGMF 425
           +DR +  + PD E R  I R  TK   + E  I  E +SR     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIYVAPPDYEARLQILRKCTKKFQIDESTINLEDLSRRTDGCSGAEVVLLCQEAGLA 726

Query: 426 AI 427
           AI
Sbjct: 727 AI 728

 Score =  167 bits (423), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 130/232 (56%), Gaps = 8/232 (3%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           +TY  VGG   +++ L+  + LPL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 233 LTYDSVGGLHKEVDLLKTTISLPLHQPTLFSDFGVSPPRGILLHGPPGTGKTMLLRCVAN 292

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
             +A  + + G  +V KY+GE    +R++F  A+  +  IIF DEI              
Sbjct: 293 TANAHVLTINGPSIVSKYLGETESALRDIFNEAKKYQPSIIFIDEI---DSIAPNRANDD 349

Query: 322 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 350 SGEVESRVVATLLTLMDGMGSAGRLVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 409

Query: 381 RANIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 428
           R +I       MS ER    E     IS       GA+L S+C E+ M  I+
Sbjct: 410 RLDILMKQFSQMSSERHTLTEEDIKTISSKTHGYVGADLSSLCRESVMKTIQ 461

>Ecym_7400 Chr7 complement(822595..825009) [2415 bp, 804 aa] {ON}
           similar to Ashbya gossypii ABL041W
          Length = 804

 Score =  181 bits (459), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 97/256 (37%), Positives = 141/256 (55%), Gaps = 4/256 (1%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 334 VKFKDVAGCDEAKEEIMEFVSF-LKQPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 392

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 393 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIVFVDEIDAIGKARQKGNFSG 452

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 453 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALLRPGRFDRHINIDKPELEG 512

Query: 381 RANIFRIHTKSMSVERGI--RWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
           R  IF++H   +++   I      ++ L P  +GA++ +VC EA + A R        + 
Sbjct: 513 RKEIFKVHLSKITLAEDIVDLENRLAALTPGFSGADIANVCNEAALVAARGDNSSVKLEH 572

Query: 439 FLKAVDKVISGYKKFS 454
           F  A+++VI G ++ S
Sbjct: 573 FEHAIERVIGGVERKS 588

>AAR025C Chr1 complement(385327..387507) [2181 bp, 726 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER017C
           (AFG3)
          Length = 726

 Score =  180 bits (457), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 147/264 (55%), Gaps = 12/264 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           + + DV GC +   ++ E V+  L +PE++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 248 IKFKDVAGCDEAKMEIMEFVDF-LKTPEKYRALGAQIPRGAILSGPPGTGKTLLAKATAG 306

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXX--XXXXXXXXXX 319
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 307 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKARGKGGEMG 366

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF  R  I V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 367 GSNDEREATLNQLLVEMDGFTSRDQIVVIAGTNRPDVLDPALLRPGRFDRHIQVDAPDVE 426

Query: 380 GRANIFRIHTKSMSVERGIRWE---------LISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  I+++H   ++++  ++            ++ L P   GA++ + C EA + A R  
Sbjct: 427 GRKAIYKVHLSKLNLDPSLKTTPDTLDNFAGKLAALTPGFAGADISNACNEAALIAARHN 486

Query: 431 RKVATEKDFLKAVDKVISGYKKFS 454
                 + F +A+++VI+G +K S
Sbjct: 487 DAFVEFRHFDQAIERVIAGLEKKS 510

>TDEL0A02480 Chr1 (443736..446186) [2451 bp, 816 aa] {ON} Anc_2.472
           YMR089C
          Length = 816

 Score =  181 bits (459), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV GC +  E++ E V   L  P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 338 VKFKDVAGCDEAKEEIMEFVSF-LKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 396

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     ++F DEI              
Sbjct: 397 EAGVPFFFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMVFIDEIDAIGKARQKGNISG 456

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR V    P+L G
Sbjct: 457 ANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDVLDKALLRPGRFDRHVNIDKPELSG 516

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R   K    +
Sbjct: 517 RQAIFEVHMKKIKLASDI-FDLKNRLAALTPGFSGADIANVCNEAALIAARNDAKSVRLE 575

Query: 438 DFLKAVDKVISGYKKFS 454
            F +AV++VI G ++ S
Sbjct: 576 HFEQAVERVIGGVERKS 592

>KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 813

 Score =  180 bits (457), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           VT+ DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 340 VTFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAG 398

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 399 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPSIVFVDEIDAIGKARQKGNFSG 458

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 459 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELEG 518

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF++H   + +  G   +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 519 RKQIFQVHLAKVKLA-GSMEDLKNRLAALTPGFSGADISNVCNEAALTAARNECTSVKLE 577

Query: 438 DFLKAVDKVISGYKKFS 454
            F +A+++VI G ++ S
Sbjct: 578 HFEQAIERVIGGVERKS 594

>CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397c AFG2
          Length = 771

 Score =  180 bits (456), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 152/272 (55%), Gaps = 16/272 (5%)

Query: 160 SPTDIEEGMRVGV-DRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLR 218
           S TD+ E ++VG+ D     +E      I PS       E P V ++D+GG +D   K++
Sbjct: 468 STTDMTE-LKVGITDVESAMLE------IRPSAMREIFLEMPKVYWSDIGGQEDLKRKMK 520

Query: 219 EVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQK 278
           E+++LPL + + FA LGI  PKGILLYGPPG  KTL A+A+A  +   F+ V G E+  K
Sbjct: 521 EMIQLPLEAADTFAALGIKAPKGILLYGPPGCSKTLTAKALATESGVNFLAVKGPEIFNK 580

Query: 279 YVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 338
           YVGE  R +RE+F  AR     IIFFDEI               N V   +  L+ ++DG
Sbjct: 581 YVGESERAIREIFRKARAASPSIIFFDEIDALSPDRDGSSTSAANHV---LTSLLNEIDG 637

Query: 339 FDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGI 398
            +    + ++ ATNRP+ +D ALLRPGR+DR V  S PD   R  I +  TK+  ++   
Sbjct: 638 VEELNGVVIVAATNRPDEIDSALLRPGRLDRHVYVSPPDFNARLQILKKCTKNFDLDN-- 695

Query: 399 RWELISRLCPNS---TGAELRSVCTEAGMFAI 427
             EL++ L   +   +GAE+  +C EAG+ AI
Sbjct: 696 TDELLNDLATRTEGCSGAEVVLLCQEAGLAAI 727

 Score =  167 bits (423), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 136/232 (58%), Gaps = 8/232 (3%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           ++Y  VGG K +I+ L++ ++LPL  PE FA  GI PPKGIL++GPPGTGKT+  R VAN
Sbjct: 233 LSYDAVGGLKCEIDLLKKAIDLPLHRPEIFADFGISPPKGILMHGPPGTGKTMLLRCVAN 292

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
            ++A  + + G  +V KY+GE    +RE+F  A+  +  IIF DEI              
Sbjct: 293 ASNAHVLSIDGPSIVSKYLGETESKLREIFNEAKKYQPAIIFIDEI---DSIAPNRANDD 349

Query: 322 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
             EV+ R +  L+T +DG    G I V+ ATNRPN +DPAL RPGR D+++E  +PD++ 
Sbjct: 350 SGEVESRVVATLLTLMDGTSSSGRIAVIAATNRPNAVDPALRRPGRFDQEIEIGIPDVDA 409

Query: 381 RANIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 428
           R +I +   + +S ++    E     I+       GA+L ++C E+ M  I+
Sbjct: 410 RFDILKKQFEKISTDKHTLSEGDIKSIASKTHGYVGADLTALCRESVMKTIQ 461

>KAFR0A05890 Chr1 (1195474..1197792) [2319 bp, 772 aa] {ON}
           Anc_4.259 YLR397C
          Length = 772

 Score =  180 bits (456), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 149/282 (52%), Gaps = 14/282 (4%)

Query: 187 IDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 246
           I PS       E P V ++D+GG  +   K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 490 IRPSAMREIFLEMPKVYWSDIGGQHELKRKMKEMIQLPLEASETFAELGVSAPKGVLLYG 549

Query: 247 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 306
           PPG  KTL A+A+A  +   F  V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 550 PPGCSKTLTAKALATESGINFFAVKGPEIFSKYVGESERAIREIFRKARAASPSIIFFDE 609

Query: 307 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 366
           I               + V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 610 IDALSPDRDSGSTSAASHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDPALLRPGR 666

Query: 367 IDRKVEFSLPDLEGRANIFRIHTKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMF 425
           +DR +    PD E R  I    TK   +E   +  E ++R     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIFVGPPDYEARLQILHKCTKKFQLEGSDVNLEDLARRTDGCSGAEIVLLCQEAGLA 726

Query: 426 AI--RARRKVATEKDFLKAVDKVISG--------YKKFSSTS 457
           AI    + K      F KA++ +  G        Y  F+S S
Sbjct: 727 AIMENLQAKEVRAAHFEKAMEGISRGITEDMLEYYNNFASRS 768

 Score =  163 bits (413), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 134/245 (54%), Gaps = 10/245 (4%)

Query: 204 YTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRT 263
           Y  VGG   +I  L+  +ELPL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN +
Sbjct: 236 YEAVGGLSKEIGLLKSTIELPLHQPTLFSDFGVSPPRGILLHGPPGTGKTMLLRCVANTS 295

Query: 264 DATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN 323
           +A  + + G  +V KY+GE    +R++F  A+  +  IIF DEI                
Sbjct: 296 NAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEI---DSLAPNRANDDSG 352

Query: 324 EVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRA 382
           EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD E R 
Sbjct: 353 EVESRVVATLLTLMDGMGAAGRLVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDAEARL 412

Query: 383 NIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR--ARRKVATE 436
           +I      +MS ER    E     I+       GA+L ++C E+ M  I+       A +
Sbjct: 413 DILLKQFSNMSSERHSLTEDNIKTIASKTHGYVGADLSALCRESVMKTIQRGLTEGTAMD 472

Query: 437 KDFLK 441
           K  LK
Sbjct: 473 KTLLK 477

>Suva_13.266 Chr13 complement(427123..429594) [2472 bp, 823 aa] {ON}
           YMR089C (REAL)
          Length = 823

 Score =  180 bits (456), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           + + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 343 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 401

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 402 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 461

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 462 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 521

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+       K
Sbjct: 522 RKAIFAVHLHHIKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDSVKLK 580

Query: 438 DFLKAVDKVISGYKKFS 454
           +F +A+++VI G ++ S
Sbjct: 581 NFEQAIERVIGGVERKS 597

>Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2340
           bp, 779 aa] {ON} ANNOTATED BY YGOB -
          Length = 779

 Score =  179 bits (455), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 146/261 (55%), Gaps = 11/261 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV GC +   ++ E V   L  P+++  LG   PKG +L GPPGTGKTL A+A A 
Sbjct: 297 VKFKDVAGCDEAKGEIMEFVHF-LQKPDKYRKLGAQIPKGAILSGPPGTGKTLLAKATAG 355

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 356 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 415

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     I V+  TNRP+ LDPAL+RPGR DR ++   PD+E
Sbjct: 416 GANDEREATLNQLLVEMDGFTSTDQIVVLAGTNRPDVLDPALMRPGRFDRHIQLDAPDVE 475

Query: 380 GRANIFRIHTKSMSVE----RGIRWEL----ISRLCPNSTGAELRSVCTEAGMFAIRARR 431
           GR  I+++H ++++++    R   +E     ++ L P   GA++ + C EA + A R   
Sbjct: 476 GRKAIYQVHLRNLNLDPKYIRTSEFEALAGKLAALTPGFAGADIANACNEAALIAARHSD 535

Query: 432 KVATEKDFLKAVDKVISGYKK 452
                + F +A+++VI+G +K
Sbjct: 536 AFVEFRHFEQAIERVIAGLEK 556

>KAFR0A00740 Chr1 (132072..134426) [2355 bp, 784 aa] {ON} Anc_2.472
           YMR089C
          Length = 784

 Score =  179 bits (455), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 142/257 (55%), Gaps = 6/257 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           + + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 308 IKFNDVAGCDEAKEEIMEFVSF-LKDPVRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 366

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 367 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 426

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 427 ANDERESTLNQMLVEMDGFTPSDHVVVLAGTNRPDILDRALLRPGRFDRHINIDKPELEG 486

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 487 RKEIFAVHLKGLKLANTI-FDLKNRLAALTPGFSGADIANVCNEAALIAARTDSHAVVLT 545

Query: 438 DFLKAVDKVISGYKKFS 454
            F  A+++VI G ++ S
Sbjct: 546 HFEHAIERVIGGVERKS 562

>NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168
          Length = 782

 Score =  179 bits (453), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 96/262 (36%), Positives = 145/262 (55%), Gaps = 12/262 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V++ +V GC +   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 304 VSFKNVAGCDEAKVEIMEFVHF-LKNPNKYTVLGAKIPRGAILSGPPGTGKTLLAKATAG 362

