Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0A057003.499ON25625613430.0
SAKL0F02530g3.499ON25225111861e-166
Kpol_480.103.499ON25924611861e-166
ZYRO0D09746g3.499ON25324911691e-163
Skud_7.4463.499ON25825211671e-163
TDEL0D056703.499ON25525111661e-163
KAFR0C020203.499ON25825611601e-162
YGR135W (PRE9)3.499ON25824711571e-162
Smik_6.2313.499ON25824711561e-161
NDAI0G008903.499ON25425011541e-161
Suva_7.4233.499ON25824711511e-161
NCAS0E007603.499ON25924811511e-161
CAGL0I10406g3.499ON25725711271e-157
Ecym_12303.499ON25125111211e-156
KNAG0B007603.499ON25925311191e-156
KLLA0E03917g3.499ON24924911111e-155
KLTH0G02376g3.499ON25125111081e-154
Kwal_47.188983.499ON25125111061e-154
AFR318W3.499ON25124810851e-151
TBLA0D029203.499ON25825710621e-147
KLTH0E16324g8.871ON2502204101e-48
TPHA0H011905.64ON2602414093e-48
TBLA0C066205.64ON2622384083e-48
SAKL0H02068g5.64ON2612384075e-48
NCAS0D013405.64ON2612414075e-48
NDAI0C034005.64ON2632534075e-48
Kwal_56.247805.64ON2622574051e-47
ADL354W8.871ON2502194022e-47
Kpol_1062.25.64ON2602414022e-47
CAGL0I02442g5.64ON2602384022e-47
KAFR0B044405.64ON2602384023e-47
ZYRO0C11770g5.64ON2602574013e-47
CAGL0H07007g8.871ON2502193995e-47
TDEL0G008805.64ON2602413998e-47
Ecym_81518.871ON2502193989e-47
KNAG0J001808.871ON2502213961e-46
KAFR0L020808.871ON2502203934e-46
AER296W5.64ON2602383944e-46
NDAI0E001608.871ON2502193925e-46
KLLA0D10373g8.871ON2502133926e-46
KLTH0H00528g5.64ON2612413928e-46
Suva_7.5495.64ON2602413901e-45
Kpol_455.58.871ON2492213891e-45
YGR253C (PUP2)5.64ON2602413901e-45
Smik_16.545.64ON2602413892e-45
Ecym_51005.64ON2612383883e-45
Skud_7.5865.64ON2602413883e-45
TPHA0C049308.871ON2502203864e-45
Smik_13.438.871ON2502193858e-45
KNAG0K004505.64ON2672383841e-44
Suva_13.568.871ON2502193822e-44
SAKL0D00440g8.871ON2502193822e-44
TDEL0B004008.871ON2502203822e-44
KLLA0A05093g5.64ON2622263822e-44
Skud_13.518.871ON2502193812e-44
YML092C (PRE8)8.871ON2502193813e-44
NCAS0B001508.871ON2502133796e-44
ZYRO0A00616g8.871ON2502203786e-44
NCAS0F010307.120ON2532043762e-43
KLLA0B11836g7.120ON2541763752e-43
KLTH0F13574g7.120ON2542043734e-43
TBLA0J019807.120ON2542043726e-43
Kwal_YGOB_Anc_7.1207.120ON2542043727e-43
TPHA0I020707.120ON2562043711e-42
KAFR0G030307.120ON2542043701e-42
AAR012C7.120ON2512043701e-42
SAKL0F04224g7.120ON2522043683e-42
TBLA0C063408.871ON2562253683e-42
Ecym_12727.120ON2512043664e-42
CAGL0F01199g7.120ON2542073665e-42
Skud_15.1197.120ON2542203665e-42
YOL038W (PRE6)7.120ON2542043641e-41
Suva_15.1317.120ON2542043641e-41
Smik_15.1297.120ON2542043631e-41
NDAI0H015207.120ON2522043622e-41
Kpol_1023.1087.120ON2542043605e-41
TDEL0H033007.120ON2562183571e-40
ZYRO0G04136g7.120ON2541793571e-40
KNAG0L010207.120ON2661763432e-38
AGL089W4.110ON2462023101e-33
TBLA0E006907.20ON2781953102e-33
Ecym_72334.110ON2461823021e-32
Kpol_538.407.20ON2741753014e-32
KNAG0E002307.20ON2792023006e-32
ZYRO0C00792g7.20ON2901722981e-31
KLLA0A05027g4.110ON2462052951e-31
NCAS0I002507.20ON2921722972e-31
Smik_15.5467.20ON2881722963e-31
ADR401C7.20ON2791782953e-31
KAFR0C050007.20ON2811722953e-31
Suva_8.4197.20ON2921722953e-31
KLLA0A03487g7.20ON2751722944e-31
CAGL0H06105g7.20ON2901722945e-31
TBLA0C040804.110ON2532012916e-31
KLTH0D00902g7.20ON2772472928e-31
Skud_15.5307.20ON2881722911e-30
YOR362C (PRE10)7.20ON2881722902e-30
Kwal_27.97208.871ON1731452771e-29
TDEL0H043107.20ON2741722831e-29
Kwal_47.174934.110ON2461822812e-29
KLTH0E07788g4.110ON2461822812e-29
TPHA0N002407.20ON2771772804e-29
Ecym_50197.20ON2852322814e-29
NDAI0A087707.20ON2921952805e-29
SAKL0D14476g7.20ON2812272797e-29
YGL011C (SCL1)4.110ON2521772777e-29
Kpol_1061.454.110ON2561772751e-28
YMR314W (PRE5)5.1ON2342292732e-28
Suva_7.2704.110ON2521772742e-28
Skud_7.2764.110ON2521972742e-28
Smik_13.5315.1ON2342252723e-28
Smik_7.2794.110ON2521772724e-28
CAGL0M14003g5.1ON2332422705e-28
NCAS0A016404.110ON2532002707e-28
Ecym_56505.1ON2331932698e-28
KNAG0D035404.110ON2522002708e-28
Skud_13.4885.1ON2342202689e-28
TPHA0F006704.110ON2572042682e-27
KNAG0E011805.1ON2331922662e-27
TDEL0F023604.110ON2531792663e-27
SAKL0H21956g4.110ON2481822663e-27
KLTH0B09504g5.1ON2332192644e-27
Suva_13.5075.1ON2342202636e-27
CAGL0A00407g4.110ON2541772611e-26
ZYRO0G10164g4.110ON2532022612e-26
Kwal_26.94835.1ON2332212602e-26
KAFR0I027205.1ON2352312583e-26
ZYRO0C01144g5.1ON2332232583e-26
NCAS0D023105.1ON2332192573e-26
Kpol_1060.15.1ON2332192574e-26
AGL336W5.1ON3062222614e-26
TPHA0A056705.1ON2332222574e-26
NDAI0I026405.1ON2332192531e-25
KLLA0A10153g5.1ON2331932531e-25
KAFR0F034304.110ON2521792481e-24
SAKL0H00946g5.1ON2332412417e-24
TBLA0C071905.1ON2331922401e-23
TDEL0G002405.1ON2382462233e-21
NDAI0D035604.110ON172801609e-13
Kwal_26.68197.20ON1961501592e-12
AGL324W7.480ON2431711322e-08
NDAI0J006007.480ON2411921261e-07
NDAI0C011705.507ON2631611261e-07
NCAS0A148807.480ON2411961242e-07
KAFR0B006507.480ON2411921242e-07
SAKL0G04290g5.507ON2612281233e-07
KNAG0B038005.507ON2611611233e-07
YOR157C (PUP1)5.507ON2611611224e-07
TPHA0E020505.507ON2611721224e-07
Smik_15.3375.507ON2611611224e-07
KAFR0C053005.507ON2611861224e-07
KLLA0E05633g7.480ON2401531206e-07
Suva_8.2085.507ON2611611199e-07
Kpol_1028.927.480ON2421871181e-06
Ecym_54585.507ON2582051191e-06
Skud_15.3215.507ON2611611191e-06
TDEL0A037105.507ON2611831191e-06
Kwal_47.187485.507ON2632051172e-06
CAGL0L04312g5.507ON2612091162e-06
TDEL0C034407.480ON2411771153e-06
SAKL0F15092g7.480ON2611741163e-06
ZYRO0G17842g7.480ON2441731144e-06
KNAG0F035907.480ON2482311144e-06
TBLA0F026807.480ON2411731144e-06
CAGL0F04477g7.480ON2421721144e-06
KLTH0E01826g7.480ON2422291144e-06
Kpol_218.15.507ON2611611144e-06
NCAS0H024805.507ON2641881145e-06
Kwal_55.198827.480ON2422161135e-06
ZYRO0D12034g5.507ON2611601135e-06
Ecym_71717.480ON2422081127e-06
KLLA0A02233g5.507ON2621991128e-06
TBLA0D017505.507ON2591611111e-05
Skud_2.617.480ON2411731111e-05
YBL041W (PRE7)7.480ON2411731101e-05
Smik_2.737.480ON2411731092e-05
KLTH0G03168g5.507ON2632111083e-05
Suva_2.777.480ON2411731065e-05
TPHA0E004207.480ON2411871047e-05
AAR119W5.507ON2591741057e-05
Kpol_534.575.216ON215209968e-04
Kpol_2002.1095.216ON215209950.001
KLLA0F12936g5.216ON215169910.003
AEL326C3.417ON285200880.009
AAL172C5.216ON215168860.013
ZYRO0B10142g5.216ON215208850.019
TDEL0C055403.417ON287208850.020
KLTH0D03058g3.417ON287177850.021
CAGL0D03058g5.216ON215206820.044
TBLA0F017603.417ON287198820.055
KNAG0A075203.417ON287179810.072
TDEL0E041305.216ON219207800.077
Smik_16.3433.417ON287169810.078
Skud_16.3883.417ON287179800.084
Suva_16.4293.417ON287169800.087
ZYRO0C17688g3.417ON287200800.10
NCAS0A114403.417ON287211800.10
Kwal_33.151935.216ON193202780.13
YPR103W (PRE2)3.417ON287169790.14
Smik_10.2785.216ON216211780.14
Ecym_82765.216ON215206770.19
Ecym_26143.417ON285203770.21
Kwal_26.72733.417ON287169770.21
YJL001W (PRE3)5.216ON215211760.22
SAKL0G12584g5.216ON215209760.23
Skud_10.2225.216ON215211760.24
NDAI0A048603.417ON287171760.26
CAGL0G01804g3.417ON286169760.33
KAFR0D042103.417ON287200750.36
TPHA0M017503.417ON286198750.41
Kpol_1018.1443.417ON288200740.54
Smik_7.1736.159ON34942740.55
SAKL0B09262g3.417ON287169740.57
KLLA0F08228g3.417ON285198730.68
KLTH0G00550g3.574ON265128730.71
NCAS0A014805.216ON21671720.75
TPHA0N007405.216ON216210711.0
KAFR0C063505.216ON21671711.1
NDAI0C024205.216ON21672711.2
Suva_12.805.216ON21571711.2
TBLA0C062005.216ON21676701.3
KLTH0B03102g5.216ON21571701.3
TPHA0E029905.216ON21673682.7
Kwal_23.29492.191ON161764693.1
KNAG0H024505.216ON21671664.7
KLTH0C07348g3.269ON316127657.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0A05700
         (256 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3....   521   0.0  
SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {O...   461   e-166
Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON} ...   461   e-166
ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {O...   454   e-163
Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W (...   454   e-163
TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3....   453   e-163
KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.49...   451   e-162
YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3...   450   e-162
Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W (...   449   e-161
NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON...   449   e-161
Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W (...   447   e-161
NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499     447   e-161
CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa] ...   438   e-157
Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON} ...   436   e-156
KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON...   435   e-156
KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {O...   432   e-155
KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {O...   431   e-154
Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR13...   430   e-154
AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic h...   422   e-151
TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON...   413   e-147
KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 2...   162   1e-48
TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON...   162   3e-48
TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {...   161   3e-48
SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly ...   161   5e-48
NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64      161   5e-48
NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON...   161   5e-48
Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa] ...   160   1e-47
ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON} S...   159   2e-47
Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906...   159   2e-47
CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {O...   159   2e-47
KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64...   159   3e-47
ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {O...   159   3e-47
CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {O...   158   5e-47
TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64...   158   8e-47
Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa] ...   157   9e-47
KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871...   157   1e-46
KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.8...   155   4e-46
AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic h...   156   4e-46
NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON} ...   155   5e-46
KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {O...   155   6e-46
KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly si...   155   8e-46
Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}...   154   1e-45
Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432) ...   154   1e-45
YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}  P...   154   1e-45
Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C (R...   154   2e-45
Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON} ...   154   3e-45
Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}...   154   3e-45
TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8....   153   4e-45
Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON} ...   152   8e-45
KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}...   152   1e-44
Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON} ...   151   2e-44
SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,...   151   2e-44
TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871 ...   151   2e-44
KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly ...   151   2e-44
Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON} ...   151   2e-44
YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}  PR...   151   3e-44
NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON} ...   150   6e-44
ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}...   150   6e-44
NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120     149   2e-43
KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highl...   149   2e-43
KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893) ...   148   4e-43
TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.1...   147   6e-43
Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131...   147   7e-43
TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.12...   147   1e-42
KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON...   147   1e-42
AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, ...   147   1e-42
SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 a...   146   3e-42
TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {...   146   3e-42
Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa] ...   145   4e-42
CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {O...   145   5e-42
Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W...   145   5e-42
YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha ...   144   1e-41
Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W...   144   1e-41
Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W...   144   1e-41
NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120     144   2e-41
Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON} (2523...   143   5e-41
TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON...   142   1e-40
ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {O...   142   1e-40
KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {O...   136   2e-38
AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic hom...   124   1e-33
TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON...   124   2e-33
Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to...   120   1e-32
Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON} ...   120   4e-32
KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20 Y...   120   6e-32
ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly si...   119   1e-31
KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly ...   118   1e-31
NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON} ...   119   2e-31
Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {O...   118   3e-31
ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 ...   118   3e-31
KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20...   118   3e-31
Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}...   118   3e-31
KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 a...   117   4e-31
CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly ...   117   5e-31
TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON...   116   6e-31
KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {...   117   8e-31
Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {O...   116   1e-30
YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}...   116   2e-30
Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON} ...   111   1e-29
TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON...   113   1e-29
Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C...   112   2e-29
KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly ...   112   2e-29
TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20 ...   112   4e-29
Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}...   112   4e-29
NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {...   112   5e-29
SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369) ...   112   7e-29
YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}  S...   111   7e-29
Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {...   110   1e-28
YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha ...   109   2e-28
Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}...   110   2e-28
Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}...   110   2e-28
Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W...   109   3e-28
Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}...   109   4e-28
CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} high...   108   5e-28
NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON...   108   7e-28
Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON...   108   8e-28
KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON...   108   8e-28
Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W...   107   9e-28
TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.11...   107   2e-27
KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON...   107   2e-27
TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON...   107   3e-27
SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highl...   107   3e-27
KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {O...   106   4e-27
Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W...   105   6e-27
CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly si...   105   1e-26
ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly ...   105   2e-26
Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {...   104   2e-26
KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1 ...   103   3e-26
ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}...   103   3e-26
NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON...   103   3e-26
Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON} c...   103   4e-26
AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homol...   105   4e-26
TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON}             103   4e-26
NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1       102   1e-25
KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {O...   102   1e-25
KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON...   100   1e-24
SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly ...    97   7e-24
TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5....    97   1e-23
TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON} ...    91   3e-21
NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON...    66   9e-13
Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C (P...    66   2e-12
AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic hom...    55   2e-08
NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.4...    53   1e-07
NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON...    53   1e-07
NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {...    52   2e-07
KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.48...    52   2e-07
SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly ...    52   3e-07
KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON...    52   3e-07
YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}  ...    52   4e-07
TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON...    52   4e-07
Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {O...    52   4e-07
KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5....    52   4e-07
KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {O...    51   6e-07
Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}...    50   9e-07
Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON} (21109...    50   1e-06
Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to...    50   1e-06
Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {O...    50   1e-06
TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.50...    50   1e-06
Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {O...    50   2e-06
CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {...    49   2e-06
TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON...    49   3e-06
SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highl...    49   3e-06
ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa] ...    49   4e-06
KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON...    49   4e-06
TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON...    49   4e-06
CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {O...    49   4e-06
KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly ...    49   4e-06
Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON} comp...    49   4e-06
NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507      49   5e-06
Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W...    48   5e-06
ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highl...    48   5e-06
Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON} ...    48   7e-06
KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {O...    48   8e-06
TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON...    47   1e-05
Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W (R...    47   1e-05
YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6 ...    47   1e-05
Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W (R...    47   2e-05
KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly ...    46   3e-05
Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W (R...    45   5e-05
TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480 ...    45   7e-05
AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic hom...    45   7e-05
Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON} (145742....    42   8e-04
Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON} (2589...    41   0.001
KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590) ...    40   0.003
AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON} Synt...    39   0.009
AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 ...    38   0.013
ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648...    37   0.019
TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.41...    37   0.020
KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {O...    37   0.021
CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {O...    36   0.044
TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON...    36   0.055
KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3....    36   0.072
TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 ...    35   0.077
Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W...    36   0.078
Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W...    35   0.084
Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W...    35   0.087
ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highl...    35   0.10 
NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3....    35   0.10 
Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL00...    35   0.13 
YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5...    35   0.14 
Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 a...    35   0.14 
Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp...    34   0.19 
Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar ...    34   0.21 
Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON...    34   0.21 
YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {...    34   0.22 
SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137) ...    34   0.23 
Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 a...    34   0.24 
NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {...    34   0.26 
CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {O...    34   0.33 
KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.41...    33   0.36 
TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.4...    33   0.41 
Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa] ...    33   0.54 
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    33   0.55 
SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly ...    33   0.57 
KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {O...    33   0.68 
KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly si...    33   0.71 
NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON...    32   0.75 
TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.2...    32   1.0  
KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [...    32   1.1  
NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON...    32   1.2  
Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa...    32   1.2  
TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5....    32   1.3  
KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648...    32   1.3  
TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON...    31   2.7  
Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C ...    31   3.1  
KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 ...    30   4.7  
KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly ...    30   7.0  

>TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3.499
           YGR135W
          Length = 256

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/256 (100%), Positives = 256/256 (100%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ
Sbjct: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240
           KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK
Sbjct: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240

Query: 241 AGITKKSEDGEDTAMN 256
           AGITKKSEDGEDTAMN
Sbjct: 241 AGITKKSEDGEDTAMN 256

>SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 252

 Score =  461 bits (1186), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 222/251 (88%), Positives = 240/251 (95%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TS+EKLYKLNDNITVAVAGLTADAEILINTARV+AQNYLQTYNE+IPVE+LVR+LSDIKQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAGYDER GYQL+TSNPSGNY+GWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240
           KD I L+GAIELALKTLSKTTDSSALT+DR+EFATIKKG N ++YQKIYKP+EI+ LLSK
Sbjct: 181 KDGINLDGAIELALKTLSKTTDSSALTHDRIEFATIKKGSNGQLYQKIYKPQEIQTLLSK 240

Query: 241 AGITKKSEDGE 251
            GITKK ++ E
Sbjct: 241 TGITKKDDEDE 251

>Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON}
           complement(20212..20991) [780 nt, 260 aa]
          Length = 259

 Score =  461 bits (1186), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/246 (90%), Positives = 238/246 (96%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TSTEK+Y+LND ITVAVAGLTADAEILINTARV AQ YL+TYNE+IPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240
           KDDIK++ AIELALKTLSKTTDSSALTYDRVEFATIKKGEN+K+YQKI+KPEEIKQLL K
Sbjct: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240

Query: 241 AGITKK 246
            GITKK
Sbjct: 241 TGITKK 246

>ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 253

 Score =  454 bits (1169), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 219/249 (87%), Positives = 237/249 (95%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TSTEKLY+LND I VAVAGLT+DAEILINTAR+ AQNYL+TYNEDIPVE+LV++LSDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQ+++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240
           KDDIK++GAIELALKTLSKTTDSSALTYDRVEFATIK GEN K+YQK++KPEEI+ LL K
Sbjct: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240

Query: 241 AGITKKSED 249
            GITK  ED
Sbjct: 241 NGITKAGED 249

>Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  454 bits (1167), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 220/252 (87%), Positives = 240/252 (95%), Gaps = 1/252 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TSTEKLYKLND I VAVAGLTADAEILINTARV AQNYL+TYNEDIPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAG+D+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN-KVYQKIYKPEEIKQLLS 239
           K+D+K++GAI+LALKTLSKTTDSSALTYDR+EFATI+KG N+ +VYQKI+KP+EIK LL 
Sbjct: 181 KEDMKVDGAIDLALKTLSKTTDSSALTYDRLEFATIRKGPNDGEVYQKIFKPQEIKDLLV 240

Query: 240 KAGITKKSEDGE 251
           K GI+KK ED E
Sbjct: 241 KTGISKKDEDDE 252

>TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3.499
           YGR135W
          Length = 255

 Score =  453 bits (1166), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 219/251 (87%), Positives = 237/251 (94%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TSTEKLY+LND ITVAVAGLTADAEILINTARV+AQNYL+TYNEDIPVE+LV++LSDIKQ
Sbjct: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQ+++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240
           KDD+KLEGAIELALKTLSKTTDSSALT DR+EFATI+K  + K+YQKI+KPEEI+ LL K
Sbjct: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240

Query: 241 AGITKKSEDGE 251
            GITKK  D E
Sbjct: 241 HGITKKHHDDE 251

>KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.499
           YGR135W
          Length = 258

 Score =  451 bits (1160), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 219/256 (85%), Positives = 238/256 (92%), Gaps = 1/256 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TS EKLYKLND ITVAVAGLTADAEILINTAR+ AQNYL+TYNEDIPVE+LVR+LSDIKQ
Sbjct: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAGYDER GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGE-NNKVYQKIYKPEEIKQLLS 239
           KD+I L+ A+ELALKTLSK TDSS LTYDR+EFATIKKG+ N+K+YQKI+ P+EIK LL 
Sbjct: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240

