Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0A057103.500ON1411416303e-85
Kpol_480.93.500ON1411414185e-53
YPR153W3.500ON1401384152e-52
NCAS0F035903.500ON1401384082e-51
CAGL0L08382g3.500ON1401384054e-51
Smik_16.4053.500ON1391384046e-51
Suva_16.4813.500ON1391384038e-51
Skud_16.4473.500ON1401383994e-50
TBLA0C045203.500ON1401333917e-49
TDEL0D056803.500ON1401383891e-48
SAKL0F02508g3.500ON1401383594e-44
KNAG0A079803.500ON1471373492e-42
KLTH0G02354g3.500ON1401353422e-41
KLLA0E03895g3.500ON1401383326e-40
ZYRO0D09724g3.500ON1391263292e-39
KAFR0G037303.500ON1441353266e-39
AFR319W3.500ON1411232362e-25
Kwal_47.189033.500ON11326710.17
YHR120W (MSH1)2.147ON95959626.1
Smik_7.1212.316ON113268628.0
CAGL0K05093g7.430ON74550619.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0A05710
         (141 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3....   247   3e-85
Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 1...   165   5e-53
YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {...   164   2e-52
NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.50...   161   2e-51
CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {...   160   4e-51
Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W...   160   6e-51
Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W...   159   8e-51
Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 a...   158   4e-50
TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3....   155   7e-49
TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 14...   154   1e-48
SAKL0F02508g Chr6 complement(217712..217835,217912..218205,21827...   142   4e-44
KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 14...   139   2e-42
KLTH0G02354g Chr7 complement(185220..185343,185400..185693,18576...   136   2e-41
KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423...   132   6e-40
ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {O...   131   2e-39
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...   130   6e-39
AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa...    96   2e-25
Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR15...    32   0.17 
YHR120W Chr8 (349574..352453) [2880 bp, 959 aa] {ON}  MSH1DNA-bi...    28   6.1  
Smik_7.121 Chr7 (211577..214975) [3399 bp, 1132 aa] {ON} YGL151W...    28   8.0  
CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highl...    28   9.4  

>TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3.500
           YPR153W
          Length = 141

 Score =  247 bits (630), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 125/141 (88%), Positives = 125/141 (88%)

Query: 1   MVGNFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYG 60
           MVGNFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYG
Sbjct: 1   MVGNFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYG 60

Query: 61  VAGALACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLC 120
           VAGALACFTHRKKGGGFWILAIY                YIISATYLSALFSMSTWIPLC
Sbjct: 61  VAGALACFTHRKKGGGFWILAIYLVLGGVQGIVLGTIIGYIISATYLSALFSMSTWIPLC 120

Query: 121 CAVAQVLFEVTTSYSLVGNLM 141
           CAVAQVLFEVTTSYSLVGNLM
Sbjct: 121 CAVAQVLFEVTTSYSLVGNLM 141

>Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 141
           aa] {ON} complement(19229..19649,19756..19760) [426 nt,
           142 aa]
          Length = 141

 Score =  165 bits (418), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 77/141 (54%), Positives = 101/141 (71%)

Query: 1   MVGNFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYG 60
           M  +FLTS D+PVGY  P FPSLYWPI++ KY+ +YLYD+ TIW FTVYWS+ILNG FY 
Sbjct: 1   MRSSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYL 60

Query: 61  VAGALACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLC 120
           ++G +A +THRK+ GG WI+ IY                Y++S  Y+S LF+MSTWIPLC
Sbjct: 61  ISGLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLC 120

Query: 121 CAVAQVLFEVTTSYSLVGNLM 141
           CA+ QVLF++ +S+SL G +M
Sbjct: 121 CAITQVLFDLCSSFSLGGMVM 141

>YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {ON}
           Putative protein of unknown function
          Length = 140

 Score =  164 bits (415), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 96/138 (69%)

Query: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63
           +F+T+ND+PVGYVTP FPSLYWPINNSKYNTA+LY    IW F++YW+LI NG FY  AG
Sbjct: 3   SFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVTAG 62

Query: 64  ALACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAV 123
             A  THRKK G  WI  +Y                ++I A Y S LFSMSTW+PLCCAV
Sbjct: 63  VYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCCAV 122

Query: 124 AQVLFEVTTSYSLVGNLM 141
            Q+LF+V  SYS+VG++M
Sbjct: 123 VQILFDVVLSYSMVGSVM 140

>NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  161 bits (408), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 73/138 (52%), Positives = 96/138 (69%)

Query: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63
           +F+T+ND+P+GY+TP FPSLYWPINN KY+  +LY+   IW FT+YW+LI N  FYG AG
Sbjct: 3   SFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGAAG 62

