Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0A057203.501ON2202209381e-129
Smik_16.4063.501ON2122206151e-80
Skud_16.4483.501ON2082216123e-80
YPR154W (PIN3)3.501ON2152215977e-78
NDAI0B059203.501ON2352395952e-77
Suva_16.4823.501ON2352245866e-76
KNAG0A079903.501ON2212255465e-70
NCAS0F036003.501ON2372405354e-68
KLTH0G02332g3.501ON2332395274e-67
SAKL0F02486g3.501ON2302375232e-66
TDEL0D056903.501ON2012235002e-63
Kwal_47.189053.501ON2362434884e-61
Kpol_480.83.501ON2391314755e-59
KAFR0G037403.501ON2342504563e-56
CAGL0F04829g3.501ON2022234438e-55
Skud_7.4473.501ON2382464233e-51
TBLA0C045303.501ON2221233781e-44
YGR136W (LSB1)3.501ON2411283746e-44
Suva_7.4243.501ON2491223757e-44
Smik_6.2323.501ON2411223591e-41
ZYRO0D09702g3.501ON1581583512e-41
AFR320W3.501ON2571683496e-40
KNAG0B007503.501ON2172203241e-36
KLLA0E03873g3.501ON2201113059e-34
Ecym_12283.501ON2531152633e-27
ZYRO0G20372gsingletonON150672172e-21
TBLA0D029103.501ON2691142102e-19
NCAS0A089901.356ON434511411e-09
Smik_8.472.502ON447791402e-09
TPHA0C040202.502ON485601375e-09
CAGL0K02761g2.502ON450701366e-09
Kpol_1056.372.502ON501711322e-08
TBLA0B054702.502ON539561313e-08
KAFR0D033602.502ON455601304e-08
TBLA0A025705.470ON493711295e-08
KLLA0B13475g2.502ON508701295e-08
TBLA0D049501.356ON468511296e-08
Smik_8.811.356ON468511287e-08
SAKL0E02200g2.502ON511701271e-07
Suva_15.1991.356ON457511261e-07
Skud_8.681.356ON475511261e-07
YHR016C (YSC84)1.356ON468671261e-07
Ecym_27471.356ON452611261e-07
TDEL0A027802.502ON451681261e-07
ABR008C2.502ON443751251e-07
Suva_8.512.502ON456571251e-07
Ecym_24402.502ON459531252e-07
YHL002W (HSE1)2.502ON452571252e-07
ZYRO0B01298g2.502ON411531232e-07
Skud_8.432.502ON454621242e-07
TPHA0O012801.356ON454511199e-07
Kwal_26.79022.502ON532531181e-06
AEL017W1.356ON416581181e-06
KNAG0C046305.470ON516741181e-06
KLTH0D06138g2.502ON489531181e-06
TPHA0A022101.356ON397851172e-06
KLTH0F15114g5.470ON435741172e-06
Kwal_0.3711.356ON217511152e-06
SAKL0G03454g5.470ON468851172e-06
KNAG0C020401.356ON464511163e-06
NDAI0G059601.356ON423551153e-06
NDAI0A043505.470ON459571153e-06
KLLA0A08360g1.356ON423611153e-06
Smik_7.3351.356ON460621153e-06
NCAS0B072501.356ON441591144e-06
YFR024C-A (LSB3)1.356ON459621144e-06
KAFR0C044001.356ON459511135e-06
SAKL0D09702g1.356ON428511135e-06
TDEL0A033405.470ON473741136e-06
NDAI0K021302.502ON459581136e-06
TDEL0D022401.356ON433511136e-06
KLTH0H12980g1.356ON399511136e-06
NCAS0A050802.502ON450521136e-06
CAGL0I08965g1.356ON437511127e-06
TBLA0F034901.356ON511731128e-06
KAFR0E036405.470ON441571119e-06
KAFR0A009701.356ON396511111e-05
Suva_6.961.356ON455651101e-05
NCAS0A119205.470ON463551101e-05
YHR114W (BZZ1)2.159ON633601102e-05
TPHA0E015005.470ON457591092e-05
Kwal_55.212875.470ON461701082e-05
Ecym_23082.591ON678651092e-05
Skud_6.1081.356ON459591082e-05
Skud_4.6615.470ON460551082e-05
CAGL0M01650g5.470ON466561083e-05
Kpol_1008.251.356ON449621073e-05
KNAG0A067102.502ON419851064e-05
ACR266W2.159ON626531074e-05
YDR388W (RVS167)5.470ON482551064e-05
NDAI0B045801.356ON424511065e-05
Smik_4.6585.470ON472551055e-05
TPHA0B028902.159ON634721057e-05
ZYRO0D11110g5.470ON459571047e-05
AFR140C5.470ON388771031e-04
CAGL0A02145g1.356ON391521021e-04
ZYRO0G00792g1.356ON469511022e-04
Kpol_440.105.470ON470551012e-04
ABR082W2.591ON683661012e-04
KLTH0E09790g2.159ON622561012e-04
Skud_8.1752.159ON633521003e-04
Smik_8.1922.159ON633601003e-04
KLLA0E03059g5.470ON42858993e-04
Kpol_1072.562.159ON63758986e-04
Ecym_23165.470ON42174976e-04
Skud_12.2567.365ON40365930.002
Kwal_47.178942.159ON62160940.002
YLR191W (PEX13)7.365ON38665930.002
Suva_15.3102.159ON63460910.004
Ecym_54262.159ON67258910.004
KLLA0C12551g2.591ON60759900.005
KAFR0L015807.365ON34465900.005
Suva_10.2877.365ON39265890.005
AGR306C5.170ON92358900.006
TDEL0E055204.45ON158963900.007
Ecym_47107.365ON39965880.007
KLTH0B04818g7.365ON38067880.008
SAKL0E10780g2.159ON62560880.009
Kpol_325.126.366ON57050880.009
TPHA0F031007.365ON38165870.009
Ecym_25266.366ON52451870.013
KAFR0J026506.366ON55350860.014
KLLA0F23848g2.159ON64977860.016
ZYRO0G10098g4.108ON139261860.016
Kpol_538.255.170ON70756860.018
TDEL0B052202.159ON61388850.019
CAGL0E03476g4.45ON156444860.021
Kwal_33.148357.365ON38463840.022
KAFR0L018807.413ON93054840.027
NDAI0I002206.366ON61552840.029
KNAG0I015801.356ON58151840.032
ZYRO0D17358g6.366ON66849840.032
Smik_3.1866.366ON59153830.037
SAKL0G17600g4.335ON44159830.039
TBLA0F002806.366ON57681830.040
Skud_3.1606.366ON58653830.041
ACR230C7.365ON39863820.047
TBLA0C055602.159ON67363820.047
SAKL0H10098g8.539ON55586820.048
KNAG0B022307.413ON90455820.049
TBLA0D004507.413ON100555820.050
Suva_3.1246.366ON60052820.056
CAGL0C03597g6.366ON58053820.059
ZYRO0B16214g2.159ON65948810.064
YCR088W (ABP1)6.366ON59253810.071
Smik_13.2022.591ON66370810.078
Suva_10.4064.45ON158763810.082
KNAG0I027006.366ON57552800.091
SAKL0F11748g7.365ON40869790.099
Suva_2.564singletonON4339710.10
SAKL0A00594g6.366ON63651800.11
TPHA0F003804.45ON161845790.14
TBLA0B096202.319ON94154790.15
KLLA0E23365g8.539ON57551780.17
CAGL0F05885g2.591ON71284780.18
TBLA0E015604.45ON139473780.19
NCAS0A145707.419ON35554770.21
TPHA0K007207.413ON101170770.21
SAKL0H24222g4.45ON152659770.23
AGL237C6.366ON57851770.23
TBLA0I010807.413ON155553760.28
KLTH0E07744g4.108ON124964760.28
AER140C4.335ON41456750.31
CAGL0C01881g7.413ON99967760.33
KLLA0A04983g4.108ON125173760.37
NCAS0D047406.366ON59450750.38
KLTH0A07348g6.366ON62651750.39
TDEL0A078106.366ON55849740.47
Kwal_23.64376.366ON63151740.48
Kpol_534.62.319ON88653740.61
YMR032W (HOF1)2.591ON66969730.71
KLLA0E09043g2.319ON81452730.73
Ecym_11474.335ON42277720.78
NCAS0B069802.159ON63971720.83
AGL293C7.413ON98470720.90
CAGL0A04147g7.365ON39165720.93
SAKL0H21912g4.108ON125359720.96
KLLA0E06953g7.419ON35753711.0
TDEL0C018207.365ON38965711.1
ZYRO0F01166g2.591ON74865721.1
NDAI0A015007.413ON104754721.1
KLLA0D09306g4.45ON153759721.2
Smik_2.1134.108ON123072711.2
Ecym_72314.108ON114664711.2
NCAS0A145307.413ON102398711.2
Kwal_47.169434.335ON46057701.3
Kpol_1045.277.413ON88054711.4
ZYRO0B02706g7.365ON39665701.6
SAKL0H15048g8.344ON20749691.7
NCAS0C057104.45ON167665701.7
TDEL0G024902.319ON85053701.7
KAFR0F007502.159ON60252701.8
TPHA0K016004.108ON113666702.0
Suva_5.2397.419ON36855692.0
Skud_13.1882.591ON66969692.1
Ecym_71417.413ON102964692.2
ZYRO0A02662g2.319ON88653692.2
KLLA0F10175g6.366ON57650692.3
ZYRO0B04004g7.419ON37153682.4
Kpol_1025.404.108ON120260692.4
NDAI0A014707.419ON36791682.5
Suva_2.1184.108ON116652692.5
Suva_13.2012.591ON66869682.8
SAKL0F12958g7.413ON102754682.8
YBL007C (SLA1)4.108ON124452682.8
KLTH0C06182g7.413ON102553682.9
TDEL0F023804.108ON125564682.9
Skud_2.1044.108ON121452682.9
CAGL0E02783g4.108ON120362683.0
Suva_2.337.413ON98254683.2
Kwal_14.23134.45ON151767683.2
Kwal_27.107337.413ON101453683.3
NCAS0A034904.108ON123564683.3
TPHA0K006807.419ON35548673.4
AGL286C7.419ON33048673.7
TBLA0C041004.108ON130264674.0
KLTH0C06028g7.419ON34260664.3
KNAG0C033907.419ON34253664.3
NDAI0B043202.159ON63250665.1
KNAG0M003604.350ON41466665.1
ZYRO0F13882g8.344ON28864655.2
Ecym_11678.539ON55068665.2
YBL085W (BOI1)7.413ON98054665.8
KAFR0K019607.413ON94272665.9
Ecym_71347.419ON33248656.0
KAFR0K020007.419ON33248656.0
Smik_5.2637.419ON36861656.5
KNAG0B067904.366ON22951646.9
Smik_2.357.413ON98554657.5
ZYRO0B03850g7.413ON108953657.6
CAGL0A02596g5.414ON87282657.7
Suva_5.2357.413ON104354657.8
TPHA0G009302.319ON82472658.1
KAFR0I010404.108ON120362649.0
Skud_2.237.413ON98254649.0
Kwal_27.107077.419ON34348639.4
TDEL0B068402.591ON59667649.4
YER114C (BOI2)7.413ON104068649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0A05720
         (220 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   365   e-129
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   241   1e-80
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   240   3e-80
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   234   7e-78
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   233   2e-77
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   230   6e-76
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   214   5e-70
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   210   4e-68
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   207   4e-67
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   206   2e-66
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   197   2e-63
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   192   4e-61
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   187   5e-59
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   180   3e-56
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   175   8e-55
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   167   3e-51
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   150   1e-44
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   148   6e-44
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   149   7e-44
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   142   1e-41
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...   139   2e-41
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   139   6e-40
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   129   1e-36
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...   122   9e-34
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   105   3e-27
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    88   2e-21
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    86   2e-19
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    59   1e-09
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    59   2e-09
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    57   5e-09
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    57   6e-09
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    55   2e-08
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    55   3e-08
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    55   4e-08
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    54   5e-08
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    54   5e-08
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    54   6e-08
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    54   7e-08
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    54   1e-07
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    53   1e-07
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    53   1e-07
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    53   1e-07
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    53   1e-07
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    53   1e-07
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    53   1e-07
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    53   1e-07
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    53   2e-07
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    53   2e-07
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    52   2e-07
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    52   2e-07
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    50   9e-07
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    50   1e-06
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    50   1e-06
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    50   1e-06
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    50   1e-06
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    50   2e-06
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    50   2e-06
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    49   2e-06
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    50   2e-06
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    49   3e-06
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    49   3e-06
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    49   3e-06
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    49   3e-06
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    49   3e-06
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    49   4e-06
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    49   4e-06
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    48   5e-06
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    48   5e-06
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    48   6e-06
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    48   6e-06
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    48   6e-06
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    48   6e-06
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    48   6e-06
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    48   7e-06
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    48   8e-06
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    47   9e-06
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    47   1e-05
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    47   1e-05
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    47   1e-05
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    47   2e-05
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    47   2e-05
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    46   2e-05
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    47   2e-05
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    46   2e-05
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    46   2e-05
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    46   3e-05
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    46   3e-05
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    45   4e-05
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    46   4e-05
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    45   4e-05
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    45   5e-05
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    45   5e-05
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    45   7e-05
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    45   7e-05
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    44   1e-04
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    44   1e-04
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    44   2e-04
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    44   2e-04
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    44   2e-04
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    44   2e-04
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    43   3e-04
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    43   3e-04
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    43   3e-04
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    42   6e-04
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    42   6e-04
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    40   0.002
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    41   0.002
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    40   0.002
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    40   0.004
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    40   0.004
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    39   0.005
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    39   0.005
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    39   0.005
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    39   0.006
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    39   0.007
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    39   0.007
KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {...    39   0.008
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    39   0.009
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    39   0.009
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    38   0.009
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    38   0.013
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    38   0.014
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    38   0.016
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    38   0.016
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    38   0.018
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    37   0.019
CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa] ...    38   0.021
Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191...    37   0.022
KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {...    37   0.027
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    37   0.029
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    37   0.032
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    37   0.032
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    37   0.037
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    37   0.039
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    37   0.040
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    37   0.041
ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON} S...    36   0.047
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    36   0.047
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    36   0.048
KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.4...    36   0.049
TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7....    36   0.050
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    36   0.056
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    36   0.059
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    36   0.064
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    36   0.071
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    36   0.078
Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa] ...    36   0.082
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    35   0.091
SAKL0F11748g Chr6 complement(915861..917087) [1227 bp, 408 aa] {...    35   0.099
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    32   0.10 
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    35   0.11 
TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45...    35   0.14 
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    35   0.15 
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    35   0.17 
CAGL0F05885g Chr6 (588828..590966) [2139 bp, 712 aa] {ON} simila...    35   0.18 
TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4....    35   0.19 
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    34   0.21 
TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON} Anc_7...    34   0.21 
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    34   0.23 
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    34   0.23 
TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7....    34   0.28 
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    34   0.28 
AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON} N...    33   0.31 
CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} simila...    34   0.33 
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    34   0.37 
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    33   0.38 
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    33   0.39 
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    33   0.47 
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    33   0.48 
Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON} (20451..23...    33   0.61 
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    33   0.71 
KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {...    33   0.73 
Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar t...    32   0.78 
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    32   0.83 
AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON} S...    32   0.90 
CAGL0A04147g Chr1 complement(411674..412849) [1176 bp, 391 aa] {...    32   0.93 
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    32   0.96 
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    32   1.0  
TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.3...    32   1.1  
ZYRO0F01166g Chr6 complement(90553..92799) [2247 bp, 748 aa] {ON...    32   1.1  
NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7....    32   1.1  
KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} simil...    32   1.2  
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    32   1.2  
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    32   1.2  
NCAS0A14530 Chr1 complement(2863100..2866171) [3072 bp, 1023 aa]...    32   1.2  
Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388...    32   1.3  
Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON} (60698....    32   1.4  
ZYRO0B02706g Chr2 complement(218864..220054) [1191 bp, 396 aa] {...    32   1.6  
SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some ...    31   1.7  
NCAS0C05710 Chr3 complement(1170253..1175283) [5031 bp, 1676 aa]...    32   1.7  
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    32   1.7  
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    32   1.8  
TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON} Anc_4...    32   2.0  
Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON...    31   2.0  
Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032...    31   2.1  
Ecym_7141 Chr7 (283803..286892) [3090 bp, 1029 aa] {ON} similar ...    31   2.2  
ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} simila...    31   2.2  
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    31   2.3  
ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {...    31   2.4  
Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON} (104...    31   2.4  
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    31   2.5  
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    31   2.5  
Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032...    31   2.8  
SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa...    31   2.8  
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    31   2.8  
KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} simil...    31   2.9  
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    31   2.9  
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    31   2.9  
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    31   3.0  
Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)    31   3.2  
Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310...    31   3.2  
Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER11...    31   3.3  
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    31   3.3  
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    30   3.4  
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    30   3.7  
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    30   4.0  
KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} simila...    30   4.3  
KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.4...    30   4.3  
NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON} Anc_2...    30   5.1  
KNAG0M00360 Chr13 (54596..55840) [1245 bp, 414 aa] {ON} Anc_4.35...    30   5.1  
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    30   5.2  
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    30   5.2  
YBL085W Chr2 (63876..66818) [2943 bp, 980 aa] {ON}  BOI1Protein ...    30   5.8  
KAFR0K01960 Chr11 complement(403631..406459) [2829 bp, 942 aa] {...    30   5.9  
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    30   6.0  
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    30   6.0  
Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON...    30   6.5  
KNAG0B06790 Chr2 complement(1341181..1341870) [690 bp, 229 aa] {...    29   6.9  
Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)    30   7.5  
ZYRO0B03850g Chr2 complement(320570..323839) [3270 bp, 1089 aa] ...    30   7.6  
CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} simila...    30   7.7  
Suva_5.235 Chr5 complement(366285..369416) [3132 bp, 1043 aa] {O...    30   7.8  
TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.3...    30   8.1  
KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4....    29   9.0  
Skud_2.23 Chr2 (47507..50455) [2949 bp, 982 aa] {ON} YBL085W (REAL)    29   9.0  
Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118...    29   9.4  
TDEL0B06840 Chr2 (1211695..1213485) [1791 bp, 596 aa] {ON} Anc_2...    29   9.4  
YER114C Chr5 complement(390590..393712) [3123 bp, 1040 aa] {ON} ...    29   9.9  