Query: 240 KAGITKKSEDGEDTAM 255
           K GI+KK  + EDT M
Sbjct: 241 KTGISKKENEDEDTEM 256

>YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3
           subunit of the 20S proteasome, the only nonessential 20S
           subunit; may be replaced by the alpha 4 subunit (Pre6p)
           under stress conditions to create a more active
           proteasomal isoform
          Length = 258

 Score =  450 bits (1157), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 218/247 (88%), Positives = 236/247 (95%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TSTEKLYKLND I VAVAGLTADAEILINTAR+ AQNYL+TYNEDIPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN-KVYQKIYKPEEIKQLLS 239
           KDD+K++ AIELALKTLSKTTDSSALTYDR+EFATI+KG N+ +VYQKI+KP+EIK +L 
Sbjct: 181 KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV 240

Query: 240 KAGITKK 246
           K GITKK
Sbjct: 241 KTGITKK 247

>Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  449 bits (1156), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 218/247 (88%), Positives = 237/247 (95%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TSTEKLYKLND I+VAVAGLTADAEILINTAR+ AQNYL+TYNEDIPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN-KVYQKIYKPEEIKQLLS 239
           KDD+K++ AI+LALKTLSKTTDSSALTYDR+EFATI+KG N+ +VYQKI+KP+EIK LL 
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240

Query: 240 KAGITKK 246
           K GITKK
Sbjct: 241 KTGITKK 247

>NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON}
           Anc_3.499
          Length = 254

 Score =  449 bits (1154), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 217/250 (86%), Positives = 238/250 (95%), Gaps = 1/250 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TS EKLYKLND ITVAVAGLTADAEILINTAR+ AQNYL+TYNEDIPVE+LVR+LSDIKQ
Sbjct: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN-KVYQKIYKPEEIKQLLS 239
           KDD++L+ AIELALKTLSKTTDSS+LTYD++EFATIKKG+N+ +VYQKIYKP+EIK+LL 
Sbjct: 181 KDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFATIKKGKNDGEVYQKIYKPDEIKELLI 240

Query: 240 KAGITKKSED 249
           K G+TKK +D
Sbjct: 241 KTGVTKKKDD 250

>Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  447 bits (1151), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 217/247 (87%), Positives = 236/247 (95%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TSTEKLYKLND I VAVAGLTADAEILINTARV AQNYL++YNEDIPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKSYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAG+D+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN-KVYQKIYKPEEIKQLLS 239
           KDD+K++ AI+LALKTLSKTTDSSALTYDR+EFATI+KG N+ +VYQKI+KP+EIK LL 
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDLLV 240

Query: 240 KAGITKK 246
           K GITKK
Sbjct: 241 KTGITKK 247

>NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499
          Length = 259

 Score =  447 bits (1151), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 217/248 (87%), Positives = 239/248 (96%), Gaps = 1/248 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DG+VLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TSTEKLYKLND ITVAVAGLTADAEILINTARV+AQ+YL+TYNE+IPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKG-ENNKVYQKIYKPEEIKQLLS 239
           KD++KL+ AIELALKTLSKTTDSS+LTYD++E ATIKKG   ++VYQKIYKPEE+K+LL 
Sbjct: 181 KDNMKLDDAIELALKTLSKTTDSSSLTYDKLELATIKKGTTTDEVYQKIYKPEELKELLL 240

Query: 240 KAGITKKS 247
           K GITKKS
Sbjct: 241 KTGITKKS 248

>CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa]
           {ON} highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135w proteasome subunit Y13
          Length = 257

 Score =  438 bits (1127), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 214/257 (83%), Positives = 238/257 (92%), Gaps = 1/257 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM  +GIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TSTEKLYKLND  TVAVAGLTADAEILINTAR+ AQNYL+TYNE+IPVE+LVRKLSDIKQ
Sbjct: 61  TSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTYNEEIPVEMLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQ+GGLRP+GVSFIYAGYD+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATI-KKGENNKVYQKIYKPEEIKQLLS 239
           KD++ L+ A+ELALKTLSKTTDSS+LTYDR+EFAT+ KKGE  +  QKI+KP EIKQLL 
Sbjct: 181 KDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFATLKKKGETEEFEQKIFKPAEIKQLLI 240

Query: 240 KAGITKKSEDGEDTAMN 256
           K GI+KKS++ ED  M+
Sbjct: 241 KTGISKKSDEDEDVEMS 257

>Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON}
           similar to Ashbya gossypii AFR318W
          Length = 251

 Score =  436 bits (1121), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 209/251 (83%), Positives = 233/251 (92%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TS+EKLY+LNDNITVAVAGLTADAEILINTAR+ AQNYL+ YNE+IPVE+LVR+LSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILINTARLHAQNYLKMYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNY+GWKAISVGANT AAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240
           KD+I  E AIELALKTLSKTTD+S+LT DR+EFATIK+  N K+ QKIYKP EIK+LL K
Sbjct: 181 KDEITFENAIELALKTLSKTTDNSSLTDDRLEFATIKQDSNGKLVQKIYKPSEIKELLQK 240

Query: 241 AGITKKSEDGE 251
           +GI K+ E+ +
Sbjct: 241 SGIMKQEENAD 251

>KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON}
           Anc_3.499 YGR135W
          Length = 259