Query: 64  ALACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAV 123
            LA F+HR+ GGG WI+ IY                ++I A Y + LF+MSTWIPLCCAV
Sbjct: 63  LLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCCAV 122

Query: 124 AQVLFEVTTSYSLVGNLM 141
           AQ+LF+V  +YS V  ++
Sbjct: 123 AQILFDVIMAYSSVSGIL 140

>CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {ON}
           highly similar to uniprot|Q06537 Saccharomyces
           cerevisiae YPR153w
          Length = 140

 Score =  160 bits (405), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 95/138 (68%)

Query: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63
           +F+TS D+P+GY TPSFPSLYWPIN+ +Y+TA+LY    IW FT+YW+ I NG FYG AG
Sbjct: 3   SFITSTDVPIGYKTPSFPSLYWPINDRRYDTAFLYFIEDIWKFTLYWTFIFNGAFYGGAG 62

Query: 64  ALACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAV 123
             A  TH K+GGG WI  IY                ++I A Y S LFSMSTW+P+CCAV
Sbjct: 63  LYASLTHWKRGGGLWIFGIYMLYAGVQGMIIGTVMGFLIGAIYRSGLFSMSTWVPMCCAV 122

Query: 124 AQVLFEVTTSYSLVGNLM 141
            Q+L +VT SYS+VG++M
Sbjct: 123 VQILLDVTMSYSMVGSIM 140

>Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  160 bits (404), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 77/138 (55%), Positives = 95/138 (68%)

Query: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63
           +F+T+ND+PVGYVTP FPSLYWPINN +YNTA+LY    IW F++YW+LI NG FY V G
Sbjct: 2   SFVTNNDIPVGYVTPKFPSLYWPINNPRYNTAFLYYISDIWKFSLYWTLIFNGAFYIVTG 61

Query: 64  ALACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAV 123
             A  THRKK G  WI ++Y                ++I A Y S LFSMSTWIPLCCAV
Sbjct: 62  LYASLTHRKKAGSLWIFSMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCAV 121

Query: 124 AQVLFEVTTSYSLVGNLM 141
            Q+LF+V   YS+VG++M
Sbjct: 122 VQILFDVVLGYSMVGSVM 139

>Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  159 bits (403), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 95/138 (68%)

Query: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63
           +F+T+ND+PVGY+TP FPSLYWPIN+S+YNTA+LY    IW F++YW+LI NG FY  AG
Sbjct: 2   SFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAAG 61

Query: 64  ALACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAV 123
             A  THRKK G  WI  +Y                ++I A Y S LFSMSTWIPLCCAV
Sbjct: 62  LYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCAV 121

Query: 124 AQVLFEVTTSYSLVGNLM 141
            Q+LF+V   YS++G++M
Sbjct: 122 VQILFDVVLGYSMIGSIM 139

>Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 aa]
           {ON} YPR153W (REAL)
          Length = 140

 Score =  158 bits (399), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 94/138 (68%)

Query: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63
           +F+T+ND+PVGYVTP FPSLYWPIN+S+YN A+LY    IW F++YW+LI NG FY   G
Sbjct: 3   SFVTNNDIPVGYVTPKFPSLYWPINSSRYNIAFLYYISDIWKFSLYWTLIFNGAFYVTTG 62

Query: 64  ALACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAV 123
             A  THRKKGG  WI  +Y                ++I A Y S LFSMSTWIPLCCAV
Sbjct: 63  LYASLTHRKKGGSIWIFVMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCAV 122

Query: 124 AQVLFEVTTSYSLVGNLM 141
            Q+LF+V   YS++G++M
Sbjct: 123 VQILFDVILGYSMIGSVM 140

>TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  155 bits (391), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 73/133 (54%), Positives = 91/133 (68%)

Query: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63
           +F+T+ND+PVGYVTP FPSLYWPINN KYNT++LYD+  IW F++YW +ILN  FYGV G
Sbjct: 3   SFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGVTG 62

Query: 64  ALACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAV 123
            +A  +HR K G  WI+ IY                Y+ISA Y S LF MSTWIP CCAV
Sbjct: 63  TIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCCAV 122

Query: 124 AQVLFEVTTSYSL 136
            Q+LF+V  S+ +
Sbjct: 123 VQILFDVVQSFPI 135

>TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 140
           aa] {ON} Anc_3.500 YPR153W
          Length = 140

 Score =  154 bits (389), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 70/138 (50%), Positives = 95/138 (68%)

Query: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63
           +F+T+ND+P+GYVTPSFPSL+WPI+N K++ A LYD   IW FT+YWSLI NG FYG+AG
Sbjct: 3   SFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGIAG 62