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 363 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARKLAPSIIFIDEIDAIGKERGKGGALG 422

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+ 
Sbjct: 423 GANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRPDVLDPALLRPGRFDRHIQIDAPDIN 482

Query: 380 GRANIFRIHTKSMSVERGI---------RWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  I+ +H K +++E  +             ++ L P  TGA++ + C EA + A R +
Sbjct: 483 GRKQIYLVHLKRLNLEEKLVETKEDVENLAGKLATLTPGFTGADIANACNEAALIAARHK 542

Query: 431 RKVATEKDFLKAVDKVISGYKK 452
               T + F +A+++VI+G +K
Sbjct: 543 DPFVTIQHFEQAIERVIAGLEK 564

>KLLA0B03234g Chr2 (293919..296333) [2415 bp, 804 aa] {ON} similar
           to uniprot|P32794 Saccharomyces cerevisiae YLR397C AFG2
           ATPase of the CDC48/PAS1/SEC18 (AAA) family forms a
           hexameric complex may be involved in degradation of
           aberrant mRNAs
          Length = 804

 Score =  179 bits (453), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 141/245 (57%), Gaps = 8/245 (3%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V Y  VGG K +   L+  VE PL  P+ F   GI+PP+GILL+GPPGTGKT+  R VAN
Sbjct: 267 VLYNAVGGLKKETSILKSTVEFPLHQPQLFTDFGINPPRGILLHGPPGTGKTMLLRCVAN 326

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
            TDA  + + G  +V KY+GE    +R++F  A+  +  IIF DEI              
Sbjct: 327 ETDAHILTISGPSIVSKYLGETEAALRDIFNEAKRYQPSIIFIDEI---DSLAPNRANDD 383

Query: 322 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
             EV+ R +  L+T +DG D  G + V+ ATNRPN++DPAL RPGR D+++E S+PD+E 
Sbjct: 384 SGEVESRVVATLLTLMDGMDGSGRLAVVAATNRPNSIDPALRRPGRFDQEIEISIPDVEA 443

Query: 381 RANIFRIHTKSMSVERGIRW-ELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 436
           R +I R     MS +R +   E IS +   +    GA+L ++C E+ M  I+       E
Sbjct: 444 RHDILRKQFSRMSKQRQLLSPEDISNIASKTHGYVGADLIALCRESVMKTIQRGLNENIE 503

Query: 437 KDFLK 441
           +D LK
Sbjct: 504 RDDLK 508

 Score =  172 bits (437), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 91/242 (37%), Positives = 136/242 (56%), Gaps = 3/242 (1%)

Query: 187 IDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 246
           I PS       E P V + D+GG ++  +K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 521 IRPSAMREIFLETPKVYWDDIGGQEELKQKMKEMIQLPLEAAETFAKLGVSAPKGVLLYG 580

Query: 247 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 306
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 581 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 640

Query: 307 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 366
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 641 I--DALSPDRDSGSGTSAANHVLTSLLNEIDGVEELKGVIIVAATNRPDEIDPALLRPGR 698

Query: 367 IDRKVEFSLPDLEGRANIFRIHTKSMSVERGI-RWELISRLCPNSTGAELRSVCTEAGMF 425
           +DR +    P  + R  I +  TK  +++  I   + ++      +GAE+  +C EAG+ 
Sbjct: 699 LDRHIYVGPPSYDARLQILQKCTKKFNIDTAIVDLKALAECTDGCSGAEVVLLCQEAGLA 758

Query: 426 AI 427
           AI
Sbjct: 759 AI 760

>TPHA0B00730 Chr2 (165929..168259) [2331 bp, 776 aa] {ON} Anc_4.259
           YLR397C
          Length = 776

 Score =  178 bits (452), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 165/311 (53%), Gaps = 19/311 (6%)

Query: 164 IEEGMRVGVDRSKYHIELPLPP------RIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKL 217
           I+ G++   D S   +++ +         I PS       E P V ++D+GG ++   K+
Sbjct: 464 IQRGLKTASDMSSDSLKITVNDVEDAMLEIRPSAMREIFLEMPKVYWSDIGGQEELKRKM 523

Query: 218 REVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 277
           +E+++LPL + + F  LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  
Sbjct: 524 KEMIQLPLEAADTFDRLGVSAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFN 583

Query: 278 KYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 337
           KYVGE  R +RE+F  AR+    IIFFDEI                     +  L+ ++D
Sbjct: 584 KYVGESERAIREIFRKARSASPSIIFFDEIDALSPDRDGGSSSS--AASHVLTSLLNEID 641

Query: 338 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERG 397
           G +    + ++ ATNRP+ +DPALLRPGR+DR +  + P  + R  I + +TK+  VE+ 
Sbjct: 642 GVEDLKGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPTYDARLQILKNNTKNFQVEKA 701

Query: 398 -IRWELISRLCPNSTGAELRSVCTEAGMFAIRAR--RKVATEKDFLKAVDKVISG----- 449
            I  E ++R     +GAE+  +C EAG+ AI         T + F KA+  +  G     
Sbjct: 702 NIDLEELARRTDGCSGAEVVLLCQEAGLAAIMENIDTDFVTPEHFEKALQGIARGITPEM 761

Query: 450 ---YKKFSSTS 457
              Y++F+S S
Sbjct: 762 LEYYQEFASRS 772

 Score =  169 bits (427), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/239 (38%), Positives = 135/239 (56%), Gaps = 6/239 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V+Y  VG    +IE LR  VELPL   + FA  GI PP+GILL+GPPGTGKT+  R VA+
Sbjct: 237 VSYNSVGALSKEIEVLRNAVELPLNQSQLFADFGITPPRGILLHGPPGTGKTMLLRCVAS 296

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
            +DA  + + G  +V KY+G+    +R++F  A+  +  IIF DEI              
Sbjct: 297 SSDAHVLTIDGPSIVSKYLGDTENTLRDIFREAQKYQPSIIFIDEIDSIAPNRTNDDSGE 356

Query: 322 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 381
                R +  L+T +DG +  G + V+ ATNRPN++DPAL RPGR D++VE  +PD+EGR
Sbjct: 357 AE--SRVVATLLTLMDGMNGSGKVVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDVEGR 414

Query: 382 ANIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 436
            +I       MS +R    +    +I+       GA+L ++C E+ M  I+   K A++
Sbjct: 415 LDILSKQFSKMSPKRHNLSDEDIKVIAAKTHGYVGADLTALCRESVMKTIQRGLKTASD 473

>SAKL0H02750g Chr8 (273630..275960) [2331 bp, 776 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family
           forms a hexameric complex may be involved in degradation
           of aberrant mRNAs
          Length = 776

 Score =  178 bits (452), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 105/294 (35%), Positives = 156/294 (53%), Gaps = 9/294 (3%)

Query: 164 IEEGMRVGVDRSKYHIELP----LPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLRE 219
           I+ G+   +DR K  + L         I PS       E P V ++D+GG ++  +K+RE
Sbjct: 466 IQRGLTESIDREKLKVILKDVEEAMMDIRPSAMREIFLEMPKVYWSDIGGQEELKQKMRE 525

Query: 220 VVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKY 279
           +++LPL + E F  LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  KY
Sbjct: 526 MIQLPLEAAETFQRLGVSAPKGVLLYGPPGCSKTLTAKALATESGVNFLAVKGPEIFNKY 585

Query: 280 VGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGF 339
           VGE  R +RE+F  AR     IIFFDEI               +     +  L+ ++DG 
Sbjct: 586 VGESERAIREIFRKARAAAPSIIFFDEI--DALSPDRNSGSGTSAANHVLTSLLNEIDGV 643

Query: 340 DPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSV-ERGI 398
           +    + ++ ATNRP+ +DPALLRPGR+DR +  + PD   R  IF+  TK   +    +
Sbjct: 644 EELNGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPDHAARLQIFKKCTKKFQLGGSNV 703

Query: 399 RWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKK 452
             E ++      +GAE+  +C EAG+ AI     + T K   +  +K +SG  K
Sbjct: 704 DLEELASKTEGCSGAEVVLLCQEAGLAAI--MEDLETSKVEARHFEKALSGISK 755

 Score =  159 bits (403), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 139/249 (55%), Gaps = 8/249 (3%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           + Y  VGG   +I  L+  +ELPL  P  F    + PP+GILL+GPPGTGKT+  R VAN
Sbjct: 239 IGYNAVGGLAKEISLLKGTIELPLHQPTLFTDFSVTPPRGILLHGPPGTGKTMLLRCVAN 298

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
            T+A  + + G  +V KY+GE    +R++F  A+  +  IIF DEI              
Sbjct: 299 ETNAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEI---DSLAPNRAGDD 355

Query: 322 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
             E++ R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE  +PD++ 
Sbjct: 356 SGEIESRVVATLLTLMDGMGGAGRLVVVAATNRPNKIDPALRRPGRFDQEVEIGIPDVDA 415

Query: 381 RANIFRIHTKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 436
           R +I       +S +R  +  E IS +   +    GA+L ++C EA M AI+     + +
Sbjct: 416 RLDILTKQFSKISHQRHELIAEDISTIASKTHGYVGADLIALCREAVMKAIQRGLTESID 475

Query: 437 KDFLKAVDK 445
           ++ LK + K
Sbjct: 476 REKLKVILK 484

>NCAS0E02020 Chr5 (386327..388648) [2322 bp, 773 aa] {ON} Anc_7.168
          Length = 773

 Score =  178 bits (452), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 148/264 (56%), Gaps = 12/264 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V++ +V GC +   ++ E V   L +P+++ TLG   P+G +L GPPGTGKTL A+A A 
Sbjct: 295 VSFKNVAGCDEAKVEIMEFVHF-LKNPKKYTTLGAKIPRGAILSGPPGTGKTLLAKATAG 353

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 354 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARKMAPSIIFIDEIDAIGKERGKGGALG 413

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR ++   PD+ 
Sbjct: 414 GSNDEREATLNQLLVEMDGFSTSDQVVVIAGTNRPDVLDPALMRPGRFDRHIQIDAPDIN 473

Query: 380 GRANIFRIHTKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  I+ +H K +++E  +      R  L   ++ L P  TGA++ + C EA + A R +
Sbjct: 474 GRKEIYLVHLKKLNLETRLVETDSDRENLAGKLATLTPGFTGADIANACNEAALIAARNK 533

Query: 431 RKVATEKDFLKAVDKVISGYKKFS 454
                   F +A+++VI+G +K S
Sbjct: 534 DPYILLSHFEQAIERVIAGLEKKS 557

>CAGL0J01353g Chr10 (124994..127477) [2484 bp, 827 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089c YTA12
           or uniprot|P39925 Saccharomyces cerevisiae YER017c AFG3
          Length = 827

 Score =  179 bits (453), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 96/255 (37%), Positives = 144/255 (56%), Gaps = 6/255 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV GC +  E++ E V   L +P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 349 VKFKDVAGCDEAKEEIMEFVSF-LRNPQRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 407

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 408 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 467

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR++    P+LEG
Sbjct: 468 ANDERENTLNQMLVEMDGFTSADHVVVLAGTNRPDILDNALLRPGRFDRRIHIDRPELEG 527

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF +H + + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 528 RKAIFEVHLQKLKLAGSI-FDLKNRLAALTPGFSGADIANVCNEAALIAARHDENAVKLS 586

Query: 438 DFLKAVDKVISGYKK 452
            F +A+++VI G ++
Sbjct: 587 HFEQAIERVIGGVER 601

>YMR089C Chr13 complement(445609..448086) [2478 bp, 825 aa] {ON}
           YTA12Component, with Afg3p, of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 825

 Score =  178 bits (452), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           + + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 345 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 403

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 404 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 463

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 464 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 523

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+        
Sbjct: 524 RKAIFAVHLHHLKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDAVKLN 582

Query: 438 DFLKAVDKVISGYKKFS 454
            F +A+++VI G ++ S
Sbjct: 583 HFEQAIERVIGGVERKS 599

>Smik_13.273 Chr13 complement(429460..431943) [2484 bp, 827 aa] {ON}
           YMR089C (REAL)
          Length = 827

 Score =  178 bits (452), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           + + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 346 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 404

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 405 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 464

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 465 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 524

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A R+        
Sbjct: 525 RKAIFAVHLHHLKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDENSVKLN 583

Query: 438 DFLKAVDKVISGYKKFS 454
            F +A+++VI G ++ S
Sbjct: 584 HFEQAIERVIGGVERKS 600

>TBLA0D04490 Chr4 complement(1111512..1113860) [2349 bp, 782 aa]
           {ON} Anc_7.168 YER017C
          Length = 782

 Score =  177 bits (450), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 103/294 (35%), Positives = 155/294 (52%), Gaps = 25/294 (8%)