 Score =  435 bits (1119), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 213/253 (84%), Positives = 235/253 (92%), Gaps = 2/253 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A+DGIV+AAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TSTEKLY+LND I VAVAGLTADAEILINTARV  QNYL+TY EDIPVE+LV+++SDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
            YTQHGGLRPFGVSFIYAG D+R G+QL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKG-ENNKVYQKIYKPEEIKQLLS 239
           KD+I LE A ELALKTLSKTTDSSALTYDRVEF+TIK+G E  +V QKIYKP EIKQLL 
Sbjct: 181 KDEITLEEATELALKTLSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240

Query: 240 KAGITKK-SEDGE 251
           K+GITKK +EDG+
Sbjct: 241 KSGITKKDAEDGD 253

>KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 249

 Score =  432 bits (1111), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 210/249 (84%), Positives = 228/249 (91%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM E GIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TS+EKLYKLNDNITVAVAGLTADAEILINTARV AQ+YL+TYNE+IPVE+LVR+LSD+KQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTYNEEIPVEMLVRRLSDLKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNY+GWKAISVGANT AAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240
           KDDI L+GAIELALKTLSKTTDSS LT++R+EFATI K    K+YQKIYKP EI  LL K
Sbjct: 181 KDDITLDGAIELALKTLSKTTDSSVLTHERLEFATISKDAEGKIYQKIYKPTEIATLLEK 240

Query: 241 AGITKKSED 249
             I KK +D
Sbjct: 241 TEIVKKDDD 249

>KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 251

 Score =  431 bits (1108), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 206/251 (82%), Positives = 233/251 (92%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA+DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           +S+EKLYKLNDNITVAVAGLTADAEILINTAR+FAQNYL++YNE+IPVE+LVR+LSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFG SFIYAGYD+R GYQL+TSNPSGNY+GWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240
           KDDI +E A ELALKTLSKTTDSS LT +RVEF+TI K +N K+ QKI+KP+EI+ LL+K
Sbjct: 181 KDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240

Query: 241 AGITKKSEDGE 251
            G+TKK  D E
Sbjct: 241 TGVTKKENDDE 251

>Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR135W
           (PRE9) - proteasome component Y13 [contig 189] FULL
          Length = 251

 Score =  430 bits (1106), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 207/251 (82%), Positives = 231/251 (92%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA+DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           +S+EKLYKLNDNITVAVAGLTADAEILINTAR+FAQNYL+TYNE+IPVE+LVR+LSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKTYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFG SFIYAGYD+R GYQL+TSNPSGNY+GWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRFGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240
           KDDI ++ A ELALKTLSKTTDSS LT +RVEFATI K EN K+ QKI+KP EI+ LL++
Sbjct: 181 KDDITVKEATELALKTLSKTTDSSTLTSERVEFATITKLENGKIAQKIFKPREIETLLNE 240

Query: 241 AGITKKSEDGE 251
            GI KK  + E
Sbjct: 241 TGINKKENEEE 251

>AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR135W (PRE9)
          Length = 251

 Score =  422 bits (1085), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 203/248 (81%), Positives = 227/248 (91%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           TS+EKLY+LNDNITVAVAGLTADAEIL+NTAR+ AQNYL+ YNE+IPVEVLVR+LSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GYTQHGGLRPFGVSFIYAGYD R GYQL+TSNPSGNY+GWKAISVGANT A QTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240
           KDD+  + AI+LALKTLSKTTDSS+L+++R+EFATI++  + KV QKIYK  EIK LL K
Sbjct: 181 KDDLTFDDAIKLALKTLSKTTDSSSLSHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240

Query: 241 AGITKKSE 248
            GI K+ E
Sbjct: 241 TGINKQEE 248

>TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON}
           Anc_3.499 YGR135W
          Length = 258

 Score =  413 bits (1062), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 203/257 (78%), Positives = 225/257 (87%), Gaps = 2/257 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM++DGIVL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
              EKLYKL+D IT+AVAGLTADAEILIN AR FAQNYL TYNE+IPVE+LV+KLSDIKQ
Sbjct: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
            YTQHGGLRPFGVSFIYAGYD+ LG QL+TSNPSGNYTGWKAIS+GANTSAAQTLLQM++
Sbjct: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180

Query: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIK--KGENNKVYQKIYKPEEIKQLL 238
           KDD+ L  A+EL LKTLSKTTDSS LTYDRVE + IK  K  +NK+ QKIY P EIKQLL
Sbjct: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSIIKIDKENDNKIIQKIYNPAEIKQLL 240

Query: 239 SKAGITKKSEDGEDTAM 255
            K GI KK+++ ED  M
Sbjct: 241 IKFGINKKNDEDEDVEM 257

>KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 250
           aa] {ON} similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  162 bits (410), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 87/220 (39%), Positives = 137/220 (62%), Gaps = 5/220 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K TS+L   + S  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIRATNGVIIATEKKSTSSLALTE-SLS 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+  +  +I  A +G+  D  +LI+ +R  A  +Y + YNE  P ++LV +++ I Q  T
Sbjct: 63  KVAHITPDIGAAYSGMGPDFRVLIDKSRKVAHTHYKRIYNEYPPTKILVAEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AGYDE  GY L+  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNK 223
           ++LE AI +AL TL ++ +      D +E A +  GE N+
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVV--GEENQ 219

>TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON}
           Anc_5.64 YGR253C
          Length = 260

 Score =  162 bits (409), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 96/241 (39%), Positives = 143/241 (59%), Gaps = 8/241 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  ILEIDRHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++GA +  AQ+ LQ E
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYNAKAIGAGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLS 239
           +   + L+ A  L LK L +  +   L  +  + ++I K E  K+Y      E +KQ+  
Sbjct: 187 WHSSLTLKEAELLVLKVLKQVMEEK-LDENNTQLSSITKDEGFKIYTNERTAELVKQVKE 245