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  365 bits (938), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 184/220 (83%), Positives = 184/220 (83%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
           ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG
Sbjct: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120

Query: 121 STNASKSELTXXXXXXXXXXXXXXXXXSYHSYQQPFPPQSTNYYXXXXXXXXXXXXXXXX 180
           STNASKSELT                 SYHSYQQPFPPQSTNYY                
Sbjct: 121 STNASKSELTPVPPQYQQQQQPIQQVQSYHSYQQPFPPQSTNYYQQAPQQQQQQQQPEQQ 180

Query: 181 XXXHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
              HHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF
Sbjct: 181 QQQHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  241 bits (615), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 127/220 (57%), Positives = 144/220 (65%), Gaps = 8/220 (3%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS SLINRSLT IRTEL+FLKES VIS+ VF +IN SLP R+DP       SA+    ST
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPP------SASRNTSST 54

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
           +LEYVEA+Y+FDPQQDGDL ++PGDKIQ+LEK+SPEWYKGSCNG+ G+FP+NY KPAFSG
Sbjct: 55  SLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSG 114

Query: 121 STNASKSELTXXXXXXXXXXXXXXXXXSYHSYQQPFPPQSTNYYXXXXXXXXXXXXXXXX 180
           S   S                           QQPFPP STNYY                
Sbjct: 115 SNGQSNLPPPPQYKAQELQPVPTQNSAVSSYQQQPFPPPSTNYY--QQPQQAPAPAPQQQ 172

Query: 181 XXXHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
                 N+  HLKSFGSKLGNAAIFGAGA+IGSDIVNSIF
Sbjct: 173 QQQQQPNSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 212

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  240 bits (612), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 149/221 (67%), Gaps = 14/221 (6%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS SLINRSLTTIRTEL+FLKES VIS  VF +IN SLP R++PS      SA     S 
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPS------SAARDTSSA 54

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
           +LEYVEA+Y+FDPQQDGDL ++PGDK+Q+LEK+SPEWYKGSCNG+VG+FP+NY KPAFSG
Sbjct: 55  SLEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFSG 114

Query: 121 STNASKSELTXXXXXXXXXXXXXXXXXSYHSY-QQPFPPQSTNYYXXXXXXXXXXXXXXX 179
           S N S +                    +  SY QQPFPP STNYY               
Sbjct: 115 S-NGSSNLPPPPQYKAQELQQAPTQNSAVSSYQQQPFPPPSTNYY------QQPQQQPQQ 167

Query: 180 XXXXHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
                  ++  HLKSFGSKLGNAAIFGAGA+IGSDIVNSIF
Sbjct: 168 APPQQQPSSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 208

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  234 bits (597), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 121/221 (54%), Positives = 143/221 (64%), Gaps = 7/221 (3%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS SLINRSLT IRTEL+FLK S VIS+ V+ +IN SLP ++DP+NAP   S  +     
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPAS----- 55

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
            LEYVEA+Y+FDPQQDGDL ++PGDK+Q+LEK+SPEWYKGSCNG+ G+FP+NY KPAFSG
Sbjct: 56  -LEYVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSG 114

Query: 121 STNASKSELTXXXXXXXXXXXXXXXXXSYHSYQQPFPPQSTNYYXXXXXXXXXXXXXXXX 180
           S   S                      +    QQPFPP STNYY                
Sbjct: 115 SNGPSNLPPPPQYKAQELQQIPTQNSAASSYQQQPFPPPSTNYYQQPQQQPQQAPPPQQQ 174

Query: 181 XXXHHSNTG-KHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
                  +   HLKSFGSKLGNAAIFGAGA+IGSDIVN+IF
Sbjct: 175 QQQQQHQSSHSHLKSFGSKLGNAAIFGAGASIGSDIVNNIF 215

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  233 bits (595), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 126/239 (52%), Positives = 151/239 (63%), Gaps = 23/239 (9%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS SLINRSLT IRTEL+FLKES VIS+  F +IN+ LP+RYDP+ +   +S+     + 
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSS----QAP 56

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
            LEYVEAIY F+PQQ+GDLA++ GDKIQV+EK SPEW+KG CNG+VG+FPSNY +PAFSG
Sbjct: 57  TLEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSG 116

Query: 121 STNASKSELTXXXXXXXXXXXXXXXXXSYH-SYQQPFPPQSTN----------------- 162
           ++  SK+ LT                 S + SYQ PFPP STN                 
Sbjct: 117 TSQPSKTRLTPGPPQYQASVETQSIHSSSNVSYQPPFPPASTNYYQQPAQQPQAQYIPPP 176

Query: 163 -YYXXXXXXXXXXXXXXXXXXXHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
                                 HH +TG+HLK FGSKLGNAAIFGAGATIGSDIVNSIF
Sbjct: 177 QPVQQVQQQVQQQPQQQQPQQQHHHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  230 bits (586), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 123/224 (54%), Positives = 146/224 (65%), Gaps = 11/224 (4%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS SL+NRSLT IRTEL+FLKES VISD VF +IN SLP ++DPS+AP         +S 
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPSSAP------RGSNSA 72

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
           +LEYVEA+Y+FDPQQDGDL ++ GDK+Q+LEK+SPEWYKGSCNG+ G+FP+NY KP FS 
Sbjct: 73  SLEYVEAVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFSD 132

Query: 121 STNASKSELTXXXXXXXXXXXXXXXXXSYHSYQ-QPFPPQSTNYY---XXXXXXXXXXXX 176
           S    +                     +  SYQ QPFPP STNYY               
Sbjct: 133 SDGQHRLP-PPPQYKAQELQQIPTQNSNVSSYQPQPFPPPSTNYYQQPLQQPQLQPQQPP 191

Query: 177 XXXXXXXHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
                    S++  HLKSFGSKLGNAAIFGAGA+IGSDIVNSIF
Sbjct: 192 PPQQQQQQQSSSNNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 235

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  214 bits (546), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 116/225 (51%), Positives = 138/225 (61%), Gaps = 9/225 (4%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS SLINRSLT +RTEL+FL+ES+VIS+  F +I  SLP++YDP+      S  ++    
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESHA 60

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
            LEYVEA+Y F PQQDGDL ++PGDKIQVLEK S EWYKG C G+VG+FPSNY KPAFSG
Sbjct: 61  KLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVKPAFSG 120

Query: 121 STNASKSELTXXXXXXXXXXXXXXXXXSYHS-YQQ----PFPPQSTNYYXXXXXXXXXXX 175
            ++A K                       ++ Y Q    PFPPQS NYY           
Sbjct: 121 ESSAPKRPAGPPYQPQQQHLAAPMYQQPQNTGYSQSSNPPFPPQSANYYPPQQQQQPQQV 180

Query: 176 XXXXXXXXHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
                    H+      K FGS+LGNAAIFGAGATIGSDIVNSIF
Sbjct: 181 VVEQQQPHKHNA----FKKFGSQLGNAAIFGAGATIGSDIVNSIF 221

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  210 bits (535), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 145/240 (60%), Gaps = 23/240 (9%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDP--SNAPSMLSATTTR- 57
           MS S INRSL TIRTEL+FLKES VIS   F +I S+LP +YDP  S APS+ S+   + 
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60

Query: 58  DSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPA 117
                E+VEAIY F+PQQ GDLA++PGDKI+V+EK SPEW+KG CNG+ G+FPSNY KPA
Sbjct: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120

Query: 118 FSGSTNASKSELTXXXXXXXXXXXXXXXXXSYHSYQQ--PFPPQSTNYY----------- 164
           FSGS+  S +++                     S+QQ  PFPP  TNYY           
Sbjct: 121 FSGSS-GSVNKVARPNGPPQYQNSLQTQNSHTPSFQQPAPFPPALTNYYQQQQPQFIQTP 179

Query: 165 ----XXXXXXXXXXXXXXXXXXXHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
                                  HHS+ G  LK FGSKLGNAAIFGAGATIGSDIVNSIF
Sbjct: 180 QQQQPQQVQQQPVQQQQPQQQEQHHSHHG--LKKFGSKLGNAAIFGAGATIGSDIVNSIF 237

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  207 bits (527), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 138/239 (57%), Gaps = 25/239 (10%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS S INRSL+T+RTELEFL+ES VI+++ +++I S+LPERYDPS  P   SAT      
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDPSRGPQQPSATQG---- 56

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
             E+VEAIY F  QQDGDL +Q GDK++VLEK SPEW+KG CNG+VG+FPSNY KPAFSG
Sbjct: 57  --EFVEAIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVKPAFSG 114

Query: 121 STNASKSELTXXXXXXXXXXXXXXXXXSYHSY--QQPFPPQSTNYYXXXXXXXXXXXXXX 178
           ST   +  +                  S  S   Q PFPP STNYY              
Sbjct: 115 STTTERPVVPPPPQYQSQQLVPQQTNASAQSAYSQPPFPPSSTNYYQPPPQQYPQQYPQQ 174

Query: 179 XXXXX-----------------HHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
                                 H S      K FG KLGNAA+FGAGATIGSDIVNSIF
Sbjct: 175 QYYQAQQAPVAAPVAAPAAQQGHSSQASSAFKKFGGKLGNAAVFGAGATIGSDIVNSIF 233

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  206 bits (523), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 121/237 (51%), Positives = 141/237 (59%), Gaps = 24/237 (10%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS SLINRSLTTIRTEL+FL+ES+VIS+  F++I++SLP+RYDP+       A   R S+
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPN-------ANGNRSSS 53

Query: 61  -ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFS 119
            +LEYVEAIY F  QQDGDL ++PGDKIQVLEK S EWYKG CNG VG+FPSNY KPAFS
Sbjct: 54  PSLEYVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFS 113

Query: 120 GSTNASKSE--------LTXXXXXXXXXXXXXXXXXSYHSYQQP-FPPQSTNYYXXXXXX 170
           GS   ++ E                           S     QP FPP ST +Y      
Sbjct: 114 GSNGFTREEPARPNLPPPPQYQSSPTVALQPQQTSSSTQLASQPQFPPPSTGFYQQPPQQ 173

Query: 171 XXXXXXXXXXXXXHHS-------NTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
                          +       N  +  K FGSKLGNAAIFGAGATIGSDIVNSIF
Sbjct: 174 YYQQPPVQQSPVQQPAPEQHAGHNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  197 bits (500), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 133/223 (59%), Gaps = 25/223 (11%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS S INRSL T+RTEL+FL+ES VIS  ++  +N SLP+     NA           + 
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQ-----NA----------SNK 45

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
             EY+EA+Y+FDPQQDGDLA+ PGDKI+VLEK S EW+KG CNG+VG+FP+NY K A+SG
Sbjct: 46  GGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSG 105

Query: 121 STNASKSELTXXXXXXXXXXXXXXXXXSYHSYQQPFPPQSTN---YYXXXXXXXXXXXXX 177
           S   S                      S  SYQQPFPP STN                  
Sbjct: 106 SDRPS-----VPPPPQYEQAQRTNTGQSSGSYQQPFPPPSTNYYQQPPQQYQQPQQQQPQ 160

Query: 178 XXXXXXHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
                 HHS+   HLK FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 161 QEQQQQHHSHN--HLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  192 bits (488), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 118/243 (48%), Positives = 139/243 (57%), Gaps = 30/243 (12%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS S INRSL+T+RTELEFL+ES VI+++ +++I   LPERY+P  +      T T  S+
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRS------TPTVPSS 54

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
             E+VEAIY F  QQDGDL +Q GDKI+VLEK SPEWYKG CNG+VG+FPSNY KPAFSG
Sbjct: 55  QSEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSG 114

Query: 121 STNAS--KSELTXXXXXXXXXXXXXXXXXSYHS--YQQPFPPQST--------------- 161
           S NAS  +  +                  S +S   Q PFPP ST               
Sbjct: 115 S-NASLERPNVPAPPEYQSQQIVPQATNTSANSNYSQPPFPPPSTAYYQGPPQQYQPQQQ 173

Query: 162 ----NYYXXXXXXXXXXXXXXXXXXXHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVN 217
                Y                      S+TG   K FG KLGNAAIFGAGATIGSDIVN
Sbjct: 174 YQQQYYQGQQATPQPAPAAPAAQQGTGSSHTGAAFKKFGGKLGNAAIFGAGATIGSDIVN 233

Query: 218 SIF 220
           SIF
Sbjct: 234 SIF 236

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  187 bits (475), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 105/131 (80%), Gaps = 5/131 (3%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS++ INRSLT+++TELEFL++S VIS   F +IN+ LP+R+DPS      S  T   S 
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDPSRE----SLATNNSSP 56

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
            LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKG CNGKVGVFPSNY KPAFSG
Sbjct: 57  NLEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVKPAFSG 116

Query: 121 STN-ASKSELT 130
            +N  S+S LT
Sbjct: 117 GSNEKSRSHLT 127

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%)

Query: 187 NTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
           N  KH KSFGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 206 NASKHFKSFGSKLGNAAIFGAGATLGSDLVNSIF 239

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  180 bits (456), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 102/250 (40%), Positives = 136/250 (54%), Gaps = 46/250 (18%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSM---------- 50
           MS++LINR++T I+TEL+FL+ES++I+     EI   LPE+YDPS+  +           
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 51  ------------LSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWY 98
                        ++ T   +  LEYVEA+Y F+PQQ+GDL +  GDK+Q+LEK S EWY
Sbjct: 61  NAAANSSSASVDHASATPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120

Query: 99  KGSCNGKVGVFPSNYTKPAFSGSTNASKSELTXXXXXXXXXXXXXXXXXSYHSYQQP--- 155
           KG+CNG++G+FP+NY KP    S      +                     ++YQQP   
Sbjct: 121 KGTCNGQIGMFPANYVKPVTKDSFAPPPPQYQQYS----------------NNYQQPSYS 164