Query: 171 GVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPER 230
           GV +SK H              +   E    VT+ DV GC++  +++ E V+  L +P +
Sbjct: 293 GVGKSKAH--------------LFNKETDVKVTFKDVAGCQEAKQEIMEFVDF-LKNPHK 337

Query: 231 FATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL 290
           +  LG   P+G +L GPPGTGKTL A+AVA      F+ V GSE V+ +VG GA  VR+L
Sbjct: 338 YTELGAKIPRGAILSGPPGTGKTLLAKAVAGEAGVPFLSVSGSEFVEMFVGVGASRVRDL 397

Query: 291 FEMARTKKACIIFFDEIXXXXXXXXXXXXX--XXNEVQRTMLELITQLDGFDPRGNIKVM 348
           FE A      IIF DEI                 +E + T+ +L+ ++DGF     + V+
Sbjct: 398 FEQASKMAPSIIFVDEIDAIGKARGKNGSLGGSNDEREATLNQLLVEMDGFSTSDQVVVL 457

Query: 349 FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSV--------ERGIRW 400
             TNRP+ LD ALLRPGR DR V+   PD+EGR  I+ +H K +++        ++ +  
Sbjct: 458 AGTNRPDVLDKALLRPGRFDRHVQIDAPDVEGRKLIYLVHLKKLNLDPLYSEDKQKQLLA 517

Query: 401 ELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFS 454
             ++ L P  TGA++ + C E+ + A R          F +A+++VI+G +K S
Sbjct: 518 GKLAALTPGFTGADIANACNESALIAARKMDPYVQFTHFEEAIERVIAGLEKKS 571

>NDAI0H02210 Chr8 complement(538548..540959) [2412 bp, 803 aa] {ON}
           Anc_2.472
          Length = 803

 Score =  177 bits (450), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           + + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 319 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 377

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 378 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 437

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 438 ANDERENTLNQMLVEMDGFTPSDHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 497

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF +H + + +  G   +L +RL    P   GA++ +VC EA + A R  +     +
Sbjct: 498 RKAIFEVHLQKLKLA-GTVLDLKNRLAALTPGFAGADIANVCNEAALIAARNDQPSVRLE 556

Query: 438 DFLKAVDKVISGYKKFS 454
            F +A+++VI G ++ S
Sbjct: 557 HFEQAIERVIGGVERKS 573

>KLTH0D14586g Chr4 complement(1190295..1192619) [2325 bp, 774 aa]
           {ON} similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family
           forms a hexameric complex may be involved in degradation
           of aberrant mRNAs
          Length = 774

 Score =  177 bits (448), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 99/267 (37%), Positives = 144/267 (53%), Gaps = 5/267 (1%)

Query: 187 IDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 246
           I PS       E P V ++D+GG +D   K++E+++LPL +PE F+ L +  PKG+LLYG
Sbjct: 491 IRPSAMREIFLEMPKVYWSDIGGQEDLKLKMKEMIQLPLEAPESFSRLSVSAPKGVLLYG 550

Query: 247 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 306
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 551 PPGCSKTLTAKALATESGVNFLAVKGPEIFNKYVGESERAIREVFRKARAAAPSIIFFDE 610

Query: 307 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 366
           I               +     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 611 I--DALSPDRDSGGSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDAALLRPGR 668

Query: 367 IDRKVEFSLPDLEGRANIFRIHTKSMS-VERGIRWELISRLCPNSTGAELRSVCTEAGMF 425
           +DR +    PD E R  I R  TK    ++     +  ++     +GAE+  +C EAG+ 
Sbjct: 669 LDRHIYVGPPDFEARLQILRKSTKDFHLIDSDALLQEFAQKTEGCSGAEVVLLCQEAGLA 728

Query: 426 AIRARRKVATEKDFLKAVDKVISGYKK 452
           AI     +  EK   K  DK I+G  +
Sbjct: 729 AI--MENLDAEKVDRKHFDKAIAGISR 753

 Score =  162 bits (410), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 139/245 (56%), Gaps = 8/245 (3%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           ++Y  VGG + +IE L+  +ELPL  P  FA  G+ PP+GILL+GPPGTGKT+  R VA+
Sbjct: 237 MSYNSVGGLQKEIELLKRTIELPLHQPTLFADFGVTPPRGILLHGPPGTGKTMLLRCVAS 296

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
             +A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 297 EANAHVLTINGPSIVSKYLGETEAALRDIFNEARIYQPSIIFIDEI---DSLAPSRTSDD 353

Query: 322 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
             EV+ R +  L+T +DG    G + V+ ATNRPN +D AL RPGR+D++VE  +PD+E 
Sbjct: 354 SGEVESRVVATLLTLMDGMGSTGRVVVVAATNRPNAVDMALRRPGRLDQEVEIGIPDVES 413

Query: 381 RANIFRIHTKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 436
           R +I     + +S +R  +  E I  +   +    GA+L ++C EA M  ++     +  
Sbjct: 414 RHDILLKQFRKVSEKRHELTLEDIQAIASKTHGYVGADLVALCREAVMKTLQRGVSHSLT 473

Query: 437 KDFLK 441
           KD +K
Sbjct: 474 KDEMK 478

>NCAS0A07820 Chr1 complement(1556553..1558928) [2376 bp, 791 aa]
           {ON} Anc_2.472
          Length = 791

 Score =  177 bits (448), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           + + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 311 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 369

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 370 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 429

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 430 ANDERENTLNQMLVEMDGFTTEDHVVVLAGTNRPDILDQALLRPGRFDRHINLDKPELEG 489

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF +H   + +   I ++L +RL    P   GA++ +VC EA + A R  +K    +
Sbjct: 490 RKAIFAVHLGKLKLSSSI-FDLKNRLAALTPGFAGADIANVCNEAALIAARNDQKSVKLE 548

Query: 438 DFLKAVDKVISGYKKFS 454
            F +A+++VI G ++ S
Sbjct: 549 HFEQAIERVIGGVERKS 565

>TPHA0C01520 Chr3 (349034..351388) [2355 bp, 784 aa] {ON} Anc_7.168
           YER017C
          Length = 784

 Score =  177 bits (448), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 95/264 (35%), Positives = 147/264 (55%), Gaps = 12/264 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV GC +  +++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 294 VAFKDVAGCNEAKQEIMEFVHF-LKNPKKYTDLGAKIPRGAILSGPPGTGKTLLAKATAG 352

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
                F+ V GSE V+ +VG GA  VR+LFE ART    IIF DEI              
Sbjct: 353 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARTMAPSIIFIDEIDAIGKERGKGGALG 412

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR +E   PD+E
Sbjct: 413 GANDEREATLNQLLVEMDGFQTSDQVIVLAGTNRPDVLDKALMRPGRFDRHIEIDPPDVE 472

Query: 380 GRANIFRIHTKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR +I+ +H   +++         ++ +    ++ L P   GA++ + C EA + A R  
Sbjct: 473 GRKSIYLVHLSKLNLDPSFLKTKHDKEMLAGKLAALTPGFAGADIANACNEAALIAARYN 532

Query: 431 RKVATEKDFLKAVDKVISGYKKFS 454
            +    + F +A+++VI+G +K S
Sbjct: 533 DEYVEMRHFEQAIERVIAGLEKKS 556

>KLLA0F13706g Chr6 complement(1269550..1272078) [2529 bp, 842 aa]
           {ON} similar to uniprot|P40341 Saccharomyces cerevisiae
           YMR089C YTA12 Component with Afg3p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 842

 Score =  177 bits (449), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 334 VNFKDVAGCDEAKEEIMEFVSF-LKEPSRYERMGAKIPRGAILSGPPGTGKTLLAKATAG 392

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DEI              
Sbjct: 393 EAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSG 452

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +L+ ++DGF    ++ V+  TNRP+ LD AL+RPGR DR +    P+L+G
Sbjct: 453 ANDERENTLNQLLVEMDGFTTADHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELQG 512

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF++H K +++  G   +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 513 RQEIFKVHLKKITLA-GDMTDLQNRLAVMTPGFSGADIANVCNEAALIAARNDCDAVRLE 571

Query: 438 DFLKAVDKVISGYKKFS 454
            F +A+++VI G ++ S
Sbjct: 572 HFEQAIERVIGGVERKS 588

>Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON}
           YER017C (REAL)
          Length = 761

 Score =  176 bits (447), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 147/259 (56%), Gaps = 9/259 (3%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           +++ +V GC +  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 286 ISFKNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 344

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
             +  F  V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 345 EANVPFFSVSGSEFVEMFVGVGASRVRDLFTQARSMSPSIIFIDEIDAIGKERGKGGALG 404

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 405 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 464

Query: 380 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 433
           GR  I+ +H K ++++  +R ++      ++ L P  TGA++ + C EA + A R   + 
Sbjct: 465 GRQQIYLVHLKRLNLDPLLRDDMDNLSGKLATLTPGFTGADIANACNEAALIAARHNDQY 524

Query: 434 ATEKDFLKAVDKVISGYKK 452
            T   F +A+++VI+G +K
Sbjct: 525 ITIHHFEQAIERVIAGLEK 543

>SAKL0F03894g Chr6 (312042..314270) [2229 bp, 742 aa] {ON} similar
           to uniprot|P39925 Saccharomyces cerevisiae YER017C AFG3
           Component with Yta12p of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 742

 Score =  176 bits (447), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/263 (36%), Positives = 145/263 (55%), Gaps = 11/263 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV GC +   ++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 267 VNFKDVAGCDEAKGEIMEFVHF-LKNPDKYKALGAKIPRGAILSGPPGTGKTLLAKATAG 325

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 326 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 385

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     I V+  TNRP+ LDPAL+RPGR DR ++   PD+E
Sbjct: 386 GANDEREATLNQLLVEMDGFSTTDQIVVLAGTNRPDVLDPALMRPGRFDRHIQIDAPDVE 445

Query: 380 GRANIFRIHTKSMSVERGIRWE--------LISRLCPNSTGAELRSVCTEAGMFAIRARR 431
           GR  I+++H   ++++  +            ++ L P   GA++ + C EA + A R + 
Sbjct: 446 GRKAIYKVHLTRLTLDPKLSKSENIQSLAGKLAALTPGFAGADIANACNEAALIAARRKE 505

Query: 432 KVATEKDFLKAVDKVISGYKKFS 454
                K F +A+++VI+G +K S
Sbjct: 506 PYVEFKHFDQAIERVIAGLEKKS 528

>SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P40341 Saccharomyces
           cerevisiae YMR089C YTA12 Component with Afg3p of the
           mitochondrial inner membrane m-AAA protease that
           mediates degradation of misfolded or unassembled
           proteins and is also required for correct assembly of
           mitochondrial enzyme complexes
          Length = 830

 Score =  177 bits (448), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV G  +  E++ E V   L  P R+  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 352 VKFKDVAGMDEAKEEVMEFVSF-LKEPSRYEKLGAKIPRGAILSGPPGTGKTLLAKATAG 410

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DEI              
Sbjct: 411 EAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSG 470

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +L+ ++DGF P  +I V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 471 ANDERENTLNQLLVEMDGFTPADHIVVLAGTNRPDILDQALMRPGRFDRHINIDKPELEG 530

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF++H   + +  G  ++L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 531 RKEIFQVHLAKIKLA-GEMYDLKNRLATLTPGFSGADIANVCNEAALIAARNDCTAVKLE 589

Query: 438 DFLKAVDKVISGYKKFS 454
            F +A+++VI G ++ S
Sbjct: 590 HFEQAIERVIGGVERKS 606

>YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON}
           AFG2ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms a
           hexameric complex; is essential for pre-60S maturation
           and release of several preribosome maturation factors;
           may be involved in degradation of aberrant mRNAs
          Length = 780

 Score =  176 bits (447), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/249 (38%), Positives = 139/249 (55%), Gaps = 4/249 (1%)

Query: 187 IDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 246
           I PS       E P V ++D+GG ++   K++E+++LPL + E FA LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEELKTKMKEMIQLPLEASETFARLGISAPKGVLLYG 557

Query: 247 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 306
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 307 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 366
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGSSTSAANHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRPGR 674

Query: 367 IDRKVEFSLPDLEGRANIFRIHTKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 425
           +DR +    PD+  R  I +  TK  + E  G+    ++      +GAE+  +C EAG+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNTEESGVDLHELADRTEGYSGAEVVLLCQEAGLA 734

Query: 426 AIRARRKVA 434
           AI     VA
Sbjct: 735 AIMEDLDVA 743

 Score =  168 bits (426), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 94/250 (37%), Positives = 142/250 (56%), Gaps = 10/250 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           ++Y  VGG   +IE L+  +E+PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 LSYAAVGGLDKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 322 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGKVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 418

Query: 381 RANIFRIHTKSMSVERGI----RWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 436
           R +I       MS +R +      + I+       GA+L ++C E+ M  I  +R + T+
Sbjct: 419 RFDILTKQFSRMSSDRHVLDSEAIKYIASKTHGYVGADLTALCRESVMKTI--QRGLGTD 476