Query: 64  ALACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAV 123
             A ++HR++ GG WI+AIY                ++I + Y + LFSMSTWIP CC +
Sbjct: 63  LWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCCVI 122

Query: 124 AQVLFEVTTSYSLVGNLM 141
            Q+LF+ + SY   G +M
Sbjct: 123 VQILFDFSVSYLSSGTIM 140

>SAKL0F02508g Chr6
           complement(217712..217835,217912..218205,218273..218277)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  142 bits (359), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 93/138 (67%)

Query: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63
           +F+T+ D+P+GYVTPSFPSLYWP+NN K++ +YLY +  IW FTVYW+LIL   FYG AG
Sbjct: 3   SFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGSAG 62

Query: 64  ALACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAV 123
            +A ++HRK  GG WI+  Y                 +I+  Y + LF+MSTW+PL CA+
Sbjct: 63  LIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSCAL 122

Query: 124 AQVLFEVTTSYSLVGNLM 141
            Q+LF V+TSY + G ++
Sbjct: 123 MQILFNVSTSYLMAGVII 140

>KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 147
           aa] {ON} Anc_3.500 YPR153W
          Length = 147

 Score =  139 bits (349), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 68/137 (49%), Positives = 90/137 (65%)

Query: 5   FLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAGA 64
           F+ +N++PVGY TPSFPSLYWPI+N  Y+ A+LY+   IW FT+YW LILNG FYG +G 
Sbjct: 11  FVANNEIPVGYHTPSFPSLYWPISNESYSLAFLYNIEDIWKFTMYWCLILNGAFYGTSGL 70

Query: 65  LACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAVA 124
           +A  +H K      I+ +Y                 ++ A Y + LF+MSTWIPLCCAVA
Sbjct: 71  VATISHWKNPHAILIVGLYLLYAGIQGVVIGIIAGLLLGAIYRAGLFTMSTWIPLCCAVA 130

Query: 125 QVLFEVTTSYSLVGNLM 141
           Q+LF+V  SYS VG+L+
Sbjct: 131 QILFDVVMSYSHVGSLL 147

>KLTH0G02354g Chr7
           complement(185220..185343,185400..185693,185765..185769)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  136 bits (342), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 66/135 (48%), Positives = 85/135 (62%)

Query: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63
           +F+T  D+P+GY TP FPSL+WPINN +Y  +YLY +  IW FTV+W+LIL   FY  AG
Sbjct: 3   SFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTAAG 62

Query: 64  ALACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAV 123
             A  +HRKK  G WI+A Y                 I++ TY + LF MSTWIPLC AV
Sbjct: 63  LWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCSAV 122

Query: 124 AQVLFEVTTSYSLVG 138
             +LF V+T+YS+ G
Sbjct: 123 VLILFHVSTTYSMAG 137

>KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423
           bp, 140 aa] {ON} similar to uniprot|Q06HN0 Saccharomyces
           cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  132 bits (332), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 63/138 (45%), Positives = 86/138 (62%)

Query: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63
            F  + D+PVGY  P FPSLYWP+NN K++ AYLY    IW FT++W++IL    YG  G
Sbjct: 3   TFFITGDVPVGYQVPDFPSLYWPMNNGKFSVAYLYYLPDIWRFTIFWTMILFAIVYGTTG 62

Query: 64  ALACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAV 123
           A+A  TH+K   GFW++ +Y                 +I+  Y + LF+MSTWIPLCCAV
Sbjct: 63  AIAWTTHKKILFGFWMIPLYIMIGMAQAFVSGTVVGILIAIIYKAGLFAMSTWIPLCCAV 122

Query: 124 AQVLFEVTTSYSLVGNLM 141
            Q+LF V+TSYS+   ++
Sbjct: 123 VQILFNVSTSYSMTSPII 140

>ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {ON}
           similar to uniprot|Q06HN0 Saccharomyces cerevisiae
           YPR153W Hypothetical ORF
          Length = 139

 Score =  131 bits (329), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 65/126 (51%), Positives = 82/126 (65%), Gaps = 1/126 (0%)

Query: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63
           +F+T+ND+PVGY TPSFPSLYWP   S+ +   +YD   IW FT+YWSLI N  FY + G
Sbjct: 3   SFITTNDVPVGYETPSFPSLYWP-TESRTSLHVIYDVSAIWKFTLYWSLIFNFGFYALTG 61

Query: 64  ALACFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAV 123
             A F+HRK+ GG WI+A+Y                ++I   Y S LFSMSTWIP CCAV
Sbjct: 62  LWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCCAV 121

Query: 124 AQVLFE 129
           AQVL++
Sbjct: 122 AQVLYD 127

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score =  130 bits (326), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 62/135 (45%), Positives = 81/135 (60%), Gaps = 1/135 (0%)