Query: 156 ---FPPQSTNYY--XXXXXXXXXXXXXXXXXXXHHSNTGKHLKSFGSKLGNAAIFGAGAT 210
              +PP ST YY                       S T + LK FGSKLGNAAIFGAGAT
Sbjct: 165 QPAYPPASTGYYQQPQQVQVQQPQQVQVQQQPQQQSQTNEQLKRFGSKLGNAAIFGAGAT 224

Query: 211 IGSDIVNSIF 220
           +GSD+VNSIF
Sbjct: 225 LGSDLVNSIF 234

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  175 bits (443), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 121/223 (54%), Gaps = 24/223 (10%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS S INRSL  IR EL+FL+ES VIS+  FKEI   LP             A+      
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSN----------GASPVPPPM 50

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
           +LEYVEA+Y F PQQDGDLAI+ GDKIQVLEK S EWY+G+ NG+ G+FPSNY +PA + 
Sbjct: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPAAAP 110

Query: 121 STNASKSELTXXXXXXXXXXXXXXXXXSYHSYQQPF---PPQSTNYYXXXXXXXXXXXXX 177
           S N +                      S+    QP    P     YY             
Sbjct: 111 SANLAPPAYD------NPKLSPQPTVQSFQPPAQPIVAQPSPQPAYYQAPPQQVVVEQQP 164

Query: 178 XXXXXXHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
                 H+      LKSFGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 165 VQQSSAHNG-----LKSFGSKLGNAAIFGAGATLGSDLVNSIF 202

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  167 bits (423), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 108/246 (43%), Positives = 136/246 (55%), Gaps = 34/246 (13%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS SLINRSL  IR ELEFLKES VIS  +F  I+S+LP ++D  N+ S  +A+T     
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWD-ENSKSANNASTE---- 55

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
             EYVEA+Y F+ QQDGDL+++ GDKIQ+LEKIS +WYKG  N  +G+FP+NY KPAF+ 
Sbjct: 56  --EYVEALYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPAFTR 113

Query: 121 STNAS--KSELTXXXXXXXXXXXXXXXXXSYHSYQQ------------------------ 154
           ST+    K+ L+                   +S QQ                        
Sbjct: 114 STSPDFEKTPLSSRVSRPSVPPPSYEPAVPEYSSQQVSAPNVPPLGYVQAPPLQQNQAPL 173

Query: 155 PFPPQSTNYYXXXXXXXXXXXXXXXXXXXHHSNTGKHLKSFGSKLGNAAIFGAGATIGSD 214
           P+PP  TN Y                     S+     KSFGSKLG+AAIFGAG+TIGSD
Sbjct: 174 PYPPSFTN-YYQQPQQQYAPAPQQAQPQQQSSSASSAFKSFGSKLGDAAIFGAGSTIGSD 232

Query: 215 IVNSIF 220
           I+NSIF
Sbjct: 233 IINSIF 238

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  150 bits (378), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 88/123 (71%), Gaps = 5/123 (4%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS+SLIN+SL+TI TEL+FL +S  I    + +I+  LP R     AP + S   +  S 
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRR-----APEVPSRQQSNSSK 55

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
             E+VEAIY+FDPQQDGDL + PGDKI V EK SPEW+KG CNGKVGVFPSNY +PAFSG
Sbjct: 56  NEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSG 115

Query: 121 STN 123
           S N
Sbjct: 116 SNN 118

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  148 bits (374), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 74/128 (57%), Positives = 93/128 (72%), Gaps = 7/128 (5%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS SL+NRSL  IR ELEFLKES VIS  +F+ INS LPE++D  N  S  +A T     
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWD-GNQRSPQNADTE---- 55

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
             EYVEA+Y F+ QQDGDL+++ GDKIQVLEKISP+WY+G  N K+G+FP+NY KPAF+ 
Sbjct: 56  --EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFTR 113

Query: 121 STNASKSE 128
           S +   +E
Sbjct: 114 SASPKSAE 121

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/37 (72%), Positives = 28/37 (75%)

Query: 184 HHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
             S      KSFGSKLGNAAIFGAG+ IGSDIVNSIF
Sbjct: 205 QSSGASSAFKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  149 bits (375), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 68/122 (55%), Positives = 91/122 (74%), Gaps = 7/122 (5%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS SLINRSL  IR EL+FLKES+VISD +F  INS LPE++D       ++     +++
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKWD-------VNLRPVPNAS 53

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
             E+VEA+Y F+PQQ+GDL ++ GDKIQ+LEKISP+WY+G  N +VG+FP+NY KPAF+ 
Sbjct: 54  VEEFVEALYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVKPAFAR 113

Query: 121 ST 122
           S 
Sbjct: 114 SA 115

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 29/35 (82%)

Query: 186 SNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
           S      KSFGSKLGNAAIFGAG+TIGSDIV+SIF
Sbjct: 215 SGASSAFKSFGSKLGNAAIFGAGSTIGSDIVHSIF 249

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  142 bits (359), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 89/122 (72%), Gaps = 7/122 (5%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS +L+NRSL  IR ELEFL+ES VIS  +F  INS LPE+++  N  S  +A T     
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWN-DNTRSPNNADTE---- 55

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
             EYVEA+Y F+ QQDGDL+++ GDKIQVLEKISP+WYKG  N +VG+FP+NY KPAF+ 
Sbjct: 56  --EYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTR 113

Query: 121 ST 122
           S 
Sbjct: 114 SV 115

 Score = 55.8 bits (133), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 26/29 (89%), Positives = 27/29 (93%)

Query: 192 LKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
            KSFGSKLGNAAIFGAG+ IGSDIVNSIF
Sbjct: 213 FKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score =  139 bits (351), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 94/158 (59%), Gaps = 3/158 (1%)

Query: 63  EYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSGST 122
           E+VEAIYRFDPQQ+GDLA+ PGDKI+VLEK SPEW++G CNG+VG+FPSNY KPAFSG  
Sbjct: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63

Query: 123 NASKSELTXXXXXXXXXXXXXXXXXSYHSYQQPFPPQSTNYYXXXXXXXXXXXXXXXXXX 182
           +   +                     +      +PP STNYY                  
Sbjct: 64  DRPAAPPPPQYDQKAMASQPSGGNAMWQQPSP-YPPPSTNYYQPPPPQQQQPQPMVVQQE 122

Query: 183 XHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
               + G  L  FGSKLGNAAIFGAGAT+GSD++NSIF
Sbjct: 123 QGKRHHG--LGKFGSKLGNAAIFGAGATLGSDLINSIF 158

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  139 bits (349), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 98/168 (58%), Gaps = 10/168 (5%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS++LINRSL TIRTEL FL +S VI+    ++I S+LP   +P+ A   L      ++ 
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLP---NPNEA---LRGAPANNAG 54

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
            +EYVEA+Y F  QQ GDL  + G+KI+VLEK SPEWYKG CNGKVG+FPSNY KPAFSG
Sbjct: 55  PVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSG 114

Query: 121 ST---NASKSELTXXXXXXXXXXXXXXXXXSYHSY-QQPFPPQSTNYY 164
            +    AS                          + Q PFPP +  YY
Sbjct: 115 GSLMKEASPPRYPAQASAPQVQSPTPQSPPPPAGFSQSPFPPGANGYY 162

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/28 (85%), Positives = 27/28 (96%)

Query: 193 KSFGSKLGNAAIFGAGATIGSDIVNSIF 220
           K FGSKLGNAAIFGAGAT+GSD+V+SIF
Sbjct: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  129 bits (324), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/220 (38%), Positives = 108/220 (49%), Gaps = 8/220 (3%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS   +NRS+T IRTELE+L ESKVIS   F E N  LP+ +D      +  A       
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWD---GKPIGGAGEKHPPH 57

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPA-FS 119
             EYVEAI+R+ PQ+  DL +Q GDK+++LEK+S +WY+G   GKVGVFPSNY K   FS
Sbjct: 58  EPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFS 117

Query: 120 GSTNASKSELTXXXXXXXXXXXXXXXXXSYHSYQQPFPPQSTNYYXXXXXXXXXXXXXXX 179
           G  +A   ++                       Q    PQ                    
Sbjct: 118 GVDDAMFQDIPPSSFSTQQYVPPYVPPPQEKPQQPKPQPQPQPQPQPQPQPQPQPEPKPQ 177

Query: 180 XXXXHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSI 219
               H S  GK+L     + GN+ +FGAG  IGSDIVN I
Sbjct: 178 KQHHH-SGAGKNLL---KQFGNSIVFGAGQRIGSDIVNGI 213

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score =  122 bits (305), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%), Gaps = 9/111 (8%)

Query: 6   INRSLTTIRTELEFLKESKVISDSVFKEINSSLPE-RYDPSNAPSMLSATTTRDSTALEY 64
           +  S+ TI++EL++LKE   +++  +K+I S LP  R  P  A +M            E 
Sbjct: 4   VEESVATIKSELKYLKEQGALAELAYKDIESLLPRVRPQPPVADTMGQNN--------EI 55

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTK 115
           VEA+Y F PQQDGDLA++PGDKI++LEK+SPEWYKG CNG+VGVFPSNY K
Sbjct: 56  VEALYAFQPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVK 106

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  105 bits (263), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 75/115 (65%), Gaps = 7/115 (6%)

Query: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60
           MS+SLINRSL  I+TELEFL ES VIS S  ++I S L      SN P   +        
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSML------SN-PREGTMKAASQQV 53

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTK 115
             EYVEA+Y F PQQ GDL  + GDKI+VLEK S +WYKG  NG+VG+FPSNY K
Sbjct: 54  LKEYVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (89%)

Query: 192 LKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
            K FGSKLGNAA+FGAGAT+GS++V+ IF
Sbjct: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 88.2 bits (217), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 48/67 (71%)

Query: 55  TTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYT 114
           + ++ +  EYVE +Y F PQ   DL I+PGDK++V+EK+S +WYKG CNGK G+FP+NY 
Sbjct: 7   SNKEKSQGEYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPANYV 66

Query: 115 KPAFSGS 121
           KP   G 
Sbjct: 67  KPVGGGD 73

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (75%), Gaps = 5/37 (13%)

Query: 184 HHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220
           HH+     L   GSKLGNAAIFG GAT+G+D+V+SIF
Sbjct: 119 HHA-----LGKVGSKLGNAAIFGVGATLGNDLVDSIF 150

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 85.5 bits (210), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 68/114 (59%), Gaps = 2/114 (1%)

Query: 4   SLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDS--TA 61
           + I  + T IR  LE L ++K IS++ + EI   L  +    +A S  + T    S    
Sbjct: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNG 67

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTK 115
            +YVEAIY +  +Q GDL + PGD I+V+ K SP+WY+G  NGKVGVFP+NY K
Sbjct: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 20/23 (86%)

Query: 198 KLGNAAIFGAGATIGSDIVNSIF 220
           KLGNAA+FGAG+  G+DIVN IF
Sbjct: 247 KLGNAALFGAGSAFGADIVNDIF 269

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNGKVGVFPSNYTK 115
           A+YRF  +Q GDL+ Q GDKI +L++     +W+ G  NGK G+FP+NY +
Sbjct: 382 ALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPANYVE 432

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 44/79 (55%)

Query: 52  SATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPS 111
           SA TT   T ++ V A+Y     +  +L+ + GD I VLE++  +W+KG+  GK+G+FP 
Sbjct: 204 SAHTTSRQTVVKKVRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALRGKMGIFPL 263

Query: 112 NYTKPAFSGSTNASKSELT 130
           NY  P    S    + E T
Sbjct: 264 NYVTPISEPSKEEIEKERT 282

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSGS 121
           +  V A+Y    Q++ +L+ + GD I VLE++  +W++G+ +GK+G+FP NY  P    S
Sbjct: 231 IRKVRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYVTPIIELS 290

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%)

Query: 59  STALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAF 118
           ++ +  V A+Y  +  +  +L+ + GD I VLE++  +W++GS +GK+G+FP NY  P  
Sbjct: 211 TSGIRRVRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTPIT 270

Query: 119 SGSTNASKSE 128
             S   S+ E
Sbjct: 271 EPSPVESQRE 280

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (54%)

Query: 60  TALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFS 119
           T +  V A+Y     +  +L+ + GD I VLE++  +W+KG+  G +G+FP NY  P   
Sbjct: 235 TVVRKVRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTPISD 294

Query: 120 GSTNASKSELT 130
            S    + ELT
Sbjct: 295 LSNAELEQELT 305

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 36/56 (64%)

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKP 116
            ++ V A+Y     + G+L+ + GD I+V+E++  +W++GS  G VG+FP NY  P
Sbjct: 241 VVKRVRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGTVGIFPLNYVNP 296

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 54.7 bits (130), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 37/60 (61%)

Query: 59  STALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAF 118
           S  ++ V A+Y F   +  +L+ + GD I VLE++  +W++GS  G++G+FP NY  P  
Sbjct: 210 SAGVKKVRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNYVTPIM 269

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 48  PSMLSATTTRDST-ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNG 104
           PS  SAT    S  A E V A+Y +  Q +GDL+   G  I+++++ +   EW+ G  NG
Sbjct: 419 PSYTSATGVPQSAPAFETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKYNG 478

Query: 105 KVGVFPSNYTK 115
           + GVFP NY K
Sbjct: 479 QQGVFPGNYVK 489

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 4/70 (5%)

Query: 60  TALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFS 119
           T +  V A+Y F+  +  +L+ + GD I V+E++  +W++G+  G VG+FP NY  P   
Sbjct: 222 TVIRKVRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYVTPV-- 279

Query: 120 GSTNASKSEL 129
             T  S+ EL
Sbjct: 280 --TEPSQQEL 287

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKIS--PEWYKGSCNGKVGVFPSNYTK 115
           A+Y FD ++ GDL+ + GD I +++K     +W+ G CNG+ G+FP+NY +
Sbjct: 416 ALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEEGIFPANYVE 466

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNGKVGVFPSNYTK 115
           A+Y F  +Q GDLA + GD I +L+K     +W+ G  NGK G+FP+NY +
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVR 466

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 41/70 (58%), Gaps = 4/70 (5%)

Query: 60  TALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFS 119
           T ++ V A+Y     +  +L+ + GD I V+E++  +W++G+  G+VG+FP NY  P   
Sbjct: 228 TVIKRVRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGRVGIFPLNYVTPI-- 285

Query: 120 GSTNASKSEL 129
             T  +K EL
Sbjct: 286 --TEPTKEEL 293

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNGKVGVFPSNYTK 115
           A+Y F  +Q GDLA + GD I +L+K     +W+ G  NGK G+FP+NY +
Sbjct: 405 ALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVR 455

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNGKVGVFPSNYTK 115
           A+Y F  +Q GDLA + GD I +L+K     +W+ G  NGK G+FP+NY +
Sbjct: 423 ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVR 473

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 51  LSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNGKVGV 108
           L   +T  ++A     A+Y F  +Q GDLA + GD I +L+K     +W+ G  NGK G+
Sbjct: 400 LGNESTATNSATPTAVALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGI 459

Query: 109 FPSNYTK 115
           FP+NY +
Sbjct: 460 FPANYVR 466

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 57  RDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNYT 114
           R S+      A+Y F  +QDGDL  + GD I +L+K + +  W+ G  NG+ G+FP+NY 
Sbjct: 390 RPSSGTPKAVALYTFKGEQDGDLPFRTGDVIAILKKSNSQDDWWTGRVNGQEGIFPANYV 449

Query: 115 K 115
           +
Sbjct: 450 E 450

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 39/68 (57%)

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120
            +  V A+Y    ++  +L+ + GD I VLE++  +W++G+  GKVG+FP NY  P    
Sbjct: 224 VIRKVRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLNYVTPIEEP 283

Query: 121 STNASKSE 128
           S    ++E
Sbjct: 284 SAEELEAE 291

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 44  PSNAPSMLSATTTR----DSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYK 99
           P  AP+ L++ T+         +  V+AI+  +  +  +L+ + GD I V+E++  +W++
Sbjct: 190 PQQAPAALASETSLPEQPQPQIVRRVKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWR 249