Query: 437 KDFLKAVDKV 446
            +  K   KV
Sbjct: 477 ANIDKFSLKV 486

>Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON}
           (50661..53240) [2580 nt, 860 aa]
          Length = 859

 Score =  177 bits (448), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV GC +  E++ E V   L  P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 379 VKFKDVAGCDEAKEEIMEFVSF-LKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 437

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ A+     I+F DEI              
Sbjct: 438 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTAKENAPSIVFIDEIDAIGKARQKGNFSG 497

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +L+ ++DGF    +I V+  TNRP+ LD ALLRPGR DR +    P+L G
Sbjct: 498 ANDERENTLNQLLVEMDGFTTSDHIVVLAGTNRPDILDKALLRPGRFDRHINIDKPELSG 557

Query: 381 RANIFRIHTKSMSVERGIRWEL---ISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF +H K + +   I ++L   +S L P  +GA++ +VC EA + A R   +    +
Sbjct: 558 RKAIFEVHLKKIKIAGDI-FDLKNRLSALTPGFSGADIANVCNEAALIAARNEARFVKLE 616

Query: 438 DFLKAVDKVISGYKKFS 454
            F +A+++VI G ++ S
Sbjct: 617 HFEQAIERVIGGVERKS 633

>Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score =  176 bits (445), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 139/242 (57%), Gaps = 4/242 (1%)

Query: 187 IDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 246
           I PS       E P V ++D+GG +D   K++E+++LPL + E F  LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEDLKTKMKEMIQLPLEASETFTRLGITAPKGVLLYG 557

Query: 247 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 306
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEVFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 307 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 366
           I               + V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGGSTSAASHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDSALLRPGR 674

Query: 367 IDRKVEFSLPDLEGRANIFRIHTKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 425
           +DR +    PD+  R  I +  TK  ++E  GI  + ++R     +GAE+  +C E+G+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNIEESGIDLQELARRTEGYSGAEVVLLCQESGLS 734

Query: 426 AI 427
           AI
Sbjct: 735 AI 736

 Score =  170 bits (430), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 144/250 (57%), Gaps = 10/250 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           ++YT VGG + +IE L+  +++PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 ISYTAVGGLRKEIELLKSAIDIPLHQPALFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 322 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD+E 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGRLVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVEA 418

Query: 381 RANIFRIHTKSMSVERGI----RWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 436
           R +I       MS +R        +LI+       GA+L ++C E+ M  I  +R + T+
Sbjct: 419 RFDILTKQVSRMSPDRHSLDSEAIKLIASKTHGYVGADLTALCRESVMKTI--QRGLGTD 476

Query: 437 KDFLKAVDKV 446
            +  K   KV
Sbjct: 477 ANIDKFSLKV 486

>ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR089C (YTA12)
          Length = 818

 Score =  176 bits (445), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/256 (37%), Positives = 141/256 (55%), Gaps = 4/256 (1%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 331 VKFKDVAGCDEAKEEIMEFVSF-LKEPSRYERMGAQIPRGAILSGPPGTGKTLLAKATAG 389

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DEI              
Sbjct: 390 EAGVPFFSVSGSEFVEMFVGIGASRVRDLFKTARENAPAIIFIDEIDAIGKSRQKGNFSG 449

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +L+ ++DGF P  +I V+  TNR + LD AL+RPGR DR +    P+L G
Sbjct: 450 ANDERENTLNQLLVEMDGFTPSDHIVVLAGTNRQDVLDRALMRPGRFDRHIHIDKPELSG 509

Query: 381 RANIFRIHTKSMSV--ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
           R  IF++H   + +  + G   + ++ L P  +GA++ +VC EA + A R        + 
Sbjct: 510 RQEIFKVHLSKIKLAGDIGDLKDRLAALTPGFSGADIANVCNEAALIAARYDSSSVKLEH 569

Query: 439 FLKAVDKVISGYKKFS 454
           F +A+++VI G ++ S
Sbjct: 570 FEQAIERVIGGVERKS 585

>NDAI0J02320 Chr10 complement(562320..564656) [2337 bp, 778 aa] {ON}
           Anc_4.259
          Length = 778

 Score =  175 bits (444), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 137/242 (56%), Gaps = 3/242 (1%)

Query: 187 IDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 246
           I PS       E P V ++D+GG ++   K++E+++LPL +   FA LGI  PKG+LLYG
Sbjct: 495 IRPSAMREIFLEMPKVFWSDIGGQEELKRKMKEMIQLPLEASATFARLGISAPKGVLLYG 554

Query: 247 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 306
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 555 PPGCSKTLTAKALATESGINFLAVKGPEVFNKYVGESERAIREIFRKARAASPSIIFFDE 614

Query: 307 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 366
           I               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 615 I--DALSPDRDGGSSTSAASHVLTSLLNEIDGVEELKGVVIVAATNRPDEIDPALLRPGR 672

Query: 367 IDRKVEFSLPDLEGRANIFRIHTKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 425
           +DR +  + PD + R  I +  TK   +E   I+ E ++      +GAE+  +C EAG+ 
Sbjct: 673 LDRHIYVAPPDYDARLQILQKCTKKFQIENTNIKLEDLAERTAGCSGAEVVLLCQEAGLA 732

Query: 426 AI 427
           AI
Sbjct: 733 AI 734

 Score =  160 bits (406), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 138/250 (55%), Gaps = 10/250 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           +TY  +GG + ++E L+  + LPL  P  F   G+ PP+GILL+GPPGTGKT+  + VAN
Sbjct: 239 ITYDAIGGLRKEVELLQSTISLPLHQPTLFTDFGVTPPRGILLHGPPGTGKTMLLQCVAN 298

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
             +A  + + G  +V KY+GE    +R++F  A+  +  IIF DE+              
Sbjct: 299 TANAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEV---DSLAPNRANDD 355

Query: 322 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
             EV+ R +  L+T + G    G + V+ ATNRPN++DPAL RPGR D++VE  +PD + 
Sbjct: 356 AGEVESRVVATLLTLMSGMSAAGRVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDADA 415

Query: 381 RANIFRIHTKSMSVER----GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATE 436
           R +I   +   MS ER    G   + I+       GA+L ++C E+ M  I  +R +   
Sbjct: 416 RLDILLKNFSKMSTERHTLTGEDIKTIASKTHGYVGADLSALCRESVMKTI--QRGMHLY 473

Query: 437 KDFLKAVDKV 446
           KD   ++ KV
Sbjct: 474 KDIDSSLLKV 483

>KNAG0C03320 Chr3 complement(654346..656646) [2301 bp, 766 aa] {ON}
           Anc_7.430 YPR024W
          Length = 766

 Score =  175 bits (444), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 293 KTNVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 351

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 352 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 411

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 412 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDV 468

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I R+H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 469 RGRADILRLHMKKITMATDVEPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMSH 528

Query: 439 FLKAVDKVISGYKK 452
           F  A DK++ G ++
Sbjct: 529 FEWAKDKILMGAER 542

>CAGL0H09416g Chr8 (921571..923823) [2253 bp, 750 aa] {ON} highly
           similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017c AFG3 or uniprot|P40341 Saccharomyces cerevisiae
           YMR089c YTA12
          Length = 750

 Score =  175 bits (443), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 147/264 (55%), Gaps = 12/264 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           +++ DV GC +  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 275 ISFKDVAGCDEAKQEIMEFVHF-LKNPAKYTQLGAKIPRGAILSGPPGTGKTLLAKATAG 333

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 334 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKGGALG 393

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     + V+  TNR + LDPAL+RPGR DR +E   PD+ 
Sbjct: 394 GANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRMDVLDPALMRPGRFDRHIEIDAPDMS 453

Query: 380 GRANIFRIHTKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  I+ +H + ++++  +      R  L   ++ L P  TGA++ + C EA + A R +
Sbjct: 454 GRKAIYNVHLQRLNLDPKLTETAEKRDNLSGKLATLTPGFTGADIANACNEAALIAARHQ 513

Query: 431 RKVATEKDFLKAVDKVISGYKKFS 454
            K      F +A+++VI+G +K S
Sbjct: 514 DKYVELLHFEQAIERVIAGLEKKS 537

>TDEL0H02770 Chr8 (458980..461214) [2235 bp, 744 aa] {ON} Anc_7.168
           YER017C
          Length = 744

 Score =  175 bits (443), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 95/264 (35%), Positives = 145/264 (54%), Gaps = 12/264 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV GC +  +++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 265 VQFKDVAGCNEAKQEIMEFVHF-LKNPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 323

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
                F+ V GSE V+ +VG GA  VR+LFE  R     IIF DEI              
Sbjct: 324 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQGRKMAPSIIFVDEIDAIGKERGKGGAMG 383

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+E
Sbjct: 384 GSNDEREATLNQLLVEMDGFSTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDVE 443

Query: 380 GRANIFRIHTKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  I+ +H + +++++        R EL   ++ L P   GA++ + C EA + A R  
Sbjct: 444 GRKAIYLVHMRKLNLDKRFTTLQSEREELAGKLAALTPGFAGADIANACNEAALIAARHN 503

Query: 431 RKVATEKDFLKAVDKVISGYKKFS 454
                   F +A+++VI+G +K S
Sbjct: 504 DPCIELHHFEQAIERVIAGLEKKS 527

>KAFR0K02060 Chr11 (418631..420811) [2181 bp, 726 aa] {ON} Anc_7.430
           YPR024W
          Length = 726

 Score =  174 bits (440), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K DV + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 254 KTDVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 312

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +RELF+ AR +   IIF DE+           
Sbjct: 313 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFQQARNRSPAIIFIDELDAIGGKRNPKD 372

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 373 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 429

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I + H + +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 430 RGRADILKHHMQKITLAPDVDPTIIARGTPGLSGAELSNLVNQAAVYACQKNAIAVDMSH 489

Query: 439 FLKAVDKVISGYKK 452
           F  A DK + G +K
Sbjct: 490 FEWAKDKTLMGAEK 503

>Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON}
           YER017C (REAL)
          Length = 760

 Score =  174 bits (441), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 146/259 (56%), Gaps = 9/259 (3%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           +++ +V GC +  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 284 ISFRNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 342

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 343 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 402

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 403 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 462

Query: 380 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 433
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 463 GRQQIYLVHLKKLNLDPLLTDDMDNLSGKLATLTPGFTGADIANACNEAALIAARHNDSY 522

Query: 434 ATEKDFLKAVDKVISGYKK 452
            T   F +A+++VI+G +K
Sbjct: 523 ITIHHFEQAIERVIAGLEK 541

>NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON}
           Anc_7.430
          Length = 750

 Score =  174 bits (440), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 278 KTNVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGTLPKGVLLTGPPGTGKTLLARA 336

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 337 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 396

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 397 QAY---AKQTLNQLLVELDGFSQTTGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 453

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I ++H K +++   +   LI+R  P  +GAEL ++  +A ++A +          
Sbjct: 454 RGRADILKLHMKKVTLASDVDPTLIARGTPGLSGAELSNLVNQAAVYACQQNAIAVDMSH 513

Query: 439 FLKAVDKVISGYKK 452
           F  A DK++ G ++
Sbjct: 514 FEWAKDKILMGAER 527

>TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.472
           YMR089C
          Length = 792

 Score =  174 bits (441), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 98/266 (36%), Positives = 142/266 (53%), Gaps = 6/266 (2%)

Query: 193 MMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGK 252
           M   +    V +  V GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGK
Sbjct: 317 MFNSDTNVKVKFNAVAGCDEAKEEIMEFVSF-LKEPSRYERMGAKIPRGAILSGPPGTGK 375

Query: 253 TLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXX 312
           TL A+A A      F  V GSE V+ +VG GA  VR+LF+ A+     I+F DEI     
Sbjct: 376 TLLAKATAGEAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTAKENAPSIVFVDEIDAIGK 435

Query: 313 XXXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKV 371
                     N E + T+ +L+ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +
Sbjct: 436 ARQKGNFSGANDERENTLNQLLVEMDGFTSSDHVVVLAGTNRPDILDKALLRPGRFDRHI 495

Query: 372 EFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIR 428
               P+L GR  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R
Sbjct: 496 NIDKPELSGRKAIFDVHLKKIKISDDI-YDLKNRLAVLTPGFSGADIANVCNEAALIAAR 554

Query: 429 ARRKVATEKDFLKAVDKVISGYKKFS 454
                     F +AV++VI G ++ S
Sbjct: 555 DDSHFVALNHFEQAVERVIGGVERKS 580

>Kwal_23.4194 s23 (612204..614528) [2325 bp, 774 aa] {ON} YLR397C
           (AFG2) - homology to the CDC48 gene product [contig 1]
           FULL
          Length = 774

 Score =  174 bits (441), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 148/277 (53%), Gaps = 6/277 (2%)