Query: 8   SNDMPVGYVTPSFPSLYWPIN-NSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAGALA 66
              +P+GY+TP FPSLYWPI  +  ++ A+LY    IW FT+YWSLI NG FY  AGA+A
Sbjct: 10  EQSVPIGYITPKFPSLYWPIGFDESFDNAFLYSVVDIWKFTLYWSLIFNGAFYVSAGAVA 69

Query: 67  CFTHRKKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAVAQV 126
           C T +KK     I A Y                +++   Y + LF MS WIP+CCAVAQ+
Sbjct: 70  CLTTKKKSRSLLIFATYTVFGGLQGVIVGTVMGFLVGTIYRAGLFGMSCWIPMCCAVAQI 129

Query: 127 LFEVTTSYSLVGNLM 141
           L++V  SYS VG +M
Sbjct: 130 LYDVLVSYSTVGRIM 144

>AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPR153W; 1-intron
          Length = 141

 Score = 95.5 bits (236), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 71/123 (57%), Gaps = 1/123 (0%)

Query: 12  PVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAGALACFTHR 71
           P GY++PSFPSL W  ++ + N A LY +  I  FT++W+LIL G  YG  G +A ++HR
Sbjct: 13  PAGYISPSFPSLLWTADD-RANGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71

Query: 72  KKGGGFWILAIYXXXXXXXXXXXXXXXXYIISATYLSALFSMSTWIPLCCAVAQVLFEVT 131
           +  GG  ILAIY                 I +A Y +AL +MSTWIPL  AV Q L+ + 
Sbjct: 72  RITGGVGILAIYLLLGALHAILGGTFSGLITAAIYRAALIAMSTWIPLASAVVQALYLLC 131

Query: 132 TSY 134
            ++
Sbjct: 132 AAF 134

>Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON}
          YPR153W - Hypothetical ORF [contig 189] FULL
          Length = 113

 Score = 32.0 bits (71), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 58 FYGVAGALACFTHRKKGGGFWILAIY 83
          FY  AG  A  +HR+  GG WI+A Y
Sbjct: 3  FYAAAGLWASVSHRRTAGGLWIMAFY 28

>YHR120W Chr8 (349574..352453) [2880 bp, 959 aa] {ON}
           MSH1DNA-binding protein of the mitochondria involved in
           repair of mitochondrial DNA, has ATPase activity and
           binds to DNA mismatches; has homology to E. coli MutS;
           transcription is induced during meiosis
          Length = 959

 Score = 28.5 bits (62), Expect = 6.1,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 27  INNSKYNTAY--LYDSYT-IWLFTVYWSLILNGFFYGVAGALACFTHRKKGGGFWILAI 82
           I N  +NT    L+D+Y  +W     ++ +L GFF G  GA   FT +++  G + L +
Sbjct: 561 IVNPSFNTKLRKLHDTYQGVWQKKTEYNALLKGFFVGDLGA-KTFTLKERQNGEYALHV 618

>Smik_7.121 Chr7 (211577..214975) [3399 bp, 1132 aa] {ON} YGL151W
           (REAL)
          Length = 1132

 Score = 28.5 bits (62), Expect = 8.0,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 3   GNFLTSNDMPVGYVTPSFPSLYWPINNSK-YNTAYLYDSYTI-----WLFTVYWSLILNG 56
           G FL  N+ PV  +  +  + +W +++S  YN  YL++   +     +LF V  +L    
Sbjct: 886 GKFLILNENPVNKIMTNQINSFWSLHSSTYYNLDYLFELIELVTPKSFLFDVLKTLEYKL 945

Query: 57  FFYGVAGA 64
             YGV G+
Sbjct: 946 TTYGVPGS 953

>CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highly
           similar to uniprot|P32795 Saccharomyces cerevisiae
           YPR024w protease
          Length = 745

 Score = 28.1 bits (61), Expect = 9.4,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 3/50 (6%)

Query: 19  SFPSLYWPINNSKYNTAYLY---DSYTIWLFTVYWSLILNGFFYGVAGAL 65
           +FPSLY P+  S+    ++     ++T+    + W L    F YGV+ A 
Sbjct: 199 TFPSLYSPLYGSRKEPLHVVVSESTFTVVSRWIKWVLFFGIFAYGVSEAF 248

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.140    0.470 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,570,816
Number of extensions: 491286
Number of successful extensions: 1372
Number of sequences better than 10.0: 35
Number of HSP's gapped: 1350
Number of HSP's successfully gapped: 35
Length of query: 141
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 43
Effective length of database: 42,244,131
Effective search space: 1816497633
Effective search space used: 1816497633
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 60 (27.7 bits)