Query: 100 GSCNGKVGVFPSNYT 114
           G   GKVG+FP NY 
Sbjct: 250 GLLRGKVGIFPVNYV 264

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 35/57 (61%)

Query: 60  TALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKP 116
           + +  V A+Y     +  +L+ + GD I VLE++  +W+KG+  G++G+FP NY  P
Sbjct: 221 SVVRRVRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYVTP 277

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 33/53 (62%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPA 117
           V A+Y  +  +  +L+   GD I V+E++  +W++G+  GKVG+FP NY  P 
Sbjct: 231 VRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIFPLNYVTPC 283

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 60  TALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKP 116
           T +  V A+Y     +  +L+ + GD I VLE++  +W+KG+  G +G+FP NY  P
Sbjct: 217 TVVRRVRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTP 273

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPA 117
           V+A+Y     +  +LA + GD I VLE++  +W++GS  G +G+FP NY  P 
Sbjct: 232 VKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYVTPV 284

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%)

Query: 55  TTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYT 114
           TT   T +  V A+Y     +  +L+ +  D I VLE++  +W+KG+  GK+G+FP NY 
Sbjct: 215 TTPVQTIVRRVRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYV 274

Query: 115 KP 116
            P
Sbjct: 275 TP 276

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNYTK 115
           A+Y F  ++ GDL+ + GD I +L+K   +  W+ G  NGK G+FP+NY +
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYVE 452

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 34/53 (64%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPA 117
           V A++    +   +L+ + GD I+V+E++  +W++GS  GK+G+FP NY  P 
Sbjct: 229 VRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYVTPV 281

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 59  STALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKIS--PEWYKGSCNGKVGVFPSNYT 114
           S A+    A+Y F  +Q GDL  + GD I +L++     +W+ G  NG+ G+FP+NY 
Sbjct: 356 SGAIPKAVALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTGRINGQEGIFPANYV 413

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 44  PSNAPSMLSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGS 101
           P+  P M +A      T +E V A+Y +  Q  GDL+   G  I+++++ +   EW+ G 
Sbjct: 443 PTAQPGMGAAPM---PTGVETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGR 499

Query: 102 CNGKVGVFPSNYTK 115
            NG+ GVFP NY +
Sbjct: 500 YNGQQGVFPGNYVQ 513

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 33/53 (62%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPA 117
           V A++    ++  +L+ + GD I V+E++  +W++G   G+VG+FP NY  P 
Sbjct: 217 VRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIFPLNYVTPV 269

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 12/85 (14%)

Query: 43  DPSNAPSMLSATTTRDSTALEYVE----------AIYRFDPQQDGDLAIQPGDKIQVLEK 92
           D +N  S +  +++R +T   YV           A++RF  +Q GDL+   GD + +L+K
Sbjct: 311 DVANRFSNVRLSSSRKNTDDSYVSSPIPQGPKAIALFRFKGEQAGDLSFNKGDVVTILKK 370

Query: 93  ISPE--WYKGSCNGKVGVFPSNYTK 115
              +  W+ G  N + G+FP+NY +
Sbjct: 371 TDTQNDWWTGRVNNQEGIFPANYVE 395

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 2/74 (2%)

Query: 44  PSNAPSMLSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGS 101
           P++A +  +  TT  ++A E V A+Y +  Q +GDL    G  I+V+E+ +    W+ G 
Sbjct: 359 PASAYTAYTPPTTAPASAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGR 418

Query: 102 CNGKVGVFPSNYTK 115
            NG  GVFP NY +
Sbjct: 419 YNGYQGVFPGNYVQ 432

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEK--ISPEWYKGSCNGKVGVFPSNYTK 115
           A+Y F+ +Q GDL  + GD I +L+K     +W+ G  NG+ G+FP+NY +
Sbjct: 165 ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 215

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 45/85 (52%), Gaps = 6/85 (7%)

Query: 37  SLPERYDPSNAPSMLSATTTRDSTAL----EYVEAIYRFDPQQDGDLAIQPGDKIQVLEK 92
           S P  Y  S+A +   +T T  +T L    E V A+Y +  Q +GDL    G  I+V+E+
Sbjct: 380 SQPPAYSSSDASAFGGSTYTPPTTGLQPGVETVTALYDYQAQAEGDLTFPVGAIIEVVER 439

Query: 93  ISPE--WYKGSCNGKVGVFPSNYTK 115
            +    W+ G  NG+ GVFP NY +
Sbjct: 440 TTDTNGWWTGRYNGQQGVFPGNYVQ 464

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNYTK 115
           A+Y F  ++ GDL  + GD I VL+K   +  W+ G  NG+ G+FP+NY +
Sbjct: 412 ALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPANYVE 462

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 63  EYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNYTK 115
           E V A+Y F  +Q GDLA + GD I V++K   +  W+ G    K G+FP+NY +
Sbjct: 367 EKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFPANYVE 421

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNGKVGVFPSNYTK 115
            +E V A+Y +  Q  GDL+   G  I+++E+ S   EW+ G  NG+ GVFP NY +
Sbjct: 399 GVETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGVFPGNYVQ 455

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 3/61 (4%)

Query: 57  RDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNYT 114
           R+S A + V A+Y F  ++ GDL  + GD I +++K   +  W+ G  NGK G+FP+NY 
Sbjct: 362 RNSGAPKAV-ALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEGIFPANYV 420

Query: 115 K 115
           +
Sbjct: 421 E 421

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 56  TRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNY 113
           T  ST+     A+Y F  ++ GDL  + GD I +L+K   +  W+ G  NG+ G+FP+NY
Sbjct: 397 TSPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANY 456

Query: 114 TK 115
            +
Sbjct: 457 VE 458

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 59  STALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNYTK 115
           STA + V A+Y F  ++ GDL  + GD I +L+K   +  W+ G  NG+ G+FP+NY +
Sbjct: 382 STAPKAV-ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 439

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 56  TRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNY 113
           T  ST+     A+Y F  ++ GDL  + GD I +L+K   +  W+ G  NG+ G+FP+NY
Sbjct: 396 TSPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANY 455

Query: 114 TK 115
            +
Sbjct: 456 VE 457

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNYTK 115
           A+Y F  ++ GDL  + GD I +L+K   +  W+ G  NG+ G+FP+NY +
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 457

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKIS--PEWYKGSCNGKVGVFPSNYTK 115
           A+Y F  +Q GDL  + GD + +L+K     +W+ G  NG+ G+FP+NY +
Sbjct: 376 ALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEGIFPANYVE 426

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 4/74 (5%)

Query: 44  PSNAPSMLSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGS 101
           P  A SM +ATT     A   V A+Y +  Q  GDL+   G  I+V+++     EW+ G 
Sbjct: 398 PPPAYSMSTATTA--PPAANTVTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGR 455

Query: 102 CNGKVGVFPSNYTK 115
            NG+ GVFP NY +
Sbjct: 456 YNGQQGVFPGNYVQ 469

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%)

Query: 60  TALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPA 117
           T +  V A+Y        +L+ + GD I VLE++  +W+KG    + G+FP NY  P 
Sbjct: 228 TIVRKVRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYVTPV 285

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNYTK 115
           A+Y F  ++ GDL  + GD I +L+K   +  W+ G  NG+ G+FP+NY +
Sbjct: 381 ALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPANYVE 431

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNYTK 115
           A+Y F  +Q GDL  + GD I +L+K   +  W+ G  NG+ G+FP+NY +
Sbjct: 347 ALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVE 397

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKP 116
           V A+Y     +  +L+   GD I VLE++  +W++G+  G  G+FP NY  P
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVTP 271

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNYTK 115
           A+Y F  ++ GDL+ + GD I +++K   +  W+ G  NG+ G+FP+NY +
Sbjct: 385 ALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGREGIFPANYVE 435

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 4/73 (5%)

Query: 47  APSMLSATTTRDST--ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSC 102
            PS ++   TRD          A+Y F  ++ GDL+ + GD I +++K     +W+ G  
Sbjct: 437 GPSRMTGIPTRDDAVPGSPKAVALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRV 496

Query: 103 NGKVGVFPSNYTK 115
           +G+ G+FP+NY +
Sbjct: 497 SGREGIFPANYVE 509

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKIS--PEWYKGSCNGKVGVFPSNYTK 115
            +E V A+Y +  Q  GDL+   G  I+++++ +   EW+ G  NG+ GVFP NY +
Sbjct: 382 GMETVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNYTK 115
           A+Y F  +++GDL  + GD I ++++   +  W+ G+ NGK G+FP+NY +
Sbjct: 344 ALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYVE 394

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 53  ATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFP 110
           A  T  ST+     A++ F  ++ GDL  + GD + +L+K   +  W+ G  NG+ G+FP
Sbjct: 389 AAPTSPSTSSPKAVALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFP 448

Query: 111 SNYTK 115
           +NY +
Sbjct: 449 ANYVE 453

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 63  EYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNGKVGVFPSNYTK 115
           E V A+Y +  Q  GDL+   G  I+++E+     EW+ G  NG+ GVFP NY +
Sbjct: 405 ETVTALYEYQAQAAGDLSFPAGAVIEIVERTPDVNEWWTGRYNGQQGVFPGNYVQ 459

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 57  RDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLE-KISPEWYKGSCNGKVGVFPSNYTK 115
           R +  +  +EAIY ++ Q D +++I PGD I V+       W  G C+G  G+FP++Y K
Sbjct: 574 RSTLPVRTMEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

 Score = 29.6 bits (65), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 66  EAIYRFDPQQDGDLAIQPGDKIQVLEKISPE-WYK--GSCNGKVGVFPSNYTKPAFSGST 122
           + +Y +  + D ++ I PGDKI ++ + +   W K      G+ G+ P+ Y + + + + 
Sbjct: 499 KVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRISSAATV 558

Query: 123 NAS 125
            A+
Sbjct: 559 KAN 561

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 59  STALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNGKVGVFPSNYTK 115
           + A EY  ++Y +  Q  GDL+   G  IQ++++ +   +W+ G  NG+ GVFP NY +
Sbjct: 396 AQAGEYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGNYVQ 454

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 39/70 (55%), Gaps = 4/70 (5%)

Query: 49  SMLSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE---WYKGSCNGK 105
           S  +  TT   +A E V A+Y +  Q +GDL    G  I+V+E+ +P+   W+ G  NG 
Sbjct: 390 STYTPPTTAPLSAPETVTALYDYQAQAEGDLTFPAGAIIEVVER-TPDVNGWWTGRYNGY 448

Query: 106 VGVFPSNYTK 115
            GVFP NY +
Sbjct: 449 QGVFPGNYVQ 458

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 4/65 (6%)

Query: 55  TTRDSTALEYVEAIYRF-DPQQDGDLAIQPGDKIQVLEKISPEWYKGSC---NGKVGVFP 110
           T+R    + Y +A+Y F +P ++  L  Q GD + + EK++ +WY G     NG+ G+ P
Sbjct: 611 TSRGQRVIGYAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIP 670

Query: 111 SNYTK 115
            NY K
Sbjct: 671 MNYVK 675

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 59  STALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNYTK 115
           ST+     A+Y F  ++ GDL  + GD I +L+K   +  W+ G  +G+ G+FP+NY +
Sbjct: 399 STSSPKAVALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFPANYVE 457

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 63  EYVEAIYRFDPQQDGDLAIQPGDKIQVLEKI--SPEWYKGSCNGKVGVFPSNYTK 115
           E V A+Y +  Q  GDL+   G  I+++++   + EW+ G  NG+ GVFP NY +
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNGKVGVFPSNYTK 115
           +E V A+Y +  Q  GDL+   G  I+V+++     EW+ G  NG+ GVFP NY +
Sbjct: 409 VETVTALYDYQAQAAGDLSFPAGAVIEVVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 464

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 56  TRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKIS--PEWYKGSCNGKVGVFPSNY 113
           TR S++     A+Y F  ++ GDL  + GD I +L+K     +W+ G  N   G+FP+NY
Sbjct: 386 TRQSSSTPKAIALYSFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRVNTSEGIFPANY 445

Query: 114 TK 115
            +
Sbjct: 446 VE 447

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 2/85 (2%)

Query: 45  SNAPSMLSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNG 104
           +N P +    T   +  ++ V A+Y  +     +LA +  D I V+E+   +W+ GS   
Sbjct: 201 ANQPEVTKRETG--TNTIKKVRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGR 258

Query: 105 KVGVFPSNYTKPAFSGSTNASKSEL 129
           +VG+FP NY  P    +    + EL
Sbjct: 259 RVGIFPLNYVTPIIELTPEQKQKEL 283

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE-WYKGSCNGKVGVFPSNY 113
           L+ V AIY +  Q D +++I+ GD I+VL   +   W  G  NG  G+FPSNY
Sbjct: 572 LKTVTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPSNY 624

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 63  EYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNGKVGVFPSNYTK 115
           E V A+Y +  Q  GDL+   G  I+++++     EW+ G  NG+ GVFP NY +
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 478

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPE--WYKGSCNGKVGVFPSNYTK 115
           A+Y F  ++  DL  + GD I +L+K   +  W+ G  NG+ G+FP+NY +
Sbjct: 372 ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 422

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 63  EYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNGKVGVFPSNYTK 115
           E V A+Y +  Q  GDL+   G  I+++++     EW+ G  NG+ GVFP NY +
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 468

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 45  SNAPSMLSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLE-KISPEWYKGSCN 103
           S  P+ ++  + R +T    V+A+Y ++ Q D +++I  GD I V++      W  G  N
Sbjct: 563 SRGPAPVAPPSRRKTTTTRKVQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELN 622

Query: 104 GKVGVFPSNYTK 115
           G  G+FPS+Y K
Sbjct: 623 GIKGLFPSSYCK 634

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKI--SPEWYKGSCNGKVGVFPSNYTK 115
           ++E V A+Y +  Q  GDL+      I+++++   + EW+ G  +G+VGVFP NY +
Sbjct: 399 SVETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 39  PERYDPSNAPSMLSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE-W 97
           P   +PS   S  S  TT    A E   A+Y F  Q DGDL+      I++L++     W
Sbjct: 311 PAYSEPSYGSSSASPATT---AAPETCIALYDFAAQADGDLSFPVNAIIEILDRSDAAGW 367

Query: 98  YKGSCNGKVGVFPSNYT 114
           + G  NG+ G+FP+NY 
Sbjct: 368 WTGRYNGREGLFPANYV 384

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNGKVGVFPSNYT 114
           V A+Y F+ QQ GDL+ +  D I V +K     +W+ G  +G  GVFP+NY 
Sbjct: 337 VRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKIS--PEWYKGSCNGKVGVFPSNYTK 115
           A+Y F  ++ GDL  + GD I +L+K     +W+ G   G+ G+FP+NY +
Sbjct: 417 ALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGREGIFPANYVE 467

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 63  EYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNGKVGVFPSNYTK 115
           E   ++Y +  Q  GDL+   G  I+++E+ +   EW+ G  NG+ GVFP NY +
Sbjct: 413 ETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQGVFPGNYVQ 467

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 54  TTTRDSTALEYVEAIYRFDPQQDGD-LAIQPGDKIQVLEKISPEWYKGSC---NGKVGVF 109
            T++    + Y  AIY F    D D L  + GD + + EK++ +WY G     NGK G+ 
Sbjct: 615 VTSKGRRVIGYARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLI 674

Query: 110 PSNYTK 115
           P NY +
Sbjct: 675 PMNYVE 680

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE-WYKGSCNGKVGVFPSNYTK 115
           A   V+A++ ++ Q D +++I+ GD I VL+      W  G  NG+ G+FP+NY +
Sbjct: 567 AARTVKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYGELNGQKGLFPTNYCQ 622

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLE-KISPEWYKGSCNGKVGVFPSNYTK 115
           +EA+Y ++ Q D +++I  GD+I V+       W  G C+G  G+FP++Y +
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 66  EAIYRFDPQQDGDLAIQPGDKIQVLEKISPE-WYK--GSCNGKVGVFPSNYTKPAFSGST 122
           + +Y +  Q D ++ I PGDKI ++ + +   W K      G+ G+ P+ Y + + + S 
Sbjct: 499 KVLYAYVKQDDDEIDITPGDKISLVARDTGSGWTKINNGNTGETGLVPTTYIRVSSAASA 558

Query: 123 NAS 125
            A+
Sbjct: 559 TAN 561

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 57  RDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLE-KISPEWYKGSCNGKVGVFPSNYTK 115
           R +  +  +EA+Y ++ Q D +++I  GD I V+       W  G C+G  G+FP++Y K
Sbjct: 574 RSTLPIRTLEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 66  EAIYRFDPQQDGDLAIQPGDKIQVLEKISPE-WYK--GSCNGKVGVFPSNYTKPAFSGST 122
           + +Y +  Q D +++I PGD+I ++ + +   W K      G+ G+ P+ Y + + + + 
Sbjct: 499 KVLYAYVKQDDDEISISPGDRISLVARDTGSGWTKINNDSTGESGLVPTTYIRISTTDTA 558

Query: 123 NAS 125
            A+
Sbjct: 559 TAN 561

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 59  STALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE-WYKGSCNGKVGVFPSNYTK 115
           S  +E   A+Y +  Q +GDL    G  IQV+++     W+ G  NG  GVFP NY +
Sbjct: 367 SAGVETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFPGNYVE 424

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 59  STALEYVEAIYRFDPQQDGDLAIQPGDKIQVLE-KISPEWYKGSCNGKVGVFPSNYTK 115
           + ++  VEAIY ++   D +L+I  G+ I+V+       W  G  NG  G+FPS+Y K
Sbjct: 580 TASIRTVEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 44  PSNAPSMLSATTTRDST-ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKI-SPEWYKGS 101
           P+ +PS  +A TT  +  A E   ++Y F  Q   DL       I++L++  S  W+ G 
Sbjct: 344 PAYSPSPYTAYTTPSTAPAPETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWTGR 403

Query: 102 CNGKVGVFPSNYTK 115
            NG+ G+FP NY +
Sbjct: 404 YNGQEGLFPGNYVR 417

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 7/65 (10%)

Query: 58  DSTALEYVEAIYRFDPQQDG-DLAIQPGDKIQVLEKISP-----EWYK-GSCNGKVGVFP 110
           D + LE+  A+Y F P+    ++A+  GD + +L K  P     +W+K  + NGK+G  P
Sbjct: 321 DPSKLEFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKNGKIGYIP 380

Query: 111 SNYTK 115
            NY +
Sbjct: 381 YNYIE 385

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 57  RDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE-WYKGSCNGKVGVFPSNYTK 115
           R   A   VEA+Y +  Q + + ++  GD I VL+      W  G  NG+ G+FP++Y K
Sbjct: 562 RKGGATRTVEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEKGLFPTSYCK 621

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 7/65 (10%)

Query: 58  DSTALEYVEAIYRFDPQQ-DGDLAIQPGDKIQVLEKISP-----EWYK-GSCNGKVGVFP 110
           D + LE+  A+Y F P+  + ++A++ GD + +L K  P     +W+K  + NG +G  P
Sbjct: 304 DPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIP 363

Query: 111 SNYTK 115
            NY +
Sbjct: 364 YNYIE 368

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 57  RDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLE-KISPEWYKGSCNGKVGVFPSNYTK 115
           R +  +  +EA Y ++ + D +++I  GD I V+       W  G C+G  G+FP++Y K
Sbjct: 575 RTALPVRTLEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 634

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 66  EAIYRFDPQQDGDLAIQPGDKIQVLEKISPE-WYK--GSCNGKVGVFPSNYTK 115
           + +Y +  Q   +++I PGDKI ++ + S   W K      G+ G+ P+ Y +
Sbjct: 499 KVLYAYSKQDTDEISISPGDKISLVARDSGSGWTKINNDSTGETGLVPTTYVR 551

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 57  RDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE-WYKGSCNGKVGVFPSNY 113
           R+ T+L  V A+Y +  +   +++I+ GD I+V+   +   W  G   G  G+FPSNY
Sbjct: 613 RNPTSLRTVIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNY 670

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 4/59 (6%)

Query: 61  ALEYVEAIYRF-DPQQDGDLAIQPGDKIQVLEKISPEWYKGSC---NGKVGVFPSNYTK 115
            ++YV+A+Y + +P ++  L    GD + ++E I+ +WY G     N + G+ P NY K
Sbjct: 546 VVKYVKAMYSYTEPNENNILLFNSGDILLLVECINDDWYVGEVYQGNKQHGLVPMNYVK 604

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 7/65 (10%)

Query: 58  DSTALEYVEAIYRFDPQQ-DGDLAIQPGDKIQVLEKI-----SPEWYK-GSCNGKVGVFP 110
           D T LE+  AIY F P+  + ++ +Q GD + +L K        +W+K  + NG VG  P
Sbjct: 255 DPTKLEFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQWWKVRTKNGSVGFVP 314

Query: 111 SNYTK 115
            NY +
Sbjct: 315 FNYIE 319

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 7/65 (10%)

Query: 58  DSTALEYVEAIYRFDPQQ-DGDLAIQPGDKIQVLEKISP-----EWYK-GSCNGKVGVFP 110
           D + LE+  A+Y F P+    ++A++ GD + +L K  P     +W+K  + NG +G  P
Sbjct: 310 DPSKLEFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKNGSIGYIP 369

Query: 111 SNYTK 115
            NY +
Sbjct: 370 YNYIE 374

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWY-----KGSCNGKVGVFPSNYTKPA 117
           V A Y ++   DGDL  + G +I+V+     +WY      G+ N + G+FP NY + A
Sbjct: 13  VIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYVEVA 70

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKG---SCNGKV--GVFPSNYTKP 116
           ++ V AI+ ++ +   +L +Q GD I V+ K    W+ G     NGKV  G FP NY + 
Sbjct: 48  VDVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHRGWFPQNYCRS 107

Query: 117 AFS 119
           + S
Sbjct: 108 SHS 110

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 7/65 (10%)

Query: 58  DSTALEYVEAIYRFDPQQDG-DLAIQPGDKIQVLEKISP-----EWYK-GSCNGKVGVFP 110
           D   LE+  A+Y F P+    + +++ GD + ++ K+ P     +W+K  +  G+VG  P
Sbjct: 310 DLNNLEFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKKGEVGYIP 369

Query: 111 SNYTK 115
           SNY +
Sbjct: 370 SNYIE 374

>KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 380

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 56  TRDSTALEYVEAIYRFDPQQ-DGDLAIQPGDKIQVLEKISP-----EWYK-GSCNGKVGV 108
           T D   LE+  A+Y F P+    + A++ GD + V+ K  P     EW++  +  G VG 
Sbjct: 304 TLDPRNLEFARAVYDFTPENPQVEAALRKGDLMAVISKQDPLGNASEWWQVRTKKGDVGY 363

Query: 109 FPSNYTK 115
            PSNY +
Sbjct: 364 VPSNYVE 370

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 7/60 (11%)

Query: 60  TALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE----WYKGSCNGKVGVFPSNYTK 115
           +++  +EA+Y +  Q D +L+I  G  ++VL+   P+    W  G  +G  G+FP++Y K
Sbjct: 569 SSVRTIEALYDYQAQGDDELSIYAGSVVKVLK---PDDGSGWTYGELDGAKGLFPTSYCK 625

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCN--GKVGVFPSNYT 114
           A Y +D  +D +L    GDKI  +E +  +W+ G     G+ G+FPSNY 
Sbjct: 517 AEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYV 566

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 7/65 (10%)

Query: 58  DSTALEYVEAIYRFDPQ-QDGDLAIQPGDKIQVLEKISP-----EWYK-GSCNGKVGVFP 110
           D + LE+  A++ F+P+ +  +L +  GD + +L K  P     +W+K  + NG  G  P
Sbjct: 302 DLSNLEFARALFDFNPENRKIELTLTKGDLMAILTKKDPYGNTSKWWKVRTKNGDTGYVP 361

Query: 111 SNYTK 115
           SNY +
Sbjct: 362 SNYIE 366

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCN--GKVGVFPSNYTK 115
           A Y ++  +D +L  + GD+I  +E +  +W+ G     G+ G+FPSNY K
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNYT 114
           A Y ++  +D +L  +  DKI  +E +  +W+ G    NG+ G+FPSNY 
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 38  LPERYDPSNAPSMLSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVL-EKISPE 96
           L +   PS + +          +A + + A Y +  Q   +L++Q GDKI+VL E     
Sbjct: 571 LQQSTTPSTSRAPPPRAPQPRKSAQKTMTAAYPYQSQGPDELSLQVGDKIKVLKEDEGNG 630

Query: 97  WYKGSCNGKVGVFPSNY 113
           W  G  NG  G+FP+ Y
Sbjct: 631 WTFGELNGTQGLFPTTY 647

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 8/61 (13%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKIS-PEWY--KGSCNG-----KVGVFPSNYTKP 116
           V+A+Y ++PQ D +LAI+  D + +LEK    EW+  K    G       G+ PSNY +P
Sbjct: 8   VKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVKKRVIGLDAEEPTGLVPSNYVEP 67

Query: 117 A 117
           A
Sbjct: 68  A 68

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGK-----VGVFPSNYTK 115
           V A+  ++PQ   DL I  GDKI VL      WY G    K      G+FPS++ K
Sbjct: 11  VVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVK 66

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 7/88 (7%)

Query: 29  SVFKEINSSLPERYDPSNAPSMLSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQ 88
           + + EIN +   +  P   P   +   TR       ++A Y ++ Q D +L++ P D + 
Sbjct: 532 TTYVEINEAAKIKEAPKVPPPRRTNMPTR------TMQAQYDYEAQGDDELSLTPNDVVN 585

Query: 89  VLE-KISPEWYKGSCNGKVGVFPSNYTK 115
           V+       W  G  NG+ G+FP++Y +
Sbjct: 586 VIRGDDGSGWTYGELNGEKGLFPTSYCR 613

>CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310c CDC25 GDP/GTP exchange factor for RAS1P and
           RAS2P
          Length = 1564

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 79  LAIQPGDKIQVLEKISPEWYKG------SCNGKVGVFPSNYTKP 116
           L++QPGD + VL K    W+ G      S     G FP NYTKP
Sbjct: 38  LSMQPGDTVYVLAKDQSGWWDGLIIDEKSDKAVRGWFPQNYTKP 81

>Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191W
           (PEX13) - Peroxisomal membrane protein that contains Src
           homology 3 (SH3) domain [contig 101] FULL
          Length = 384

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query: 58  DSTALEYVEAIYRFDPQQDG-DLAIQPGDKIQVLEKISP-----EWYK-GSCNGKVGVFP 110
           D  +LE+  AIY F P+    +L ++ GD + V+ K  P     EW++  +  G +G  P
Sbjct: 303 DPRSLEFARAIYDFTPENPQIELTLKKGDLMAVISKQDPMGNPSEWWRVRTKKGDIGYVP 362

Query: 111 SNY 113
            NY
Sbjct: 363 YNY 365

>KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {ON}
           Anc_7.413 YER114C
          Length = 930

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 5/54 (9%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVL---EKISPEWYKGSC--NGKVGVFPSNYTK 115
           A+  +  + + +++I+PGDKIQV+   E  +  WY G     GK G+FP  +T+
Sbjct: 33  AVSAYTKRMEDEISIKPGDKIQVITDDEDYNDGWYVGRNLRTGKEGLFPKIFTQ 86

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 37.0 bits (84), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 64  YVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNY 113
           +  A Y +D  ++ +L     DKI  +E +  +W+ G    NG+ G+FPSNY
Sbjct: 559 WATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKGLFPSNY 610

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 37.0 bits (84), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISP--EWYKGSCNGKVGVFPSNYTK 115
           A++ F   + GDL  + GD I ++++     +W+ G  N + G+FP+NY +
Sbjct: 529 ALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYVE 579

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 37.0 bits (84), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCN--GKVGVFPSNY 113
           A Y +D  +D +L  +  DKI  +E +  +W+ G     G+ G+FPSNY
Sbjct: 615 AEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLGELGSTGEKGLFPSNY 663

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 64  YVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNYT 114
           +  A Y +D  +D +L     DKI  +E +  +W+ G    +G  G+FPSNY 
Sbjct: 535 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 587

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 36.6 bits (83), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 7/59 (11%)

Query: 64  YVEAIYRF--DPQQDG---DLAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNYTK 115
           Y  A+Y +  DP Q G   DL  + GD I+V++K    W+ G      + G FP N+ +
Sbjct: 378 YATALYDYSPDPNQQGTGEDLTFKNGDMIRVIKKTENNWWYGEVLRTKRRGYFPVNFVE 436

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 36.6 bits (83), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 10/81 (12%)

Query: 37  SLPERYDPSNAPSMLSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE 96
           SLP R + +  PS  +      +TA+    A Y ++  +D +L     DKI  +E +  +
Sbjct: 501 SLPSRENATEEPSKPAGG----ATAI----AQYDYEAAEDNELTFNENDKIINIEFVDDD 552

Query: 97  WYKGSC--NGKVGVFPSNYTK 115
           W+ G    +G+ G+FPSNY +
Sbjct: 553 WWLGELESSGEKGLFPSNYVE 573

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 36.6 bits (83), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 64  YVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNYT 114
           +  A Y +D  +D +L     DKI  +E +  +W+ G    +G  G+FPSNY 
Sbjct: 530 WATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR191W
           (PEX13)
          Length = 398

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query: 58  DSTALEYVEAIYRFDPQQDG-DLAIQPGDKIQVLEKISP-----EWYK-GSCNGKVGVFP 110
           D  +LE+  AIY F P+    + A++ GD + ++ +  P     +W+K  +  G VG  P
Sbjct: 310 DLNSLEFARAIYDFTPENPRIECALKKGDLMAIISRQDPTGKESQWWKVRTKKGDVGYVP 369

Query: 111 SNY 113
            NY
Sbjct: 370 CNY 372

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 57  RDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE----WYKGSCNGKVGVFPSN 112
           R +  +  + A+Y ++ Q D ++++  GD I+V   I P+    W  G  N K  +FP++
Sbjct: 609 RTTVLIRTMVALYPYEAQGDDEMSLAVGDTIKV---IKPDDGSGWTFGELNNKQSLFPTS 665

Query: 113 YTK 115
           Y K
Sbjct: 666 YCK 668

 Score = 35.8 bits (81), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 41  RYDPSNAPSMLSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPE-WYK 99
           R+  SN  S LSA     STA    + +Y +    D +++I PGD I V+EK +   W K
Sbjct: 515 RHTKSNI-STLSANNKMYSTA-NSSKVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTK 572

Query: 100 --GSCNGKVGVFPSNY 113
                 G++G+ PS+Y
Sbjct: 573 INNHSTGEIGLVPSSY 588

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 36.2 bits (82), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%), Gaps = 13/86 (15%)

Query: 51  LSATTTRDSTALEYV-EAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGS--CNGKVG 107
           L+A  ++D ++ E V +A+Y +  Q  G+L+   GD   VL +   EWY  S   +GK G
Sbjct: 56  LNAPKSKDISSPEKVIKAMYNYQAQSPGELSFVKGDFFHVLTE-DREWYDASNPSDGKRG 114

Query: 108 VFPSNY------TKPAFSGSTNASKS 127
           + P +Y      T+P   GS N S S
Sbjct: 115 MVPKSYFEIFGRTRP---GSVNGSGS 137

>KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.413
           YER114C
          Length = 904

 Score = 36.2 bits (82), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEK---ISPEWYKG---SCNGKVGVFPSNYTK 115
            I R+  + + +L + PGD+I+VLE        WY G   S   +VG+FP  +TK
Sbjct: 24  VINRYAKRMEDELDLVPGDRIEVLEADELYGDGWYTGKNLSRGSQVGLFPEVFTK 78

>TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7.413
           YER114C
          Length = 1005