Query: 187 IDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 246
           I PS       E P V ++D+GG  D   K++E+++LPL + E F  LG++ PKGILLYG
Sbjct: 491 IRPSAMREIFLEMPKVYWSDIGGQHDLKLKMKEMIQLPLEASESFKRLGVNAPKGILLYG 550

Query: 247 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 306
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 551 PPGCSKTLTAKALATESGVNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDE 610

Query: 307 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 366
           I               +     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 611 I--DALSPDRDSGGSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDAALLRPGR 668

Query: 367 IDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMF 425
           +DR +    PD + R  I    TK+  +E   +  E ++      +GAE+  +C EAG+ 
Sbjct: 669 LDRHIYVGPPDFDARLQILNKCTKNFHMENQDQMLEDLAHKTEGCSGAEVVLLCQEAGLA 728

Query: 426 AIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQY 462
           AI     + TE    +  +K +SG  +    +  +QY
Sbjct: 729 AI--MENLETENVEQRHFEKALSGISR-GINAEMLQY 762

 Score =  161 bits (407), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 93/249 (37%), Positives = 137/249 (55%), Gaps = 8/249 (3%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           ++Y  VGG   +IE L+  +ELPL  P  FA  G+ PP+GILL+GPPGTGKT+  R VA 
Sbjct: 237 MSYNSVGGLNKEIELLKRTIELPLHQPTLFAEFGVTPPRGILLHGPPGTGKTMLLRCVAG 296

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
             +A  + + G  +V KY+GE    +R++F  AR  +  I+F DEI              
Sbjct: 297 EANAHVLTINGPSIVSKYLGETEAALRDIFNEARLYQPSIVFIDEI---DSLAPSRASDD 353

Query: 322 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
             EV+ R +  L+T +DG    G + ++ ATNRPN +D AL RPGR+D++VE  +PD+E 
Sbjct: 354 SGEVESRVVATLLTLMDGMGSSGRVVIVAATNRPNAIDTALRRPGRLDQEVEIGIPDVES 413

Query: 381 RANIFRIHTKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGMFAIRARRKVATE 436
           R +I     + +S +R  +  E I  +   +    GA+L ++C EA M  ++        
Sbjct: 414 RHDILTKQFRKVSEKRHELTLEDIESIASKTHGYVGADLVALCREAVMKTLQRGVVHNLS 473

Query: 437 KDFLKAVDK 445
           KD LK   K
Sbjct: 474 KDELKVTMK 482

>Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score =  174 bits (441), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 146/266 (54%), Gaps = 6/266 (2%)

Query: 187 IDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 246
           I PS       E P V ++D+GG ++  +K++E+++LPL + E F+ LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEELKKKMKEMIQLPLEASETFSRLGISAPKGVLLYG 557

Query: 247 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 306
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 307 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 366
           I               N V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGSSTSAANHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRPGR 674

Query: 367 IDRKVEFSLPDLEGRANIFRIHTKSMSV-ERGIRWELISRLCPNSTGAELRSVCTEAGMF 425
           +DR +    PD+  R  I +  TK  +  E G+    ++      +GAE+  +C EAG+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNTKESGVDLYELADRTEGYSGAEVVLLCQEAGLA 734

Query: 426 AIRARRKVATE--KDFLKAVDKVISG 449
           AI     V     + F KA + +  G
Sbjct: 735 AIMDNLDVTMVELRHFEKAFEGIARG 760

 Score =  174 bits (440), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 99/252 (39%), Positives = 145/252 (57%), Gaps = 14/252 (5%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           ++YT VGG   +IE L+  +E+PL  PE F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 ISYTAVGGLNKEIESLKSAIEIPLHQPELFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DEI              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETESALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 322 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGRVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 418

Query: 381 RANIFRIHTKSMSVER------GIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVA 434
           R +I       MS ER      GI+   I+       GA+L ++C E+ M  I  +R + 
Sbjct: 419 RFDILTKQFSRMSPERHLLNSEGIKH--IASKTHGYVGADLTALCRESVMKTI--QRGLG 474

Query: 435 TEKDFLKAVDKV 446
           T+ +  K   KV
Sbjct: 475 TDANIDKFSLKV 486

>Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON}
           YER017C (REAL)
          Length = 762

 Score =  174 bits (440), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 146/259 (56%), Gaps = 9/259 (3%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           +++ +V GC +  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 287 ISFKNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 345

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 346 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 405

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 406 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 465

Query: 380 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 433
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 466 GRQQIYLVHLKRLNLDPLLTDDMGNLSGKLATLTPGFTGADIANACNEAALIAARHNDPY 525

Query: 434 ATEKDFLKAVDKVISGYKK 452
            T   F +A+++VI+G +K
Sbjct: 526 ITIHHFEQAIERVIAGLEK 544

>ZYRO0F13024g Chr6 (1063334..1065556) [2223 bp, 740 aa] {ON} similar
           to uniprot|P32795 Saccharomyces cerevisiae YPR024W YME1
           Mitochondrial inner membrane protease of the AAA family
           responsible for degradation of unfolded or misfolded
           mitochondrial gene products mutation causes an elevated
           rate of mitochondrial turnover
          Length = 740

 Score =  173 bits (439), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 268 KTNVKFDDVHGCDEARAELEEIVDF-LKDPAKYESLGGTLPKGVLLTGPPGTGKTLLARA 326

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ VRELF  AR++   I+F DE+           
Sbjct: 327 TAGEAGVDFFFMSGSEFDEVYVGVGAKRVRELFSQARSRAPAIVFIDELDAIGGKRNPKD 386

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 387 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKLVNVDLPDV 443

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I + H K +++   +   LI+R  P  +GAEL ++  +A ++A +          
Sbjct: 444 RGRADILKHHMKKITLANDVDPTLIARGTPGLSGAELANLVNQAAVYACQKNAISVDMSH 503

Query: 439 FLKAVDKVISGYKK 452
           F  A DK++ G ++
Sbjct: 504 FEWAKDKILLGAER 517

>KLLA0E06711g Chr5 complement(607187..609496) [2310 bp, 769 aa] {ON}
           highly similar to uniprot|P32795 Saccharomyces
           cerevisiae YPR024W YME1 Mitochondrial inner membrane
           protease of the AAA family responsible for degradation
           of unfolded or misfolded mitochondrial gene products
           mutation causes an elevated rate of mitochondrial
           turnover
          Length = 769

 Score =  173 bits (439), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 297 KTNVRFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 355

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 356 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 415

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 416 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 472

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I R H K ++V   +   +I+R  P  +GAEL ++  +A ++A +        + 
Sbjct: 473 RGRADILRHHMKKVTVAPDVDPTIIARGTPGLSGAELMNLVNQAAVYACQKNAIAVDMQH 532

Query: 439 FLKAVDKVISGYKK 452
           F  A DK++ G ++
Sbjct: 533 FEWAKDKILMGAER 546

>Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {ON}
           YLR397C (REAL)
          Length = 777

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 100/271 (36%), Positives = 146/271 (53%), Gaps = 10/271 (3%)

Query: 164 IEEGMRVGVDRSKYHIELPLPP------RIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKL 217
           I+ G+ +  D  K+ + + L         I PS       E P V ++D+GG  +   K+
Sbjct: 466 IQRGLGLDADIDKFSLIVTLKDVESAMVDIRPSAMREIFLEMPKVYWSDIGGQDELKTKM 525

Query: 218 REVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQ 277
           +E+++LPL + E FA LGI  PKG+LLYGPPG  KTL A+A+A  +   F  V G E+  
Sbjct: 526 KEMIQLPLEASETFARLGISAPKGVLLYGPPGCSKTLTAKALATESGINFFAVKGPEVFN 585

Query: 278 KYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLD 337
           KYVGE  R +RE+F  AR+    IIFFDEI               N V   +  L+ ++D
Sbjct: 586 KYVGESERAIREIFRKARSAAPSIIFFDEIDALSPVRDGGSTSAANHV---LTSLLNEID 642

Query: 338 GFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVE-R 396
           G +    + ++ ATNRP+ +D ALLRPGR+DR +    PD   R  I +  TK  + E  
Sbjct: 643 GVEELKGVVIVAATNRPDEIDGALLRPGRLDRHIYVGPPDANARLEILKKCTKKFNTEGS 702

Query: 397 GIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           G+  + ++      +GAE+  +C EAG+ AI
Sbjct: 703 GVDLQELAARTKGYSGAEVVLLCQEAGLAAI 733

 Score =  170 bits (430), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 149/283 (52%), Gaps = 16/283 (5%)

Query: 159 VSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPD--------VTYTDVGGC 210
           VS  D+      G    +Y++  P   R   +    T E +          ++Y  VGG 
Sbjct: 188 VSQLDLNSDEVYGSSNGQYYLSPPFIFRKGSTHIAFTKEMQASRKYNLPEPISYAAVGGL 247

Query: 211 KDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 270
             +IE L+  +E+PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN ++A  + +
Sbjct: 248 NKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVANTSNAHVLTI 307

Query: 271 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQ-RTM 329
            G  +V KY+GE    +RE+F  AR  +  IIF DEI                EV+ R +
Sbjct: 308 NGPSIVSKYLGETESALREIFNEARKYQPSIIFIDEI---DSIAPNRANDDSGEVESRVV 364

Query: 330 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHT 389
             L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE  +PD++ R +I     
Sbjct: 365 ATLLTLMDGMGAAGRLIVIAATNRPNCVDPALRRPGRFDQEVEIGIPDVDARFDILTRQF 424

Query: 390 KSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 428
             MS +R  +  E I  +   +    GA+L ++C E+ M  I+
Sbjct: 425 SKMSPDRHALNLEEIKHIASKTHGYVGADLTALCRESVMKTIQ 467

>YLL034C Chr12 complement(70633..73146) [2514 bp, 837 aa] {ON}
           RIX7Putative ATPase of the AAA family, required for
           export of pre-ribosomal large subunits from the nucleus;
           distributed between the nucleolus, nucleoplasm, and
           nuclear periphery depending on growth conditions
          Length = 837

 Score =  174 bits (440), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 144/257 (56%), Gaps = 7/257 (2%)

Query: 176 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLG 235
           KY   L   P I P+         PDVT+ +VG  +    +L   +  P+  PE +  +G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRLELNMAIVQPIKRPELYEKVG 563

Query: 236 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 295
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 296 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 355
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 356 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMS--VERGIRWELISR--LCPNST 411
            +DPA+LRPGR+D+ +   LP+ E + +I +  TKS    +   + +E I R   C N +
Sbjct: 681 MIDPAMLRPGRLDKSLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEEIIRNEKCNNFS 740

Query: 412 GAELRSVCTEAGMFAIR 428
           GA+L ++  E+ + A++
Sbjct: 741 GADLAALVRESSVLALK 757

 Score =  148 bits (373), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           P+ +   +GG  D + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A      FI +    +V    GE  + +R+LF+ AR+   C++FFDEI            
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEARSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 320 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNV 377

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 428
           P+   R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILKKMSDNLKIDGAIDFAKLAKLTPGFVGADLKALVTAAGTCAIK 430

>Ecym_7123 Chr7 complement(247275..249458) [2184 bp, 727 aa] {ON}
           similar to Ashbya gossypii AGL274W
          Length = 727

 Score =  172 bits (437), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 147/255 (57%), Gaps = 6/255 (2%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG + PKG+LL GPPGTGKTL ARA
Sbjct: 255 KTNVKFEDVRGCDEARAELEEIVDF-LKDPTKYESLGGNLPKGVLLTGPPGTGKTLLARA 313

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +RELF  AR     IIF DE+           
Sbjct: 314 TAGEAGVDFFFMSGSEFDEIYVGVGAKRIRELFAHARAHAPAIIFIDELDAIGGKRNPKD 373

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 374 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVTVDLPDV 430

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I + H K +++  G+   +I+R  P  +GAEL ++  +A ++A + +  +A +  
Sbjct: 431 RGRADILQHHMKKVTLAAGVDPYIIARGTPGLSGAELMNLVNQAAVYACQ-QNAIAVDMS 489

Query: 439 FLK-AVDKVISGYKK 452
            L+ A DK++ G ++
Sbjct: 490 HLEWAKDKILMGAER 504

>YER017C Chr5 complement(189503..191788) [2286 bp, 761 aa] {ON}
           AFG3Component, with Yta12p, of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 761

 Score =  173 bits (438), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 146/259 (56%), Gaps = 9/259 (3%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           +++ +V GC +  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 285 ISFKNVAGCDEAKQEIMEFVHF-LKNPGKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 343

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXX--XXX 319
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DEI              
Sbjct: 344 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 403

Query: 320 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 404 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 463

Query: 380 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRARRKV 433
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 464 GRQQIYLVHLKRLNLDPLLTDDMNNLSGKLATLTPGFTGADIANACNEAALIAARHNDPY 523

Query: 434 ATEKDFLKAVDKVISGYKK 452
            T   F +A+++VI+G +K
Sbjct: 524 ITIHHFEQAIERVIAGLEK 542

>Ecym_6218 Chr6 complement(409972..412488) [2517 bp, 838 aa] {ON}
           similar to Ashbya gossypii AFR188W
          Length = 838