Query: 240 K 240
           K
Sbjct: 246 K 246

>TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {ON}
           Anc_5.64 YGR253C
          Length = 262

 Score =  161 bits (408), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 140/238 (58%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSRLLESD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + ++  +I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIEKHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AGYD+  GYQLF + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQL 237
           +   + L+ A  L LK L +  +   L  + V+ + + K E  K+Y      E IK+L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LNENNVQLSCVTKEEGFKIYSDEKLSEIIKEL 243

>SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  161 bits (407), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 95/238 (39%), Positives = 143/238 (60%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + +++ +I  A++GLTADA  +I  ARV A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARVSAVTHNLYYDEDIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYDAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQL 237
           +   + L+ A  L LK L +  +   L  +  + +++ + E  K+Y      E IK+L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSVTRDEGFKIYSDEKTAEIIKEL 243

>NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64
          Length = 261

 Score =  161 bits (407), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 96/241 (39%), Positives = 139/241 (57%), Gaps = 8/241 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + ++  +I  A++GLTADA  +I  ARV A N+   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIEHHIGCAMSGLTADARSMIEHARVAAVNHNLYYDEDIKVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AGYD   GYQLF + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDNDEGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLS 239
           +   + L+ A  L LK L +  +   L     + + + K    ++Y      E IK+L  
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDESNAQLSCVTKENGFQIYDDAKTAEIIKELKE 245

Query: 240 K 240
           K
Sbjct: 246 K 246

>NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON}
           Anc_5.64
          Length = 263

 Score =  161 bits (407), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 96/253 (37%), Positives = 147/253 (58%), Gaps = 10/253 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + ++  ++  A++GLTADA  +I  ARV A N+   Y+ED+ VE L + + D+     +G
Sbjct: 67  IVEIEHHVGCAMSGLTADARSMIEHARVAAVNHNLYYDEDMKVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDDDEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLS 239
           +   + L  A  L LK L +  +   L  +  + + I K    ++Y      E IK++  
Sbjct: 187 WHSSLTLREAEVLVLKILKQVMEEK-LDENNAQLSCITKDNGFQIYDNAKTAEIIKEMKE 245

Query: 240 KAGITKKSEDGED 252
           K   T++  +GE+
Sbjct: 246 KE--TQEHPEGEE 256

>Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa]
           {ON} YGR253C (PUP2) - 1:1 [contig 160] FULL
          Length = 262

 Score =  160 bits (405), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 150/257 (58%), Gaps = 10/257 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + ++  ++  A++GLTADA  +I  ARV A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSAVTHNLYYDEEISVESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDQEQGYQLYHAEPSGTFYRFNAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLS 239
           +   + L+ A  L L+ L +  +   L  D  + +++ K +  KVY        IK+L  
Sbjct: 187 WHSSLTLKEAELLVLRILKQVMEEK-LDEDNAQLSSVTKEDGFKVYSDEKTAAIIKELKE 245

Query: 240 KAGITKKSEDGEDTAMN 256
           K    ++S + +D  M+
Sbjct: 246 KEA--QESSESQDVEMS 260

>ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML092C
           (PRE8); 1-intron
          Length = 250

 Score =  159 bits (402), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 85/219 (38%), Positives = 136/219 (62%), Gaps = 5/219 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K  +TL  +DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANTTLTIKDT-LD 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFA-QNYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+ ++  +I    +G+  D  +LIN +R  A  +Y + Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSQITPDIGAVYSGMGPDFRVLINKSRKTAYGSYRKAYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AGYDE  G+ L+  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN 222
           ++LE AI +AL TL ++ +      + +E A +  GE N
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGETIELAVV--GEEN 218

>Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906)
           [783 nt, 261 aa]
          Length = 260

 Score =  159 bits (402), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/241 (39%), Positives = 140/241 (58%), Gaps = 8/241 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTREGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + +++++I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDNHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVETLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDRDQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLS 239
           +   + L+ A  L LK L +  +   L     + ++I K    K+Y      E IK+L  
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDESNTQLSSITKENGFKIYNDDKTAELIKELKE 245

Query: 240 K 240
           K
Sbjct: 246 K 246

>CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253c PUP2
          Length = 260

 Score =  159 bits (402), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 143/238 (60%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG++  +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + +++ ++  A++GLTADA  ++  ARV A  +   Y+EDI +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMLEHARVSAVTHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AGYD+  GYQLF + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQL 237
           +   + L+ A +L LK L +  +   L  +  + ++I K +  ++Y      E IK+ 
Sbjct: 187 WHSSLTLKEAEQLVLKILKQVMEEK-LDENNAQLSSITKDDGFQIYSDSKTAEIIKEF 243

>KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  159 bits (402), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 92/238 (38%), Positives = 140/238 (58%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TA+GI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAVGICTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + +++ ++  A++GLTADA  +I  ARV A ++   Y+EDI +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMIEHARVAAVSHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AGYD   GYQLF + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQL 237
           +   + L+ A  L LK L +  +   L  +  + + + K +  K+Y      E IK L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCVTKSDGFKIYSDEKVAEIIKDL 243

>ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253C PUP2 Alpha subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit zeta
          Length = 260

 Score =  159 bits (401), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 147/257 (57%), Gaps = 10/257 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G++L  E++  S LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVILGVEKRANSPLLEAD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  ILEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDENISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AGYD+  GYQLF + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLS 239
           +   + L+ A  L LK L +  +   L  +  + ++I K E  K+Y      E IK L  
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSITKEEGFKIYDDKKTAEIIKALKE 245