 Score = 36.2 bits (82), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 7/55 (12%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKIS---PEWYKG---SCNGKVGVFPSNYTK 115
           A+  +  + D +L + PGDKIQVL   S     WY G   + N K G++P N+T+
Sbjct: 26  AVAEYQKRMDDELNMMPGDKIQVLNDDSLYNDGWYLGINLTTNEK-GLYPLNFTQ 79

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 36.2 bits (82), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 64  YVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNY 113
           +  A Y +D  +D +L     DKI  +E +  +W+ G    +G  G+FPSNY
Sbjct: 544 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNY 595

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 36.2 bits (82), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 64  YVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCN--GKVGVFPSNYT 114
           +  A Y ++  +D +L  +  DKI  +E +  +W+ G     G+ G+FPSNY 
Sbjct: 523 WATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 35.8 bits (81), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 69  YRFDPQQDGDLAIQPGDKIQVL-EKISPEWYKGSCNGKVGVFPSNYTK 115
           Y +D Q++ ++ ++ GD + VL E     W     +G  G+ P+NY K
Sbjct: 612 YDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGLIPTNYCK 659

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 35.8 bits (81), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 64  YVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNYT 114
           +  A Y +D  +D +L     DKI  +E +  +W+ G    +G  G+FPSNY 
Sbjct: 536 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 35.8 bits (81), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 9/70 (12%)

Query: 61  ALEYVEAIYRFDPQQDGDLA-IQPGDKIQVLEKISPEWYKGSC--------NGKVGVFPS 111
            +EY +A+Y     +   LA    GD I + E ++ +WYKG          N +VG+ P 
Sbjct: 594 VIEYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIPY 653

Query: 112 NYTKPAFSGS 121
           N+ +    GS
Sbjct: 654 NFIQLLHQGS 663

>Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa]
           {ON} YLR310C (REAL)
          Length = 1587

 Score = 35.8 bits (81), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 11/63 (17%)

Query: 65  VEAIYRFD--PQQDGD---LAIQPGDKIQVLEKISPEWYKG----SCNGKV--GVFPSNY 113
           V A Y F+   ++DG    L++Q GD I +L K S  W+ G      +GKV  G FP N+
Sbjct: 66  VVAAYDFNHPTKKDGSSQLLSVQQGDTIYILNKNSSGWWDGLVIDDSSGKVDRGWFPQNF 125

Query: 114 TKP 116
            +P
Sbjct: 126 GRP 128

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 35.4 bits (80), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 64  YVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNY 113
           +  A Y +D  ++ +L     DKI  +E +  +W+ G    NG+ G+FPSNY
Sbjct: 519 WALAEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNY 570

>SAKL0F11748g Chr6 complement(915861..917087) [1227 bp, 408 aa] {ON}
           similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191W PEX13 Integral peroxisomal membrane receptor
          Length = 408

 Score = 35.0 bits (79), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 7/69 (10%)

Query: 52  SATTTRDSTALEYVEAIYRFDPQQDG-DLAIQPGDKIQVLEKISP-----EWYK-GSCNG 104
           S  T+ D   LE+  A+Y F P+    ++ ++ GD + ++ K  P     +W+K  +  G
Sbjct: 313 SLRTSPDPKNLEFARAVYDFTPENPQIEVTLKKGDLMAIISKQDPIGNESQWWKVRTKKG 372

Query: 105 KVGVFPSNY 113
            +G  P NY
Sbjct: 373 DIGYVPYNY 381

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 32.0 bits (71), Expect = 0.10,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 79  LAIQPGDKIQVLEKI--SPEWYKGSCNGKVGVFPSNYTK 115
           L    G  I+++++   + EW+ G  NG+ GVFP NY +
Sbjct: 1   LTFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 39

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCN--GKVGVFPSNYTK 115
           A Y ++  ++ +L    GDKI  +E +  +W+ G     G+ G+FPSNY +
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVE 633

>TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1618

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 4/45 (8%)

Query: 76  DGDLAIQPGDKIQVLEKISPEWYKG-SCNGKV---GVFPSNYTKP 116
           D  L   PGDKI VL K    W+ G   +GKV   G FP ++ KP
Sbjct: 50  DTYLRFNPGDKIYVLNKNDNGWWDGIVLHGKVVTRGWFPLHFVKP 94

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
           {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKV-GVFPSNYTK 115
           V+A Y +  Q  GDL    GD ++V  KI+ +WY G    N K  G FP+N+ K
Sbjct: 15  VKAKYGWSGQAKGDLGFLEGDVMEV-TKITGDWYYGRLLRNRKCSGYFPNNFVK 67

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGS--CNGKVGVFPSNY 113
           ++A+Y +  Q  G+L+   GD   V ++   +WY+ S   +GK G+ P NY
Sbjct: 68  IKALYNYQAQSAGELSFNKGDFFHVQQE-ENDWYEASNPADGKRGMVPKNY 117

>CAGL0F05885g Chr6 (588828..590966) [2139 bp, 712 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032w HOF1
           involved in cytokinesis
          Length = 712

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 38/84 (45%), Gaps = 9/84 (10%)

Query: 41  RYDPSNAPSMLSATTTRDSTALEYVEAIYRFDPQQDGDLA-IQPGDKIQVLEKISPEWYK 99
           R D +  P  L   T      +++ +A+Y     +  +LA  + GD + + E ++ +WY+
Sbjct: 623 RVDDNGMPVTLPTITKEGEEVIKFAKALYPLINSEAQELANFEKGDYLLLTEVVNEDWYR 682

Query: 100 GSCNGKV--------GVFPSNYTK 115
           G   G          G+ PSN+ +
Sbjct: 683 GEVYGNSNTTTTHGNGLIPSNFIQ 706

>TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1394

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 18/73 (24%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKG----------------SCNGK 105
           ++ V  I+ F P     L +Q G  I V+EK S  W+ G                    K
Sbjct: 9   IDIVVVIHNFTPTSSNMLPLQSGSIIYVIEKNSNGWWDGVQLVAGTQSGSFSPKSGSTQK 68

Query: 106 V--GVFPSNYTKP 116
           +  G FP+NYTKP
Sbjct: 69  IIRGWFPANYTKP 81

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query: 65  VEAIYRF--DPQQDGDLAIQPGDKIQVLEKISPEWYKGSC-NGKVGVFPSNYTK 115
           V+A+Y +  D     +L+ + GD ++V   I   W+K    NG+ G+ PSNY K
Sbjct: 300 VKALYSYKADDSDAYELSFEQGDILKV-SDIEGRWWKARKENGQTGIIPSNYVK 352

>TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON}
           Anc_7.413 YER114C
          Length = 1011

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 5/70 (7%)

Query: 51  LSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVL---EKISPEWYKGSC--NGK 105
           + AT  + + +L    AI  +  + + +L  +PGDKIQVL   E+ +  WY G      +
Sbjct: 64  VEATNNKGARSLPIYIAINEYSKRMEDELDFRPGDKIQVLLDDEEYNDGWYFGRNLRTQE 123

Query: 106 VGVFPSNYTK 115
            G++P+ +T+
Sbjct: 124 EGLYPAVFTQ 133

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 5/59 (8%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKG---SCNGKV--GVFPSNYTK 115
           ++ V A Y + P +   L +  GD + VL K    W+ G     N K   G FP NY+K
Sbjct: 23  VDVVVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIILDSNNKASRGWFPCNYSK 81

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCN--GKVGVFPSNYTK 115
           A Y ++  +D +L  + GD I  ++ +  +W+ G     G+ G+FPSNY +
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVE 575

>TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7.413
           YER114C
          Length = 1555

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 5/53 (9%)

Query: 68  IYRFDPQQDGDLAIQPGDKIQVL---EKISPEWYKGSC--NGKVGVFPSNYTK 115
           I  +  + D +L ++PGDKIQV+   E+ +  WY G     G+ G++P  +T+
Sbjct: 55  INEYTKRMDDELDMKPGDKIQVITDDEEYNDGWYFGKNLRTGEEGLYPVVFTQ 107

>KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1249

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 8/64 (12%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKIS-PEWYK------GS-CNGKVGVFPSNY 113
           L   +A+++++PQ D +LAI  GD + +L+K    +W+       GS     VG+ P+NY
Sbjct: 5   LGIYKAVFQYEPQSDEELAIDEGDMLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVPNNY 64

Query: 114 TKPA 117
            + A
Sbjct: 65  IEEA 68

>AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON}
           NOHBY516; No homolog in Saccharomyces cerevisiae'
          Length = 414

 Score = 33.5 bits (75), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 64  YVEAIYRFDPQQDGD--LAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNYTK 115
           Y  A+Y +DPQ +    L+I+ GD IQV+ +    W+ G        G+FP +Y +
Sbjct: 353 YATALYDYDPQFNDPQYLSIKKGDIIQVITQSKNGWWYGDLLRTKTKGLFPQSYVQ 408

>CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} similar
           to uniprot|P38041 Saccharomyces cerevisiae YBL085w BOB1
           BEM1 protein-binding protein or uniprot|P39969
           Saccharomyces cerevisiae YER114c BOI2
          Length = 999

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLE---KISPEWYKGSC--NGKVGVFPSNYTKPAFSGS 121
            +  +  + + ++ ++PGDKI+VL    +    WY+G      +VG++P+ +T+P    +
Sbjct: 7   CVNEYRRRMEDEIDMKPGDKIEVLMDDGEYKDGWYQGKNLRTAQVGLYPAVFTQPIGHTT 66

Query: 122 TNASKSE 128
              +KS+
Sbjct: 67  RTTAKSD 73

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 56  TRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVL-EKISPEWYKGSC--NGKVGVFPSN 112
           +R +   +  +A+Y F      +L ++ GD I +L ++ S +WY       GK G+ P+ 
Sbjct: 406 SRPAMTKKRAKAVYDFFANSPDELTVKEGDYINILDDRTSKDWYMCESVETGKRGIVPAQ 465

Query: 113 YTKPAFSGSTNAS 125
           + +   SGS+  S
Sbjct: 466 FVETRGSGSSRPS 478

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNYT 114
           A Y ++  +D +L     DKI  +E +  +W+ G    +G+ G+FPSNY 
Sbjct: 541 AEYDYEAGEDNELTFSENDKIINIEFVDDDWWLGELESSGEKGLFPSNYV 590

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCN--GKVGVFPSNYTK 115
           A Y  + ++  +LA + GDKI  +  +  +W+ G     G+ G+FPSNY +
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQ 623

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNY 113
           A Y ++  ++ +L     DKI  ++ +  +W+ G    NG+ G+FPSNY
Sbjct: 506 AEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNY 554

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 33.1 bits (74), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCN--GKVGVFPSNYTK 115
           A Y  + ++  +LA + GDKI  +  +  +W+ G     G+ G+FPSNY +
Sbjct: 578 AEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSNYVQ 628

>Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON}
           (20451..23111) [2661 nt, 887 aa]
          Length = 886

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKV-GVFPSNYT 114
           V A Y +  Q  GDL    GD ++V +KI+ +W+ G+   N K  G FP N+ 
Sbjct: 10  VRARYGWSGQTKGDLGFLEGDVMEV-KKITGDWFYGTLLRNKKCSGYFPKNFV 61

>YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud
           neck-localized, SH3 domain-containing protein required
           for cytokinesis; regulates actomyosin ring dynamics and
           septin localization; interacts with the formins, Bni1p
           and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p
          Length = 669

 Score = 32.7 bits (73), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 9/69 (13%)

Query: 61  ALEYVEAIYRFDPQQDGDLA-IQPGDKIQVLEKISPEWYKGSC--------NGKVGVFPS 111
            +EY +A+Y     +   LA    GD + + E ++ +WYKG          N ++G+ P 
Sbjct: 600 VIEYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIPY 659

Query: 112 NYTKPAFSG 120
           N+ +    G
Sbjct: 660 NFIQLLHQG 668

>KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 814

 Score = 32.7 bits (73), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNYT 114
           V+  + +  ++  DL    GD I+V  +++ +WY G    N K G FPSNY 
Sbjct: 11  VKTNFAWSGEKKDDLGFLEGDFIEVT-RVTGDWYFGKLIRNKKQGYFPSNYV 61

>Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar to
           Ashbya gossypii AER140C
          Length = 422

 Score = 32.3 bits (72), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 10/77 (12%)

Query: 43  DPSNAPSMLSATTTRDSTALEYVEAIYRFDPQQDGD--LAIQPGDKIQVLEKISPEWYKG 100
           D SN+ S+  A  T       Y   +Y ++PQ +    L+I+ GD IQ++ +    W+ G
Sbjct: 346 DSSNSNSLQKAVPTM------YATVLYDYEPQFNDPQYLSIKKGDTIQIITQSKNGWWYG 399

Query: 101 SC--NGKVGVFPSNYTK 115
                   G+FP +Y +
Sbjct: 400 DLLRTKTKGLFPQSYVQ 416

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 32.3 bits (72), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 7/71 (9%)

Query: 44  PSNAPSMLSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVLE-KISPEWYKGSC 102
           P+  P   S   TR  TA       Y +  Q D +++I  GD I V+       W  G  
Sbjct: 573 PAAPPPRRSTLPTRTMTAK------YPYVAQGDDEMSINAGDTISVIRGDDGSGWTYGEL 626

Query: 103 NGKVGVFPSNY 113
           NG  G+FP++Y
Sbjct: 627 NGVKGLFPTSY 637

>AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER114C
           (BOI2) and YBL085W (BOI1)
          Length = 984

 Score = 32.3 bits (72), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 13/70 (18%)

Query: 58  DSTALE-------YVEAIYRFDPQQDGDLAIQPGDKIQVL---EKISPEWYKGSC--NGK 105
           DSTA E       Y+ AI  +  + + +L ++PGDKI+V+   ++ +  WY G     G+
Sbjct: 19  DSTAAEERPRYGTYI-AINEYSKRMEDELDMKPGDKIEVITDDQEYNDGWYFGRNLRTGE 77

Query: 106 VGVFPSNYTK 115
            G++P  +T+
Sbjct: 78  EGLYPKLFTQ 87

>CAGL0A04147g Chr1 complement(411674..412849) [1176 bp, 391 aa] {ON}
           similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191w PAS20
          Length = 391

 Score = 32.3 bits (72), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 7/65 (10%)

Query: 56  TRDSTALEYVEAIYRFDPQQ-DGDLAIQPGDKIQVLEKISP-----EWYK-GSCNGKVGV 108
           T D + LE+  A+Y F P+    ++ ++ GD + ++ K  P     +W+K  +  G+ G 
Sbjct: 310 TIDPSKLEFARALYDFTPENPQIEITLKKGDLVAIISKADPLGRSSDWWKVRNRAGQNGY 369

Query: 109 FPSNY 113
            P NY
Sbjct: 370 APYNY 374

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 32.3 bits (72), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 61  ALEYVEAIYRFDPQQ--DGDLAIQPGDKIQVLEKISPEWYKGS--CNGKVGVFPSNYTK 115
            + + +A+Y +D  Q  D +L    GD+  V +   P+W   S   +G++G  P NY +
Sbjct: 70  VISHAKALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKTSGEIGFVPGNYVE 128

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 66  EAIYRFDPQQDG--DLAIQPGDKIQVLEKISPEWYKGS-CNGKVGVFPSNYTK 115
           EA+Y +   Q    +++ + G+ ++V + I   W+K    NG+ G+ PSNY K
Sbjct: 299 EALYTYQADQTDAYEISFEQGEILRVGD-IEGRWWKAKKSNGETGIIPSNYVK 350

>TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.365
           YLR191W
          Length = 389

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 7/65 (10%)

Query: 58  DSTALEYVEAIYRFDPQQ-DGDLAIQPGDKIQVLEK-----ISPEWYK-GSCNGKVGVFP 110
           D + LE+  A+Y F P+    ++ ++ GD + ++ K        EW+K  + +G +G  P
Sbjct: 304 DPSKLEFARALYDFTPENPQMEVTLKKGDLMAIMSKQDSLGRDSEWWKVRTKSGDIGYVP 363