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 141/257 (54%), Gaps = 7/257 (2%)

Query: 176 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLG 235
           KY   L   P I P+         PDVT+T+VG       +L   +  P+  PE +  +G
Sbjct: 502 KYEDFLKALPTIQPTAKREGFATVPDVTWTNVGALTKIRMELNMAIVQPIKRPELYEKVG 561

Query: 236 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 295
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 562 ISAPAGVLLWGPPGCGKTLIAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 621

Query: 296 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 355
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 622 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIAATNRPD 678

Query: 356 TLDPALLRPGRIDRKVEFSLPDLEGRANIFR--IHTKSMSVERGIRWELI--SRLCPNST 411
            +DPA+LRPGR+D+ +   LPDL  + +I +  I +    +   I   +I     C N +
Sbjct: 679 IIDPAMLRPGRLDKTLFIELPDLTEKHDILKTLIRSNGTPLAPNIDLSVIVSDERCRNFS 738

Query: 412 GAELRSVCTEAGMFAIR 428
           GA+L S+  E+ + A++
Sbjct: 739 GADLASLVRESSVLALK 755

 Score =  150 bits (379), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           P    + +GG  D + +L E++ LP+L PE +A+ GI+PP+G+L +GPPG GKT  A A+
Sbjct: 206 PQTDLSSLGGMDDVVAQLMELIGLPILHPEIYASTGIEPPRGVLFHGPPGCGKTSIANAL 265

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 266 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAIAPKRDGGAQ 325

Query: 320 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                 +R + +L+T +D   FD      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 326 REME--RRIVAQLLTSMDELSFDKTDGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 383

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 428
           P+   R +I +  T ++ +   I +  +S+L P   GA+L+++ T AG  AI+
Sbjct: 384 PNEASRMHILKKMTSNLKINGQIDFVKLSKLTPGFVGADLKALVTAAGTCAIK 436

>Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  173 bits (438), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 143/257 (55%), Gaps = 7/257 (2%)

Query: 176 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLG 235
           KY   L   P I P+         PDVT+ +VG  +    +L   +  P+  PE +  +G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRIELNMAIVQPIKRPELYEKVG 563

Query: 236 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 295
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 296 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 355
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 356 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNST 411
            +DPA+LRPGR+D+ +   LP+ E + +I +  TKS    +S +      + +  C N +
Sbjct: 681 MIDPAMLRPGRLDKTLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEKIITNEKCNNFS 740

Query: 412 GAELRSVCTEAGMFAIR 428
           GA+L ++  E+ + A++
Sbjct: 741 GADLAALVRESSVLALK 757

 Score =  145 bits (367), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           P+ +   +GG  D + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 260 AGELKVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 320 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--KRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNV 377

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 428
           P+   R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILKKMSNNLKIDGIIDFAKLAKLTPGFVGADLKALVTAAGTCAIK 430

>Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  173 bits (438), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 143/257 (55%), Gaps = 7/257 (2%)

Query: 176 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLG 235
           KY   L   P I P+         PDVT+ +VG  +    +L   +  P+  PE +  +G
Sbjct: 505 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRVELNMAIVQPIKRPELYEKVG 564

Query: 236 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 295
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 565 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 624

Query: 296 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 355
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 625 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 681

Query: 356 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNST 411
            +DPA+LRPGR+D+ +   LP+ E + +I +  TKS    +S +      + +  C N +
Sbjct: 682 MIDPAMLRPGRLDKTLFIELPNTEEKLDIIKTLTKSHGTPLSDDVDFEKIITNEKCNNYS 741

Query: 412 GAELRSVCTEAGMFAIR 428
           GA+L ++  E+ + A++
Sbjct: 742 GADLAALVRESSVLALK 758

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 131/232 (56%), Gaps = 6/232 (2%)

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           P+ +   +GG  D I +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVIAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 260 AGELKVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 320 XXXNEVQRTMLELITQLDGFD-PRGNIK---VMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                 +R + +L+T +D     + N K   ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIVGATNRPDSLDSALRRAGRFDREICLNV 377

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 427
           P+   R +I +  +  + ++  I +  +++L P   GA+L+++ T AG  AI
Sbjct: 378 PNEVSRLHILKKMSDKLKIDGTIDFAKLAKLTPGFVGADLKALVTAAGTCAI 429

>Skud_12.33 Chr12 complement(61780..64293) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  173 bits (438), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 145/257 (56%), Gaps = 7/257 (2%)

Query: 176 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLG 235
           KY   L   P I P+         PDVT+ +VG  +    +L   +  P+  PE +  +G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRIELNMAIVQPIKRPELYEKVG 563

Query: 236 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 295
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 296 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 355
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 356 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMS--VERGIRWELI--SRLCPNST 411
            +DPA+LRPGR+D+ +   LP++E + +I +  TKS    +   + +E I  +  C N +
Sbjct: 681 MIDPAMLRPGRLDKTLFIELPNMEEKLDIIKTLTKSHGTPLSGDVDFEKIIKNEKCNNFS 740

Query: 412 GAELRSVCTEAGMFAIR 428
           GA+L ++  E+ + A++
Sbjct: 741 GADLAALVRESSVLALK 757

 Score =  148 bits (373), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 130/233 (55%), Gaps = 6/233 (2%)

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           P+ +   +GG  D + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKTLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDEI            
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 320 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDSALRRAGRFDREICLNV 377

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 428
           P+   R +I R  +  + ++  I +  +S+L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILRKMSDDLKIDGAIDFAKLSKLTPGFVGADLKALVTAAGTCAIK 430

>ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 830

 Score =  172 bits (437), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 139/255 (54%), Gaps = 6/255 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV GC +  E++ E V   L  P R+  +G   P+G +L G PGTGKTL A+A A 
Sbjct: 351 VKFKDVAGCDEAKEEIEEFVSF-LKEPSRYEKMGAKIPRGAILSGAPGTGKTLLAKATAG 409

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     +IF DEI              
Sbjct: 410 EAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMIFVDEIDAIGKARQKGNFSG 469

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR V    P+L G
Sbjct: 470 ANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDILDRALLRPGRFDRHVNIDKPELSG 529

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R  IF +H K + +   I ++L +RL    P  +GA++ + C EA + A R         
Sbjct: 530 RQAIFEVHLKKIKLAGDI-FDLKNRLAALTPGFSGADIANACNEAALIAARNESDSVKLV 588

Query: 438 DFLKAVDKVISGYKK 452
            F +A+++VI G ++
Sbjct: 589 HFEQAIERVIGGVER 603

>SAKL0H25630g Chr8 (2244348..2246840) [2493 bp, 830 aa] {ON} highly
           similar to uniprot|Q07844 Saccharomyces cerevisiae
           YLL034C RIX7 Putative ATPase of the AAA family required
           for export of pre-ribosomal large subunits from the
           nucleus distributed between the nucleolus nucleoplasm
           and nuclear periphery depending on growth conditions
          Length = 830

 Score =  172 bits (437), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 147/258 (56%), Gaps = 9/258 (3%)

Query: 176 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGC-KDQIEKLREVVELPLLSPERFATL 234
           KY   L   P I P+         PDVT+++VG   K +IE    +V+ P+  PE +  +
Sbjct: 498 KYEDFLKALPTIQPTAKREGFATVPDVTWSNVGALGKTRIELNMAIVQ-PIKRPELYEKV 556

Query: 235 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 294
           GI  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  A
Sbjct: 557 GISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRA 616

Query: 295 RTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 354
           R    CIIFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP
Sbjct: 617 RASVPCIIFFDELDALVPRRDTALSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRP 673

Query: 355 NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNS 410
           + +DPA+LRPGR+D+ +   LP+ + + +I +   KS    +S +  I+  +    C N 
Sbjct: 674 DMIDPAMLRPGRLDKTLFIELPNYDEKLDIVKTLIKSNGTPLSSDVDIQCIVADERCRNF 733

Query: 411 TGAELRSVCTEAGMFAIR 428
           +GA+L ++  E+ + A++
Sbjct: 734 SGADLAALVRESSVLALK 751

 Score =  153 bits (387), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 133/233 (57%), Gaps = 6/233 (2%)

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           P      +GG  D I +L E++ LP+L PE +A+ G++PP+G+LL+GPPG GKT  A A+
Sbjct: 203 PTTNLATLGGMDDVIAQLMELIGLPILHPEIYASTGVEPPRGVLLHGPPGCGKTSIANAL 262

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A      FI +    +V    GE  + +R+LF+ A+    C++FFDEI            
Sbjct: 263 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKNLAPCLVFFDEIDAITPKRDGGAQ 322

Query: 320 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                 +R + +L+T +D   F+  G   + V+ ATNRP++LDPAL R GR DR++  ++
Sbjct: 323 REME--RRIVAQLLTSMDELSFEKTGGKPVIVIGATNRPDSLDPALRRAGRFDREICLNV 380

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 428
           P+   R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 381 PNEISRLHILKKMSSALKIDGTIDFSKLAKLTPGFVGADLKALTTAAGTCAIK 433

>KAFR0G02800 Chr7 complement(581262..583613) [2352 bp, 783 aa] {ON}
           Anc_7.168 YER017C
          Length = 783

 Score =  172 bits (436), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 142/262 (54%), Gaps = 12/262 (4%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           + + DV GC++  +++ E V   L SP+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 303 IQFKDVAGCQEAKQEIMEFVHF-LKSPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 361

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXX- 320
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DEI              
Sbjct: 362 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKNGALG 421

Query: 321 -XXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 379
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 422 GANDEREATLNQLLVEMDGFTTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDIT 481

Query: 380 GRANIFRIHTKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 430
           GR  I+ +H   + +         +  +    ++ L P  TGA++ + C EA + A R +
Sbjct: 482 GRKEIYLVHLAKLHLDPVFTKTKKDGDMLAGKLATLTPGFTGADIANACNEAALIAARYK 541

Query: 431 RKVATEKDFLKAVDKVISGYKK 452
                   F +A+++VI+G +K
Sbjct: 542 DPYVGLSHFEQAIERVIAGLEK 563

>KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.472
           YMR089C
          Length = 845

 Score =  172 bits (436), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 142/257 (55%), Gaps = 6/257 (2%)

Query: 202 VTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 261
           V + DV GC +  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 366 VKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 424

Query: 262 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXX 321
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DEI              
Sbjct: 425 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNISG 484

Query: 322 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 380
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +    P+L G
Sbjct: 485 ANDERENTLNQMLVEMDGFTAADHVVVLAGTNRPDILDKALLRPGRFDRHINLDNPELSG 544

Query: 381 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRARRKVATEK 437
           R +IF +H + + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 545 RKDIFAVHLQKLKLAGDI-YDLKNRLAALTPGFSGADIANVCNEAALIAARNDCDSVKLV 603

Query: 438 DFLKAVDKVISGYKKFS 454
            F +A+++VI G ++ S
Sbjct: 604 HFEQAIERVIGGVERKS 620

>NDAI0A01390 Chr1 complement(310386..312524) [2139 bp, 712 aa] {ON}
           Anc_7.430
          Length = 712

 Score =  171 bits (433), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 145/255 (56%), Gaps = 6/255 (2%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 305 KTNVKFDDVQGCDEARAELEEIVDF-LKDPTKYESLGGTLPKGVLLTGPPGTGKTLLARA 363

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 364 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 423

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 424 QAY---AKQTLNQLLVELDGFSQSTGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 480

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I + H K +++   +   LI+R  P  +GAEL ++  +A ++A + +  +A +  
Sbjct: 481 RGRADILKHHMKKVTLASDVDPTLIARGTPGLSGAELSNLVNQAAVYACQ-QNAIAVDMS 539

Query: 439 FLK-AVDKVISGYKK 452
            L+ A DK++ G ++
Sbjct: 540 HLEWAKDKILMGAER 554

>SAKL0F13376g Chr6 (1058414..1060639) [2226 bp, 741 aa] {ON} highly
           similar to uniprot|P32795 Saccharomyces cerevisiae
           YPR024W YME1 Mitochondrial inner membrane protease of
           the AAA family responsible for degradation of unfolded
           or misfolded mitochondrial gene products mutation causes
           an elevated rate of mitochondrial turnover
          Length = 741

 Score =  171 bits (434), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 269 KTNVKFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 327

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 328 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 387

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 388 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 444

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 445 RGRADILKHHMKKVTLASEVDPTIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMSH 504

Query: 439 FLKAVDKVISGYKK 452
           F  A DK++ G ++
Sbjct: 505 FEWAKDKILMGAER 518

>NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23
          Length = 857

 Score =  172 bits (436), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 155/288 (53%), Gaps = 13/288 (4%)

Query: 145 LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY 204
           L  I KF+    E   P + E+  ++ +   KY   L   P I P+         PDVT+
Sbjct: 496 LSIIQKFIQNFPE---PLNDEQLAQLSI---KYEDFLKALPTIQPTAKREGFATVPDVTW 549

Query: 205 TDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTD 264
            +VG       +L   +  P+  PE +  +GI+ P G+LL+GPPG GKTL A+AVAN + 
Sbjct: 550 ANVGALGKVRVELNMAIVQPIKRPELYEKVGINAPAGVLLWGPPGCGKTLLAKAVANESR 609

Query: 265 ATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNE 324
           A FI + G EL+ KYVGE  R +R++F  AR    C+IFFDE+               + 
Sbjct: 610 ANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDTSLSESSSR 669

Query: 325 VQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANI 384
           V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ E + +I
Sbjct: 670 VVNTLL---TELDGLNDRRGIFVVAATNRPDMIDPAMLRPGRLDKTIFIELPNYEEKVDI 726

Query: 385 FRIHTKSMS--VERGIRWELI--SRLCPNSTGAELRSVCTEAGMFAIR 428
               ++S    +  G+ +  I     C N +GA+L ++  E+ + A++
Sbjct: 727 ITTVSRSSGTPLAEGVDFRKIIQDERCRNFSGADLAALVRESSVLALK 774

 Score =  145 bits (366), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           P      +GG  D I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 203 PSSDLNSLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 262

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A      FI +    +V    GE  + +RELFE A++   C++FFDEI            
Sbjct: 263 AGELKVPFISISAPSVVSGMSGESEKKLRELFEEAKSLAPCLMFFDEIDAITPKRDGGAQ 322

Query: 320 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                 +R + +L+T +D    +  G   + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 323 REME--RRIVAQLLTSMDELSMEQTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 380

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 428
           P+   R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 381 PNEVSRLHILKKMSNNLKIDGEIDFLKLAKLTPGFVGADLKALTTAAGTCAIK 433

>Suva_16.351 Chr16 (616052..618295) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  171 bits (434), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +R+LF  AR++   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVNMSH 510

Query: 439 FLKAVDKVISGYKK 452
           F  A DK++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highly
           similar to uniprot|P32795 Saccharomyces cerevisiae
           YPR024w protease
          Length = 745

 Score =  171 bits (433), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 272 KTNVKFDDVRGCDEARAELEEIVDF-LKDPAKYESLGGKLPKGVLLTGPPGTGKTLLARA 330

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 331 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 390

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 391 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 447

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 448 RGRADILKHHMKKITLAPNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMTH 507

Query: 439 FLKAVDKVISGYKK 452
           F  A DK++ G ++
Sbjct: 508 FEWAKDKILMGAER 521

>TDEL0C02930 Chr3 (516526..518748) [2223 bp, 740 aa] {ON} Anc_7.430
           YPR024W
          Length = 740

 Score =  171 bits (432), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 267 KTNVKFDDVCGCDEARAELEEIVDF-LKDPAKYESLGGSLPKGVLLTGPPGTGKTLLARA 325

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +RELF  AR +   I+F DE+           
Sbjct: 326 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKD 385

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 386 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 442

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GR++I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +        + 
Sbjct: 443 RGRSDILKHHMKKITMAADVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMQH 502

Query: 439 FLKAVDKVISGYKK 452
           F  A DK++ G ++
Sbjct: 503 FEWAKDKILMGAER 516

>TBLA0F01470 Chr6 (359540..361948) [2409 bp, 802 aa] {ON} Anc_7.430
           YPR024W
          Length = 802

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K DV + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 332 KTDVKFDDVRGCDEARAELEEIVDF-LKDPAKYESLGGKLPKGVLLTGPPGTGKTLLARA 390

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F+ + GSE  + YVG GA+ +R+LF  AR K   IIF DE+           
Sbjct: 391 TAGEAGVDFLFMSGSEFDEVYVGVGAKRIRDLFAQARAKAPAIIFIDELDAIGGKRNPKD 450

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P+ LD AL RPGR D+ V   LPD+
Sbjct: 451 QAY---AKQTLNQLLVELDGFSQTTGIIIIGATNFPDALDKALTRPGRFDKIVNVDLPDV 507

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GR++I R H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 508 RGRSDILRHHMKKITLAPDVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVNMSH 567

Query: 439 FLKAVDKVISGYKK 452
              A DK++ G +K
Sbjct: 568 LEWAKDKILMGAEK 581

>YPR024W Chr16 (610481..612724) [2244 bp, 747 aa] {ON}
           YME1Catalytic subunit of the mitochondrial inner
           membrane i-AAA protease complex, which is responsible
           for degradation of unfolded or misfolded mitochondrial
           gene products; mutation causes an elevated rate of
           mitochondrial turnover
          Length = 747

 Score =  171 bits (432), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +R+LF  AR++   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAVSVDMSH 510

Query: 439 FLKAVDKVISGYKK 452
           F  A DK++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034c
          Length = 834

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 144/257 (56%), Gaps = 7/257 (2%)

Query: 176 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLG 235
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 503 KYEDFLKALPTIQPTAKREGFATVPDVTWSNVGALQKVRIELNMAIVQPIKRPELYEKVG 562

Query: 236 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 295
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 563 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 622

Query: 296 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 355
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 623 ASVPCVIFFDELDALVPRRDTSMSESSSRVVNTLL---TELDGLNDRHGIFVVGATNRPD 679

Query: 356 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNST 411
            +DPA+LRPGR+D+ +   LP+ + + +I R  T S    +S +  ++  +    C N +
Sbjct: 680 MIDPAMLRPGRLDKTLFIELPNEQEKFDIIRTLTISNGTPLSKDVDLKEIVADERCRNFS 739

Query: 412 GAELRSVCTEAGMFAIR 428
           GA+L ++  E+ + A++
Sbjct: 740 GADLAALVRESSVLALK 756

 Score =  145 bits (366), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 129/233 (55%), Gaps = 6/233 (2%)

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           P  + + +GG  D I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 193 PTSSLSALGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 252

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A      FI +    +V    GE  + +RELF+ A++   C++FFDEI            
Sbjct: 253 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLMFFDEIDAITPKRDGGAQ 312

Query: 320 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                 +R + +L+T +D           + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 313 REME--RRIVAQLLTSMDELTLSNTNGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 370

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 428
           P+   R +I +     + ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 371 PNEISRLHILKKMAGKLKIDGEIDFHKLAKLTPGFVGADLKALTTAAGTCAIK 423

>Smik_16.265 Chr16 (486410..488653) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  170 bits (431), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +R+LF  AR++   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAVSVDMSH 510

Query: 439 FLKAVDKVISGYKK 452
           F  A DK++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>TDEL0E01110 Chr5 (227041..229377) [2337 bp, 778 aa] {ON} Anc_4.259
           YLR397C
          Length = 778

 Score =  171 bits (432), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/268 (35%), Positives = 146/268 (54%), Gaps = 7/268 (2%)

Query: 187 IDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 246
           + PS       E P V ++D+GG ++   K+ E+++LPL + E F+ LG+  PKG+LLYG
Sbjct: 495 VRPSAMREIFLEMPKVYWSDIGGQEELKRKMVEMIQLPLEASETFSRLGVSAPKGVLLYG 554

Query: 247 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 306
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 555 PPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDE 614

Query: 307 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 366
           I                 V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 615 IDALSPDRDGPSSSAAGHV---LTSLLNEIDGVEELNGVVIVGATNRPDEIDPALLRPGR 671

Query: 367 IDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWEL--ISRLCPNSTGAELRSVCTEAGM 424
           +DR +  + PD   R  I    +   S E    ++L  ++R     +GAE+  +C EAG+
Sbjct: 672 LDRHIYVAPPDYAARLQILTKCSSKFSTEEEPDYDLENLARRTEGCSGAEVVLLCQEAGL 731

Query: 425 FAIRARRKVATEKDFLKAVDKVISGYKK 452
            AI     + T++   +  +K +SG  +
Sbjct: 732 AAI--MENLDTKRVEARHFEKALSGISR 757

 Score =  152 bits (384), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 86/234 (36%), Positives = 129/234 (55%), Gaps = 16/234 (6%)

Query: 204 YTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRT 263
           Y+ VGG   +I+ L++ +ELPL  P  F    + PP+G+LL+GPPGTGKT+  R  AN  
Sbjct: 243 YSLVGGLAKEIDSLKKTIELPLHQPTLFTRFAVSPPRGVLLHGPPGTGKTMLLRCFANTC 302

Query: 264 DATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXN 323
           +A  + + G  +V K++GE    +RE+F+ A+  +  IIF DEI                
Sbjct: 303 NAHVLTINGPSIVSKFLGETEATLREIFDEAKKYQPSIIFIDEIDSIAPNRAHDDSGEAE 362

Query: 324 EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN 383
              R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE ++PD++ R  
Sbjct: 363 --SRVVATLLTLMDGMGGAGRVVVVAATNRPNAVDPALRRPGRFDQEVEIAVPDVDARLE 420

Query: 384 IFR---------IHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 428
           I +         +HT S   +  IR   I+       GA+L ++C E+ M AI+
Sbjct: 421 ILKKQFDKMNSDLHTLS---DDDIRN--IASRTHGYVGADLIALCRESVMKAIQ 469

>ZYRO0B12606g Chr2 complement(1013826..1016159) [2334 bp, 777 aa]
           {ON} highly similar to uniprot|P32794 Saccharomyces
           cerevisiae YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18
           (AAA) family forms a hexameric complex may be involved
           in degradation of aberrant mRNAs
          Length = 777

 Score =  171 bits (432), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 98/278 (35%), Positives = 143/278 (51%), Gaps = 5/278 (1%)

Query: 187 IDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 246
           I PS       E P V +TD+GG      K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 492 IRPSAMREIFLEMPKVYWTDIGGQDVLKRKMKEMIQLPLEASETFARLGVSAPKGVLLYG 551

Query: 247 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 306
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 552 PPGCSKTLTAKALATESGVNFLAVKGPEIFSKYVGESERAIREIFHKARSAAPSIIFFDE 611

Query: 307 IXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 366
           I                     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 612 I-DAISSSRDDGGSSTTAASNVLTSLLNEIDGVEELKGVVIVAATNRPDEIDSALLRPGR 670

Query: 367 IDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWEL--ISRLCPNSTGAELRSVCTEAGM 424
           +DR +    PD   R  I +  T   S++    + L  ++      +GAE+  +C EAG+
Sbjct: 671 LDRHIYVGPPDYSARLQILKKCTSKFSIDSQPDYNLEKLAEHTDGCSGAEIVLLCQEAGL 730

Query: 425 FAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQY 462
            AI     V   K   +  +K +SG  +  +      Y
Sbjct: 731 AAI--MEDVEANKVESRHFEKALSGISRIITPEMLAYY 766

 Score =  169 bits (429), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 103/283 (36%), Positives = 152/283 (53%), Gaps = 16/283 (5%)

Query: 159 VSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPD--------VTYTDVGGC 210
           VS  D+ +     V+ S  ++  P+  R   +    T   KP         + Y  VGG 
Sbjct: 185 VSKCDLNQDSTTTVEDSSPYLSPPVIFRRGSTKVEFTKASKPSSRFNLSHSIGYDSVGGL 244

Query: 211 KDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 270
             +IE L+  + LPL  P+ F+  G+ PP+GILL+GPPGTGKT+  R VAN TDA  + +
Sbjct: 245 AKEIEVLKNAIHLPLHKPKLFSEFGVAPPRGILLHGPPGTGKTMLLRCVANTTDAHILTI 304

Query: 271 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNEVQ-RTM 329
            G  +V KY+GE    +RE+F+ A+  +  IIF DEI                EV+ R +
Sbjct: 305 NGPSIVSKYLGETEATLREIFDEAKLYQPSIIFIDEI---DSIAPNRASDDSGEVESRVV 361

Query: 330 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHT 389
             L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE ++PD+E R +I     
Sbjct: 362 ATLLTLMDGMGAAGRLVVVAATNRPNNIDPALRRPGRFDQEVEIAIPDVEERIDILMKQF 421

Query: 390 KSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 428
           + MS E+  +  E I  +   +    GA+L ++C E+ M  I+
Sbjct: 422 ERMSSEKHSLSAEDIKEVAAKTHGYVGADLTALCRESVMKTIQ 464

>AGL274W Chr7 (191481..193679) [2199 bp, 732 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR024W (YME1)
          Length = 732

 Score =  170 bits (430), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG + PKG+LL GPPGTGKTL ARA
Sbjct: 260 KTNVKFEDVRGCDEARAELEEIVDF-LKDPAKYESLGGNLPKGVLLTGPPGTGKTLLARA 318

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 319 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 378

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 379 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDV 435

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I + H + +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 436 RGRADILQHHMRKVTLAPDVDPSIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMTH 495

Query: 439 FLKAVDKVISGYKK 452
           F  A DK++ G ++
Sbjct: 496 FEWAKDKILMGAER 509

>Skud_16.309 Chr16 (575130..577373) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  170 bits (430), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +R+LF  AR++   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVDMSH 510