Query: 111 SNYTK 115
            NY +
Sbjct: 364 FNYIE 368

>ZYRO0F01166g Chr6 complement(90553..92799) [2247 bp, 748 aa] {ON}
           similar to uniprot|Q05080 Saccharomyces cerevisiae
           YMR032W HOF1 Bud neck-localized SH3 domain-containing
           protein required for cytokinesis
          Length = 748

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 9/65 (13%)

Query: 61  ALEYVEAIYRFDPQQDGDLA-IQPGDKIQVLEKISPEWYKG--------SCNGKVGVFPS 111
            ++Y +A+Y    +   +LA  Q GD + +  +++ EWY+G        S     G+ P 
Sbjct: 682 VIKYAKAVYPLYEENVPELAQFQRGDYLLITGEVNDEWYRGEVYSNDYVSQGSSSGLIPH 741

Query: 112 NYTKP 116
           N+ KP
Sbjct: 742 NFIKP 746

>NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7.413
           YBL085W
          Length = 1047

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVL---EKISPEWYKGSC--NGKVGVFPSNYTK 115
            I  +  + + +L ++PGDKI+VL   E+ +  WY G     G+ G++P  +T+
Sbjct: 46  CINEYSKRMEDELDMRPGDKIEVLTDDEEYNDGWYFGRNLRTGEEGLYPVVFTQ 99

>KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1537

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 5/59 (8%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKV---GVFPSNYTK 115
           L+ V A Y F+P +   L    GD I V+ K    W+ G    N  +   G FP +YTK
Sbjct: 23  LDIVIAQYDFNPLRKSQLRFFAGDIIYVISKSDSGWWDGILYYNKSLVLRGWFPRSYTK 81

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 4/72 (5%)

Query: 50  MLSATTTRDSTALEYVEAIYRFDPQQDGD--LAIQPGDKIQVLEKISPEWY--KGSCNGK 105
           ++ +T   ++  L+ V AIY +   Q+ D  L     D   V +    +W   K + + +
Sbjct: 59  LVPSTYIEEAPVLKKVRAIYDYGQVQNADEELTFHENDTFDVFDDNDADWLLVKSTVSNE 118

Query: 106 VGVFPSNYTKPA 117
            G  P NY +PA
Sbjct: 119 FGFIPGNYVEPA 130

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 69  YRFDPQQDGDLAIQPGDKIQVL-EKISPEWYKGSC--NGKVGVFPSNYTKPA 117
           Y F  +   +L I+ GDK+ +L +K S +W+      +GK G+ P+ + +P 
Sbjct: 359 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLIDSGKSGLVPAQFIEPV 410

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKIS-PEWY--KGSCNGK-----VGVFPSNY 113
           L    AIY ++PQ   +LAIQ  D + +L+K    +W+  K    G      VG+ PS Y
Sbjct: 5   LGIYRAIYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTY 64

Query: 114 TKPA 117
            + A
Sbjct: 65  IEEA 68

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKIS-PEWYK-------GSCNGKVGVFPSNY 113
           L   +AIY ++PQ D +L I+  D + VLEK    +W+              VG+ P+NY
Sbjct: 5   LGVYKAIYSYEPQTDEELRIEEDDLLYVLEKSEVDDWWTVKKREIGTDTEELVGLVPNNY 64

Query: 114 TKPA 117
            + A
Sbjct: 65  IEEA 68

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 58  DSTALEYVEAIYRFDPQQ--DGDLAIQPGDKIQVLEKISPEWY--KGSCNGKVGVFPSNY 113
           ++  L  V AIY +   Q  D +L+ Q GD   + +    +W+  +   + KVG  P NY
Sbjct: 67  EADVLYQVHAIYDYKQVQNPDEELSFQEGDVFDIFDDRDADWFLVRAVKDKKVGFIPGNY 126

Query: 114 TKPAFSGST--NASKSELT 130
            +    G    N S  ++T
Sbjct: 127 VETIEEGGRGGNVSNVDMT 145

>NCAS0A14530 Chr1 complement(2863100..2866171) [3072 bp, 1023 aa]
           {ON} Anc_7.413 YBL085W
          Length = 1023

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 50/98 (51%), Gaps = 13/98 (13%)

Query: 28  DSVFKEINSSLPERYDPSNAPSMLSATTT-----RDSTALEYVEAIYRFDPQQDGDLAIQ 82
           DS  +++NS+ P R    NA S+ S++ +      D+ +      I  +  + + +L ++
Sbjct: 6   DSTLEQLNSTSPSRI--RNA-SIESSSYSGNFHPEDAKSYPMYICINEYTKRMEDELDMR 62

Query: 83  PGDKIQVL---EKISPEWYKGSC--NGKVGVFPSNYTK 115
           PGDKIQVL   E+    WY G      + G++P  +T+
Sbjct: 63  PGDKIQVLIDDEEYDDGWYFGRNLRTQEEGLYPVTFTQ 100

>Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388W
           (RVS167) - (putative) cytoskeletal protein [contig 219]
           FULL
          Length = 460

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 5/57 (8%)

Query: 64  YVEAIYRFDP---QQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNYTK 115
           Y  A++ ++P    Q  DL  +  + I+V++K    W+ G      K G FP+NY +
Sbjct: 399 YATALFDYEPAEPDQSTDLNFRRNEVIKVIKKNEDGWWYGEAMRTRKRGYFPANYVE 455

>Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON}
           (60698..63340) [2643 nt, 881 aa]
          Length = 880

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVL---EKISPEWYKGSC--NGKVGVFPSNYTK 115
           AI  +  + + +L  +PGDKIQV+   E+ +  WY G      + G++P+ +T+
Sbjct: 38  AINEYSRRMEDELDFKPGDKIQVITDDEEYNDGWYYGKNLRTQQEGLYPAVFTQ 91

>ZYRO0B02706g Chr2 complement(218864..220054) [1191 bp, 396 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 396

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 7/65 (10%)

Query: 58  DSTALEYVEAIYRFDPQQDG-DLAIQPGDKIQVLEKISP-----EWYK-GSCNGKVGVFP 110
           D + LE+  A+Y F P+    +  ++ G+ + ++ K  P     EW+K  +  G +G  P
Sbjct: 309 DPSKLEFARALYDFTPENPQIEAPLKKGELMAIITKQHPSGNNSEWWKVRTKTGNMGYVP 368

Query: 111 SNYTK 115
            NY +
Sbjct: 369 FNYVE 373

>SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some
           similarities with uniprot|Q12163 Saccharomyces
           cerevisiae YDR162C NBP2 Protein involved in the HOG
           (high osmolarity glycerol) pathway negatively regulates
           Hog1p by recruitment of phosphatase Ptc1p the
           Pbs2p-Hog1p complex found in the nucleus and cytoplasm
           contains an SH3 domain that binds Pbs2p
          Length = 207

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPEWY--KGSCNGKVGVFPSNY 113
           AIY F P+ D +LA++ GD + +  K    W   +     K G+ P  Y
Sbjct: 95  AIYDFIPENDNELALKEGDVVYISYKHGQGWLVAENEERTKTGLVPEEY 143

>NCAS0C05710 Chr3 complement(1170253..1175283) [5031 bp, 1676 aa]
           {ON} Anc_4.45
          Length = 1676

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 10/65 (15%)

Query: 62  LEYVEAIYRFD---PQQDGDLAIQPGDKIQVLEKISPEWYKG-------SCNGKVGVFPS 111
           ++ V A++ F+    + +  L+ Q GD I VL K +  W+ G       + N   G FP 
Sbjct: 84  IDIVVALFDFNYPLKKSNQHLSFQQGDTIYVLNKNNSGWWDGLTINDNNNTNINRGWFPQ 143

Query: 112 NYTKP 116
            YT+P
Sbjct: 144 TYTRP 148

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.319
           YDL117W
          Length = 850

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKV-GVFPSNYT 114
           V+A Y +  Q  GDL    GD ++V  +I+ +W+ G    N K  G FP+N+ 
Sbjct: 13  VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGKLLRNKKCSGYFPNNFV 64

>KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {ON}
           Anc_2.159 YHR114W
          Length = 602

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLE-KISPEWYKGSCNGKVGVFPSNYTK 115
           +E ++ +  Q D +++I  GD + V++      W  G  NG  G+ P++Y K
Sbjct: 551 LEVVFDYVAQGDDEISINVGDVVTVIKGDDGSGWTYGELNGLKGLVPTSYCK 602

>TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1136

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 12/66 (18%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKIS-PEWYKGSCNGKV---------GVFPS 111
           L   +AIY ++PQ   +LAIQ  D + +LEK    +W+  +   +V         G+ PS
Sbjct: 5   LGIYKAIYNYEPQTPEELAIQEDDLLYLLEKSDVDDWW--TVKKRVIGSDAEEPSGLIPS 62

Query: 112 NYTKPA 117
           NY + A
Sbjct: 63  NYIEEA 68

>Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 65  VEAIYRFDPQQDGDLAIQ---PGDKIQVLEKISPEWYKGS-CNGKVGVFPSNYTK 115
            +A+Y +D   DGD A +     ++I  +  I   W+K    NG+ G+ PSNY +
Sbjct: 306 AKALYPYDA--DGDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032W
           (REAL)
          Length = 669

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 9/69 (13%)

Query: 61  ALEYVEAIYRFDPQQDGDLA-IQPGDKIQVLEKISPEWYKGSC--------NGKVGVFPS 111
            +EY +A+Y     +   LA    GD + + E ++ +WYKG          + +VG+ P 
Sbjct: 600 VIEYAKAMYPLVGNEAPGLANFHKGDYMLITEIVNKDWYKGEVYDNDRIDRDHRVGLIPY 659

Query: 112 NYTKPAFSG 120
           N+ +    G
Sbjct: 660 NFIQLLHQG 668

>Ecym_7141 Chr7 (283803..286892) [3090 bp, 1029 aa] {ON} similar to
           Ashbya gossypii AGL293C
          Length = 1029

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 34/64 (53%), Gaps = 5/64 (7%)

Query: 57  RDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVL---EKISPEWYKGSC--NGKVGVFPS 111
           R  T  +   AI  +  + + +L ++PGDKI+ +   ++ +  WY G     G+ G++P 
Sbjct: 46  RGKTRFDMYIAINEYSKRMEDELDMKPGDKIEAITDDQEYNDGWYYGRNLRTGEEGLYPK 105

Query: 112 NYTK 115
            +T+
Sbjct: 106 LFTQ 109

>ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} similar
           to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
           SH3-domain protein located in the mother-bud neck and
           the cytokinetic actin ring mutant phenotype and genetic
           interactions suggest a role in cytokinesis
          Length = 886

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKV-GVFPSNYT 114
           V+A Y +  Q  GDL    GD ++V  +I+ +W+ G    N K  G FP+N+ 
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGRLLRNKKCSGYFPNNFV 65

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNYT 114
           A Y ++  +D +L  +  ++I  ++ +  +W+ G    +G+ G+FPSNY 
Sbjct: 523 AEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGLFPSNYV 572

>ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118C SHO1 Transmembrane osmosensor participates in
           activation of both the Cdc42p- and MAP kinase-dependent
           filamentous growth pathway and the high-osmolarity
           glycerol response pathway
          Length = 371

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 66  EAIYRFDPQQDG--DLAIQPGDKIQVLEKISPEWYKGS-CNGKVGVFPSNYTK 115
           + +YR+   +D   +++ + G+ ++V   I   W+K     G+ G+ PSNY K
Sbjct: 312 QTLYRYQADEDDAYEISFEQGEILKV-SDIEGRWWKAKRSTGETGIIPSNYVK 363

>Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON}
           (104879..108487) [3609 nt, 1203 aa]
          Length = 1202

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 66  EAIYRFDPQQDGDLAIQPGDKIQVLEKIS-PEWYK------GS-CNGKVGVFPSNYTKPA 117
           +AIY ++PQ   +L IQ  D + +LEK +  +W+       GS  +   G+ PSNY + A
Sbjct: 9   KAIYNYEPQTPDELTIQEDDLLYLLEKSNVDDWWTVKKRVIGSDIDEPAGLVPSNYVEVA 68

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 8/91 (8%)

Query: 32  KEINSSLPERYDPSNAPSM---LSATTTRDSTALEY-VEAIYRF--DPQQDGDLAIQPGD 85
           + +N+ + E  + + A SM   L   +  D     Y V+A+Y +  D     +++   G+
Sbjct: 274 QNVNTYMTETSNGNTATSMGDTLGLYSELDDDNFTYTVKALYSYQADDADAYEISFDQGE 333

Query: 86  KIQVLEKISPEWYKGSC-NGKVGVFPSNYTK 115
            ++V   I   W+K    NG+ G+ PSNY +
Sbjct: 334 ILKV-SDIEGRWWKAKRENGQTGIIPSNYVE 363

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 69  YRFDPQQDGDLAIQPGDKIQVL-EKISPEWYKGSC--NGKVGVFPSNYTKPA 117
           Y F  +   +L I+ GDK+ +L +K S +W+      +GK G+ P+ + +P 
Sbjct: 354 YDFLAESQDELTIKSGDKVYILDDKKSSDWWMCQLIDSGKSGLVPAQFVEPV 405

>Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032W
           (REAL)
          Length = 668

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 9/69 (13%)

Query: 61  ALEYVEAIYRFDPQQDGDLA-IQPGDKIQVLEKISPEWYKGSC--------NGKVGVFPS 111
            +EY +A+Y     +   LA    GD I + E ++ +W+KG          + +VG+ P 
Sbjct: 599 VIEYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWFKGEVYNNDRIERDHRVGLIPY 658

Query: 112 NYTKPAFSG 120
           N+ +    G
Sbjct: 659 NFIQLLHQG 667

>SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P39969 Saccharomyces cerevisiae
           YER114C BOI2 Protein implicated in polar growth
           functionally redundant with Boi1p interacts with bud-
           emergence protein Bem1p contains an SH3 (src homology 3)
           domain and a PH (pleckstrin homology) domain
          Length = 1027

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVL---EKISPEWYKGSC--NGKVGVFPSNYTK 115
           AI  +  + + +L ++PGDKIQV+   ++ +  WY G      + G++P  +T+
Sbjct: 43  AINEYTKRMEDELDMKPGDKIQVITDDQEYNDGWYYGRNLRTNEEGLYPKVFTQ 96

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 69  YRFDPQQDGDLAIQPGDKIQVL-EKISPEWYKGSC--NGKVGVFPSNYTKPA 117
           Y F  +   +L I+ GDK+ +L +K S +W+      +GK G+ P+ + +P 
Sbjct: 362 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEPV 413

>KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} similar
           to uniprot|P39969 Saccharomyces cerevisiae YER114C BOI2
           Protein implicated in polar growth functionally
           redundant with Boi1p interacts with bud- emergence
           protein Bem1p contains an SH3 (src homology 3) domain
           and a PH (pleckstrin homology) domain
          Length = 1025

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 68  IYRFDPQQDGDLAIQPGDKIQVL---EKISPEWYKGSC--NGKVGVFPSNYTK 115
           I  +  + + +L ++PGDKIQV+   E+ +  WY G      + G++P  +T+
Sbjct: 39  ITEYSKRMEDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLYPKVFTQ 91

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKIS-PEWYK------GS-CNGKVGVFPSNY 113
           L   +A+Y ++PQ   +LAI+  + + +LEK    EW+       GS  +  VG+ PSNY
Sbjct: 5   LGVYKALYDYEPQTTEELAIREDELLYLLEKSDVDEWWTVKKRVIGSDADEPVGLVPSNY 64

Query: 114 TKPA 117
            + A
Sbjct: 65  VEQA 68

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 69  YRFDPQQDGDLAIQPGDKIQVLE-KISPEWYKGSC--NGKVGVFPSNYTKPA 117
           Y F  +   +L ++ GDK+ +L+ K S +W+      +GK G+ P+ + +P 
Sbjct: 355 YNFMAESQDELTVKSGDKVYILDAKKSKDWWMCQLVDSGKSGLVPAQFIEPV 406

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 5/62 (8%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVL-EKISPEWYKGSC--NGKVGVFPSNYTKPAFSGSTN 123
           A+Y F+ +   +L I+ GD + V+ +K S +W+      NGK G+ P+ + +  FS S  
Sbjct: 377 ALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLVPAQFIE--FSKSKE 434

Query: 124 AS 125
           +S
Sbjct: 435 SS 436

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKIS-PEWYK------GS-CNGKVGVFPSNY 113
           L   +A+Y ++PQ   +LAIQ  D + +LEK    +W+       GS      G+ PSNY
Sbjct: 5   LGVYKAVYSYEPQTPEELAIQEDDLLYLLEKSEVDDWWTVKKRIIGSDAEEPQGLVPSNY 64

Query: 114 TKPA 117
            + A
Sbjct: 65  IEAA 68

>Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 32/54 (59%), Gaps = 5/54 (9%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLE---KISPEWYKGSC--NGKVGVFPSNYTK 115
           A+  +  + + +L+++PGDKI+V+    + +  WY G      + G++P+ +TK
Sbjct: 20  AVNEYSKRMEDELSMKPGDKIEVITDDGEYNDGWYYGRNLRTKEEGLYPAVFTK 73

>Kwal_14.2313 s14 (702302..706855) [4554 bp, 1517 aa] {ON} YLR310C
           (CDC25) - 1:1 [contig 225] FULL
          Length = 1517

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 10/67 (14%)

Query: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWY----------KGSCNGKVGVFP 110
           AL+ V A   F   +   L +  GD + VL K    W+          +G+     G FP
Sbjct: 22  ALDVVIASCDFVATKKSQLRLNVGDVVYVLGKNESGWWDGVVVSPGGVRGAHRCVRGWFP 81

Query: 111 SNYTKPA 117
            N+T+PA
Sbjct: 82  QNHTRPA 88

>Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER114C
           (BOI2) - involved in bud formation, has SH3 domain
           [contig 33] FULL
          Length = 1014

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 5/53 (9%)

Query: 68  IYRFDPQQDGDLAIQPGDKIQVL---EKISPEWYKGSC--NGKVGVFPSNYTK 115
           I  +  + + +L ++PGDKIQV+   E+ +  WY G      + G++P  +T+
Sbjct: 42  ITEYSKRMEDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLYPKVFTQ 94

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKIS-PEWY--KGSCNGK-----VGVFPSNY 113
           L   +AIY ++PQ   +L I   D + +LEK    EW+  K    G      VG+ PSNY
Sbjct: 5   LGVYKAIYDYEPQTPEELEIHEDDLLYLLEKSEVDEWWTVKKRVIGSDVVEPVGLVPSNY 64

Query: 114 TKPA 117
            + A
Sbjct: 65  IEEA 68

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 69  YRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC-NGKVGVFPSNYTK 115
           Y+ D     +++ + G+ ++V   I   W+K    NG+VG+ PSNY +
Sbjct: 305 YQADDADGYEISFEQGEILKV-SDIEGRWWKSKRENGQVGIIPSNYVQ 351

>AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER118C
           (SHO1)
          Length = 330

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 69  YRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGS-CNGKVGVFPSNYTK 115
           Y  D     +++ Q G+ ++V + I   W+K    NG+ G+ PSNY +
Sbjct: 276 YEADASDAYEISFQQGEILRVGD-IEGRWWKAKKANGETGIIPSNYVE 322

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 62  LEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKIS-PEWYK-------GSCNGKVGVFPSNY 113
           L   +A+Y ++PQ   +LAI+  D + +LEK    +W+           +   G+ PSNY
Sbjct: 5   LGIYKAVYAYEPQTPEELAIEEDDLLYLLEKSDVDDWWTVKKRVLGTDADEPTGLVPSNY 64

Query: 114 TKPA 117
            + A
Sbjct: 65  VEEA 68

>KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} similar
           to uniprot|P40073 Saccharomyces cerevisiae YER118C SHO1
           Transmembrane osmosensor participates in activation of
           both the Cdc42p- and MAP kinase-dependent filamentous
           growth pathway and the high- osmolarity glycerol
           response pathway
          Length = 342

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 5/60 (8%)

Query: 60  TALEYV-EAIYRF--DPQQDGDLAIQPGDKIQVLEKISPEWYKGS-CNGKVGVFPSNYTK 115
           T+  YV +A+Y +  D     +++ + G+ ++V + I   W+K    NG+ G+ PSNY +
Sbjct: 277 TSFPYVAKALYTYTADSNDAYEVSFEQGEMLRVGD-IEGRWWKAKRANGETGIIPSNYVE 335

>KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.419
           YER118C
          Length = 342

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 66  EAIYRFDPQQDG--DLAIQPGDKIQVLEKISPEWYKGS-CNGKVGVFPSNYTK 115
           +A+Y +D   +   +++ + G+ ++V   I   W+K    NG+ G+ PSNY +
Sbjct: 287 KALYSYDADSNDQYEVSFEQGEILKV-SDIEGRWWKARRANGETGIIPSNYVE 338

>NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON}
           Anc_2.159 YHR114W
          Length = 632

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLE-KISPEWYKGSCNGKVGVFPSNYTK 115
           A Y +    D +++I  GD I V+       W  G  NG  G+ P++Y K
Sbjct: 583 AAYSYSAAGDDEISINVGDVITVIRGDDGSGWTYGELNGSKGLVPTSYCK 632

>KNAG0M00360 Chr13 (54596..55840) [1245 bp, 414 aa] {ON} Anc_4.350
           YML080W
          Length = 414

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 30/66 (45%), Gaps = 10/66 (15%)

Query: 24  KVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDSTALEY-------VEAIYRFDPQQ- 75
           K +    FK +   LP   D  ++ + LSA TT D    E        VEAIYR DP+  
Sbjct: 297 KAMKSHFFKILRPFLPHHTDIRSSIASLSAHTTLDEWEREVVVPVERAVEAIYRTDPEDA 356

Query: 76  --DGDL 79
             DG L
Sbjct: 357 IVDGPL 362

>ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 288

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLEKISPEWY--KGSCNGKVGVFPSNYTKPAFSGSTNA 124
           A+Y F+P+ D +L +Q GD + +  +    W   +     K G+ P  +   A     N 
Sbjct: 133 ALYDFEPENDNELELQEGDVVFISYRHGQGWLVAENQNRTKTGLVPEEFVTYANEDDENW 192

Query: 125 SKSE 128
           ++ E
Sbjct: 193 AEYE 196

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKVGVFPSNYTKPAFSGST 122
           ++A+Y +  Q  G+L+   G+ + V+ +   EW++ S   +G+ G+ P +Y +P      
Sbjct: 69  LKALYTYHAQSPGELSFTKGELVHVIGE-DGEWFEVSSPDSGRKGMVPKSYFEPVSRSRV 127

Query: 123 NASKSELT 130
            +++S L 
Sbjct: 128 VSTQSILV 135

>YBL085W Chr2 (63876..66818) [2943 bp, 980 aa] {ON}  BOI1Protein
           implicated in polar growth, functionally redundant with
           Boi2p; interacts with bud-emergence protein Bem1p;
           contains an SH3 (src homology 3) domain and a PH
           (pleckstrin homology) domain
          Length = 980

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 32/54 (59%), Gaps = 5/54 (9%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLE---KISPEWYKGSC--NGKVGVFPSNYTK 115
           A+ ++  + + +L ++PGDKI+V+    + +  WY G      + G++P+ +TK
Sbjct: 20  AVNQYSKRMEDELNMKPGDKIKVITDDGEYNDGWYYGRNLRTKEEGLYPAVFTK 73

>KAFR0K01960 Chr11 complement(403631..406459) [2829 bp, 942 aa] {ON}
           Anc_7.413 YER114C
          Length = 942

 Score = 30.0 bits (66), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 49  SMLSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVL---EKISPEWYKGSC--N 103
           S LS+T++           I  +  + + +L ++PGDKIQVL   E+ +  WY G     
Sbjct: 26  SQLSSTSSDAPKIFPMYICINEYFKRMEDELDMRPGDKIQVLTDDEEYNDGWYFGRNLRT 85

Query: 104 GKVGVFPSNYTK 115
            + G++P  +T+
Sbjct: 86  KEEGLYPVVFTQ 97

>Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AGL286C
          Length = 332

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 69  YRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGS-CNGKVGVFPSNYTK 115
           Y  D     +++ Q G+ ++V + I   W+K    NG+ G+ PSNY +
Sbjct: 278 YEADESDAYEISFQQGEILRVGD-IEGRWWKAKRSNGETGIIPSNYVE 324

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 69  YRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC-NGKVGVFPSNYTK 115
           Y+ D     +++ + G+ ++V   I   W+K    NG+ G+ PSNY +
Sbjct: 278 YQADESDQYEISFEQGEILRV-SDIEGRWWKAKRENGETGIIPSNYVQ 324

>Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 58  DSTALEYVEAIYRFDPQQDG--DLAIQPGDKIQVLEKISPEWYKGS-CNGKVGVFPSNYT 114
           D   +   +A+Y +D   +   +++ +  + +QV   I   W+K    NG+ G+ PSNY 
Sbjct: 299 DDNFIYKAKALYPYDADDEDAYEISFEQNEILQV-SDIEGRWWKARRANGETGIIPSNYV 357

Query: 115 K 115
           +
Sbjct: 358 Q 358

>KNAG0B06790 Chr2 complement(1341181..1341870) [690 bp, 229 aa] {ON}
           Anc_4.366 YJR135C
          Length = 229

 Score = 29.3 bits (64), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 27/51 (52%)

Query: 39  PERYDPSNAPSMLSATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQV 89
           PER DP     +  + TTR +T+LE++ ++   + + +  LA Q     Q+
Sbjct: 61  PERSDPIGVSLLAVSQTTRRTTSLEWLRSMREHNSRLERTLAAQTATNEQL 111

>Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)
          Length = 985

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLE---KISPEWYKGSC--NGKVGVFPSNYTK 115
           A+  +  + + +L ++PGDKI+V+    + +  WY G      + G++P+ +TK
Sbjct: 20  AVNEYSKRMEDELNMRPGDKIEVITDDGEYNDGWYYGRNLRTKEEGLYPAVFTK 73

>ZYRO0B03850g Chr2 complement(320570..323839) [3270 bp, 1089 aa]
           {ON} some similarities with uniprot|P39969 Saccharomyces
           cerevisiae YER114C BOI2 Protein implicated in polar
           growth functionally redundant with Boi1p interacts with
           bud- emergence protein Bem1p contains an SH3 (src
           homology 3) domain and a PH (pleckstrin homology) domain
          Length = 1089

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 5/53 (9%)

Query: 68  IYRFDPQQDGDLAIQPGDKIQVL---EKISPEWYKGSC--NGKVGVFPSNYTK 115
           I  +  +   +L ++PGDKIQV+   E+ +  WY G      + G+FP  +T+
Sbjct: 43  INEYTKRMQDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLFPVIFTQ 95

>CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} similar
           to uniprot|P32380 Saccharomyces cerevisiae YDR356w NUF1
          Length = 872

 Score = 29.6 bits (65), Expect = 7.7,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 4   SLINRSLTTIRTELEFLK----ESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDS 59
           SLI R    ++ E + +K    +  +   S  +E+NS L +R DPS + S  + TT  D 
Sbjct: 680 SLIERKYEKLKDEFKLMKKGYLDEMIKLQSRNRELNSDLQKRMDPSISTS--ANTTLADK 737

Query: 60  TALEYVEAIYRFDPQQDGDLAI 81
             L+Y +  Y  + + + DL +
Sbjct: 738 --LDYYKLKYNDEVRHNNDLRV 757

>Suva_5.235 Chr5 complement(366285..369416) [3132 bp, 1043 aa] {ON}
           YER114C (REAL)
          Length = 1043

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVL---EKISPEWYKGSC--NGKVGVFPSNYTK 115
           AI  +  + + +L ++PGDKI+V+   EK    WY G      + G++P  +T+
Sbjct: 50  AINEYFKRMEDELDMKPGDKIKVITDDEKYKDGWYFGRNLRTNEEGLYPVVFTQ 103

>TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.319
           YDL117W
          Length = 824

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 33/72 (45%), Gaps = 11/72 (15%)

Query: 65  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSC--NGKV-GVFPSNY-------T 114
           V+A Y +  Q  GDL    GD + V  K + +WY G    N K  G FP N+       T
Sbjct: 7   VKARYGWSGQAKGDLGFLEGDIMNV-TKTTGDWYYGFLLRNKKSKGYFPKNFVIELNGKT 65

Query: 115 KPAFSGSTNASK 126
           KP+    T  +K
Sbjct: 66  KPSVEAITADAK 77

>KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4.108
           YBL007C
          Length = 1203

 Score = 29.3 bits (64), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 12/62 (19%)

Query: 66  EAIYRFDPQQDGDLAIQPGDKIQVLEKIS-PEWYKGSCNGKV---------GVFPSNYTK 115
           +AIY ++PQ   +LA+Q  D + +LEK    +W+  +   +V         G+ PSNY +
Sbjct: 9   KAIYSYEPQTPEELALQEDDFLYLLEKSEVDDWW--TVKKRVIGSDAEEPSGLVPSNYIE 66

Query: 116 PA 117
            A
Sbjct: 67  TA 68

>Skud_2.23 Chr2 (47507..50455) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 29.3 bits (64), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 67  AIYRFDPQQDGDLAIQPGDKIQVLE---KISPEWYKGSC--NGKVGVFPSNYTK 115
           A+  +  + + +L ++PGDKI+V+    + +  WY G      + G++P+ +TK
Sbjct: 20  AVNEYSKRMEDELNMKPGDKIKVITDDGEYNDGWYYGRNLRTEEEGLYPAVFTK 73

>Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118C
           (SHO1) - Transmembrane osmosensor [contig 33] FULL
          Length = 343

 Score = 28.9 bits (63), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 69  YRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGS-CNGKVGVFPSNYTK 115
           Y  D     +++ + G+ ++V + I   W+K    NG+ G+ PSNY +
Sbjct: 290 YTADSNDAYEVSFEQGETLRVGD-IEGRWWKAKRANGETGIIPSNYVE 336

>TDEL0B06840 Chr2 (1211695..1213485) [1791 bp, 596 aa] {ON}
           Anc_2.591 YMR032W
          Length = 596

 Score = 29.3 bits (64), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 15/67 (22%)

Query: 61  ALEYVEAIYRFDPQQDGDLA----IQPGDKIQVLEKISPEWYKGSCNG--------KVGV 108
            + Y +A+Y   P  D D A     Q GD + +   ++ EW++G   G        + G+
Sbjct: 530 VIRYAKAVY---PLLDNDAAELAHFQKGDYLLITLMVNEEWFRGEVYGNDMIESTHRNGL 586

Query: 109 FPSNYTK 115
            P N+ +
Sbjct: 587 IPYNFIQ 593

>YER114C Chr5 complement(390590..393712) [3123 bp, 1040 aa] {ON}
           BOI2Protein implicated in polar growth, functionally
           redundant with Boi1p; interacts with bud-emergence
           protein Bem1p; contains an SH3 (src homology 3) domain
           and a PH (pleckstrin homology) domain
          Length = 1040

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 53  ATTTRDSTALEYVEAIYRFDPQQDGDLAIQPGDKIQVL---EKISPEWYKGSC--NGKVG 107
           + T RD        AI  +  + + +L ++PGDKI+V+   E+    WY G      + G
Sbjct: 36  SATGRDGGNFPMYIAINEYFKRMEDELDMKPGDKIKVITDDEEYKDGWYFGRNLRTNEEG 95

Query: 108 VFPSNYTK 115
           ++P  +T+
Sbjct: 96  LYPVVFTQ 103

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,694,194
Number of extensions: 713351
Number of successful extensions: 2179
Number of sequences better than 10.0: 270
Number of HSP's gapped: 2042
Number of HSP's successfully gapped: 302
Length of query: 220
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 115
Effective length of database: 41,441,469
Effective search space: 4765768935
Effective search space used: 4765768935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)