Query: 439 FLKAVDKVISGYKK 452
           F  A DK++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>KLLA0E00837g Chr5 complement(84426..86870) [2445 bp, 814 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 814

 Score =  170 bits (431), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 141/257 (54%), Gaps = 7/257 (2%)

Query: 176 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLG 235
           KY   L   P I P+         PDVT++ VG       +L   +  P+  PE +  +G
Sbjct: 485 KYEDFLKALPTIQPTAKREGFATVPDVTWSSVGALDKIRIELNMAIVQPIKRPELYEKVG 544

Query: 236 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 295
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 545 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFNRAR 604

Query: 296 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 355
               CIIFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 605 ASVPCIIFFDELDALVPRRDASLSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPD 661

Query: 356 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNST 411
            +DPA+LRPGR+D+ +   LP+ E + +I R   +S    ++ +  I   +    C N +
Sbjct: 662 MIDPAMLRPGRLDKTLFIELPNFEEKVDIMRTLIRSNGTPIADDVDINRIVNDERCKNFS 721

Query: 412 GAELRSVCTEAGMFAIR 428
           GA++ ++  E+ + A++
Sbjct: 722 GADIAALVRESSVLALK 738

 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 130/233 (55%), Gaps = 6/233 (2%)

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           P    + +GG  D I +L E++ LP+L PE ++  G++PP+G+LL+GPPG GKT  A A+
Sbjct: 194 PSSNLSTLGGMDDVIAQLMELIGLPILHPEIYSATGVEPPRGVLLHGPPGCGKTSIANAL 253

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A      FI +    +V    GE  + +RELF+ A++   C++FFDEI            
Sbjct: 254 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 313

Query: 320 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                 +R + +L+T +D   F+      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 314 REME--RRIVAQLLTSMDELSFEKMEGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 371

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 428
           P+   R  I +    S+ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 372 PNETSRYFILKKMASSLKIDGEIDFIKLAKLTPGFVGADLKALITAAGTCAIK 424

>ZYRO0G08008g Chr7 complement(649595..652075) [2481 bp, 826 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 826

 Score =  170 bits (431), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 151/288 (52%), Gaps = 13/288 (4%)

Query: 145 LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTY 204
           L  I KF+    E   P + E+   + +   +Y   L   P I P+         PDVT+
Sbjct: 462 LTIIQKFIQNFPE---PLNDEQLSNLSI---QYEDFLKALPTIQPTAKREGFATVPDVTW 515

Query: 205 TDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTD 264
             VG       +L   +  P+  PE +  +GI  P G+LL+GPPG GKTL A+AVAN + 
Sbjct: 516 ASVGALTKVRVELNMAIVQPIKKPELYEKVGISAPAGVLLWGPPGCGKTLLAKAVANESR 575

Query: 265 ATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXXXXXNE 324
           A FI + G EL+ KYVGE  R +R++F  AR    C+IFFDE+               + 
Sbjct: 576 ANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDSTLSESSSR 635

Query: 325 VQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANI 384
           V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ E + +I
Sbjct: 636 VVNTLL---TELDGLNDRRGIFVVGATNRPDMIDPAMLRPGRLDKTLFIELPNAEEKLDI 692

Query: 385 F----RIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 428
                R +   MS +  +   +    C N +GA++ S+  E+ + A++
Sbjct: 693 LKTLVRTNGTPMSSDVDLETVIADDRCKNFSGADIASLVRESSVLALK 740

 Score =  144 bits (362), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           P      +GG +D + +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 187 PQSRLESIGGMEDVVAQLMELIGLPILHPEIYISTGVEPPRGVLLHGPPGCGKTSIANAL 246

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A      F+ +    +V    GE  + +R+LF+ AR+   C++FFDEI            
Sbjct: 247 AGELQVPFLSISAPSVVSGMSGESEKKIRDLFDEARSLAPCLMFFDEIDAITPKRDGGAQ 306

Query: 320 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                 +R + +L+T +D  +        + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 307 REME--RRIVAQLLTSMDELNMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 364

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 428
           P+   R +I +   +++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 365 PNELSRVHILKKLAQNLKIDGEIDFIKLAKLTPGFVGADLKALITAAGTCAIK 417

>Kpol_1044.15 s1044 complement(29676..32195) [2520 bp, 839 aa] {ON}
           complement(29676..32195) [2520 nt, 840 aa]
          Length = 839

 Score =  170 bits (431), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 141/257 (54%), Gaps = 7/257 (2%)

Query: 176 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLG 235
           KY   L   P I P+         PDVT+ +VG       +L   +  P+  PE +  +G
Sbjct: 512 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALDKTRVELNMAIVQPIKRPELYEKVG 571

Query: 236 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 295
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 572 ISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 631

Query: 296 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 355
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 632 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 688

Query: 356 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRL----CPNST 411
            +DPA+LRPGR+D+ +   LP+ + + +I +  T+S         EL + +    C N +
Sbjct: 689 MIDPAMLRPGRLDKTLFIELPNEDEKLDIIKTLTRSNGTPLADDVELQTIISDERCRNFS 748

Query: 412 GAELRSVCTEAGMFAIR 428
           GA+L ++  E+ + A++
Sbjct: 749 GADLAALVRESSVLALK 765

 Score =  144 bits (362), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           P      +GG  D I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 205 PSSDLKSLGGMDDVIAQLMELIGLPILHPEIYQSTGVEPPRGVLLHGPPGCGKTSIANAL 264

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A      FI +    +V    GE  + +R+LF+ A+    C++FFDEI            
Sbjct: 265 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKAIAPCLMFFDEIDAITPKRDGGAQ 324

Query: 320 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                 +R + +L+T +D    +  G   + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 325 REME--RRIVAQLLTSMDELSMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 382

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 428
           P+   R +I +  ++++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 383 PNEVSRLHILKKMSENLKIDGEIDFAQLAKLTPGFVGADLKALSTAAGTCAIK 435

>KLTH0C05742g Chr3 complement(499428..501662) [2235 bp, 744 aa] {ON}
           highly similar to uniprot|P32795 Saccharomyces
           cerevisiae YPR024W YME1 Mitochondrial inner membrane
           protease of the AAA family responsible for degradation
           of unfolded or misfolded mitochondrial gene products
           mutation causes an elevated rate of mitochondrial
           turnover
          Length = 744

 Score =  169 bits (429), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 93/254 (36%), Positives = 140/254 (55%), Gaps = 4/254 (1%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +V + DV GC +   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 273 KTNVKFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 331

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +RELF  AR +   I+F DE+           
Sbjct: 332 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKD 391

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 392 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 448

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GR +I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 449 RGRTDILKHHMKKVTLASDVDPTIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMNH 508

Query: 439 FLKAVDKVISGYKK 452
           F  A DK++ G ++
Sbjct: 509 FEWAKDKILMGAER 522

>KNAG0E01040 Chr5 complement(195972..198329) [2358 bp, 785 aa] {ON}
           Anc_4.23 YLL034C
          Length = 785

 Score =  169 bits (429), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 95/257 (36%), Positives = 144/257 (56%), Gaps = 7/257 (2%)

Query: 176 KYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLG 235
           KY   L   P I P+         PDVT+ ++G   +   +L   +  P+  PE +  +G
Sbjct: 454 KYEDFLKALPTIQPTAKREGFATVPDVTWNNIGALSNVRLELNMAIVQPIKRPELYEKVG 513

Query: 236 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 295
           I+ P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 514 INAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 573

Query: 296 TKKACIIFFDEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 355
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 574 ASIPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 630

Query: 356 TLDPALLRPGRIDRKVEFSLPDLEGRANIFR--IHTKSMSVERGIRW-ELISRL-CPNST 411
            +DPA+LRPGR+D+ +   LP  E + +I +  + +    V   I + E+I+   C N +
Sbjct: 631 MIDPAMLRPGRLDKTIFIELPTKEEKLDILQTLLRSNGTPVAHDIDFAEIINDFRCQNFS 690

Query: 412 GAELRSVCTEAGMFAIR 428
           GA+L ++  E+ + A++
Sbjct: 691 GADLAALVRESSVSALK 707

 Score =  149 bits (377), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 130/233 (55%), Gaps = 6/233 (2%)

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           P+     +GG  D + +L E++ LP+L PE F T GIDPP+G+LL+GPPG GKT  A A+
Sbjct: 167 PETNLQSLGGMDDVVAQLMELIGLPILHPEIFETTGIDPPRGVLLHGPPGCGKTSIANAL 226

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A      FI V    +V    GE  + +R+LFE A+    C+IFFDEI            
Sbjct: 227 AGELKVPFISVSAPSVVSGMSGESEKKIRDLFEEAQQIAPCLIFFDEIDAITPKRDGGAQ 286

Query: 320 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                 +R + +L+T +D    +      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 287 REME--KRIVAQLLTSMDELTLQKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 344

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 428
           P+   R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 345 PNEVSRLHILKKLSSTLKLDGEIDFLQLAKLTPGFVGADLKALITAAGTCAIK 397

>TPHA0E00660 Chr5 complement(125411..127759) [2349 bp, 782 aa] {ON}
           Anc_7.430 YPR024W
          Length = 782

 Score =  169 bits (428), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 95/255 (37%), Positives = 145/255 (56%), Gaps = 6/255 (2%)

Query: 199 KPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 258
           K +VT+ DV GC +   +L E+V+  L  P ++ +LG   P G+LL GPPGTGKTL ARA
Sbjct: 309 KTNVTFDDVRGCDEARAELEEIVDF-LKDPAKYESLGGKLPSGVLLTGPPGTGKTLLARA 367

Query: 259 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXX 318
            A      F  + GSE  + YVG GA+ +R+LF  AR K   IIF DE+           
Sbjct: 368 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFSQARAKAPAIIFIDELDAIGGKRNPKD 427

Query: 319 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 378
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 428 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 484

Query: 379 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKD 438
            GRA+I   H K +++   +   +I+R  P  +GAEL ++  +A ++A + +  ++ +  
Sbjct: 485 RGRADILAHHLKKITLAPNVDATVIARGTPGLSGAELANLVNQAAVYACQ-QNAISVDMS 543

Query: 439 FLK-AVDKVISGYKK 452
            L+ A DK++ G ++
Sbjct: 544 HLEWAKDKILLGAER 558

>TPHA0K02220 Chr11 (473969..476431) [2463 bp, 820 aa] {ON} Anc_4.23
           YLL034C
          Length = 820

 Score =  169 bits (428), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/248 (37%), Positives = 137/248 (55%), Gaps = 7/248 (2%)

Query: 185 PRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILL 244
           P I P+         PDVT+  VG   +   +L   +  P+  PE +  +GI  P G+LL
Sbjct: 503 PTIQPTAKREGFATVPDVTWASVGALGNIRIELNMAIVQPIKRPELYEKVGISAPAGVLL 562

Query: 245 YGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFF 304
           +GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    C+IFF
Sbjct: 563 WGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFF 622

Query: 305 DEIXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRP 364
           DE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRP
Sbjct: 623 DELDALVPRRDASLSESSSRVVNTLL---TELDGLNDRNGIFVIGATNRPDMIDPAMLRP 679

Query: 365 GRIDRKVEFSLPDLEGRANIFRIHTK--SMSVERGIRWELISR--LCPNSTGAELRSVCT 420
           GR+D+ +   LP+ + + +I    TK     ++  +    I R   C N +GA+L S+  
Sbjct: 680 GRLDKTLFIELPNFQEKLDIINTITKVNGTPLDDSVNLSEIIRDDRCKNFSGADLASLVR 739

Query: 421 EAGMFAIR 428
           E+ + A++
Sbjct: 740 ESSVLALK 747

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 133/233 (57%), Gaps = 6/233 (2%)

Query: 200 PDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 259
           P    +++GG  D I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 189 PTSLLSNLGGMDDVIAQLMELIGLPILHPEIYISTGVEPPRGVLLHGPPGCGKTSIANAL 248

Query: 260 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIXXXXXXXXXXXX 319
           A      FI +    +V    GE  + +RELF+ A++   C++FFDEI            
Sbjct: 249 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLMFFDEIDAITPKRDGGAQ 308

Query: 320 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 375
                 +R + +L+T +D    +  G   + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 309 REME--RRIVAQLLTAMDELSMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 366

Query: 376 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 428
           P+   R +I +  ++ + ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 367 PNEVSRLHILKKMSEHLKIKGEIDYLKLAKLTPGFVGADLKALVTAAGTCAIK 419

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,413,576
Number of extensions: 1666750
Number of successful extensions: 6310
Number of sequences better than 10.0: 536
Number of HSP's gapped: 5766
Number of HSP's successfully gapped: 659
Length of query: 463
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 350
Effective length of database: 40,524,141
Effective search space: 14183449350
Effective search space used: 14183449350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)