Query: 240 KAGITKKSEDGEDTAMN 256
           K    +  EDG D  MN
Sbjct: 246 KEA-EESPEDG-DVEMN 260

>CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092c PRE8
          Length = 250

 Score =  158 bits (399), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 87/219 (39%), Positives = 135/219 (61%), Gaps = 5/219 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+  L  +I    +G+  D  +L++ +R  A  NY + Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGIGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AGYDE  GY L+  +PSG+Y  WKA S+G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNNE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN 222
           ++LE AI +AL TL ++ +      D +E A I  GE N
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVI--GEPN 218

>TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  158 bits (399), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 139/241 (57%), Gaps = 8/241 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+ED+ VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDMSVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
                    RPFGV+ + AGYD+  GYQLF + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDKESGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLS 239
           +   + L+ A  L LK L +  +   L  +  + ++  K +  K+Y      E IK+L  
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSTTKEDGFKIYDDSKTAEIIKELKE 245

Query: 240 K 240
           K
Sbjct: 246 K 246

>Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa]
           {ON} similar to Ashbya gossypii ADL354W 1-intron
          Length = 250

 Score =  157 bits (398), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 135/219 (61%), Gaps = 5/219 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K  STL   DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANSTLTLTDT-LD 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFA-QNYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+ K+  +I    +G+  D  +LIN +R  A  +Y++TY E  P ++LV +++ I Q  T
Sbjct: 63  KISKITPDIGAVYSGMGPDFRVLINKSRKTAYGSYMKTYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AGYD    + L+  +PSG+Y  WKA ++G   +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDNHNEFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNNE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN 222
           ++LE AI +AL TL ++ +      + +E A I  GE N
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGETIEVAVI--GEEN 218

>KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  157 bits (396), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 81/221 (36%), Positives = 137/221 (61%), Gaps = 3/221 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   DT + 
Sbjct: 4   RYAFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKSSSPLALTDTLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+  +  +I    +G+  D  +L++ +R  A  +Y + YNE  P ++LV +++++ Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEVMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AGYD+  G+ L+  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDDHRGFSLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKV 224
           ++LE AI +AL TL ++ +      D +E   I +  N+++
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIGIIGEPNNDQL 222

>KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  155 bits (393), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 137/220 (62%), Gaps = 5/220 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+  +  +I    +G+  D  +L++ +R  A  +Y + YNE  P ++LV ++++I Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AG+DE  G+ L+  +PSG+Y  WKA ++G  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHQGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNK 223
           ++LE AI +AL TL ++ +      D +E   I  GE N+
Sbjct: 183 LELEDAIHIALLTLKESIEGE-FNGDTIEIGVI--GEPNQ 219

>AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR253C (PUP2)
          Length = 260

 Score =  156 bits (394), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 144/238 (60%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + +++ +I  A++GLTADA  +I  AR+ +  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQL 237
           +   + L+ A  L LK L +  +   L  +  + +++ K +  ++Y +    E IK+L
Sbjct: 187 WYSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSVTKEQGFRIYPESETAEIIKEL 243

>NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  155 bits (392), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 85/219 (38%), Positives = 135/219 (61%), Gaps = 5/219 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL +++   T+IGI A +GIV+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSIGIKATNGIVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+  +  +I    +G+  D  +L++ +R  A  NY + Y E  P ++LV +++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHSNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AG+DE  G+ L+  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHRGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN 222
           ++LE AI +AL TL ++ +      D +E A I  G+ N
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVI--GDEN 218

>KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type
           subunit,
          Length = 250

 Score =  155 bits (392), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI + +GIV+A E+K +S+L   DT   
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKSTNGIVIATEKKSSSSLALPDT-VS 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+  +  +I    +G+  D  +L++ AR  A  NY + Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSLITPDIGAVYSGMGPDFRVLVDKARKVAHTNYKRIYGEYPPTKILVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AG+DE  G+ L+  +PSG Y  WKA ++G  +SAA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSVLVAGHDEHNGFGLYQVDPSGAYFPWKATAIGKGSSAAKTFLEKRWNEE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++LE AI +AL TL ++ +      D +E A +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAIV 214

>KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  155 bits (392), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 139/241 (57%), Gaps = 8/241 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + ++  ++  A++GLTADA  +I  ARV +  +   Y+EDI +E L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLYYDEDISIESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLS 239
           +   + L+ A  L LK L +  +   L     + + + K +  KVY        IK+L  
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDEGNAQLSCVTKEDGFKVYSDEKTAAIIKELKD 245

Query: 240 K 240
           K
Sbjct: 246 K 246

>Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  154 bits (390), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 139/241 (57%), Gaps = 8/241 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AG+D   GYQLF + PSG +  + A ++G+ +  AQ  L  E
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLS 239
           +   + L+ A  L LK L +  +   L  +  + + I K +  K+Y      E IK+L  
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCITKEDGFKIYDDSKTAELIKELKE 245

Query: 240 K 240
           K
Sbjct: 246 K 246

>Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432)
           [750 nt, 250 aa]
          Length = 249

 Score =  154 bits (389), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 136/221 (61%), Gaps = 7/221 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTL-LEQDTST 63
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTEDVS- 62

Query: 64  EKLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGY 122
            K+  L  +I    +G+  D  +L++ +R  A  NY + Y E  P ++LV +++ I Q  
Sbjct: 63  -KISLLTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKD 182
           TQ GG+RPFGVS + AG+DE  G+ L+  +PSG+Y  WKA ++G  + AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATAIGKGSIAAKTFLEKRWNN 181

Query: 183 DIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNK 223
           +++LE AI +AL TL ++ +      D +E A +  G NN+
Sbjct: 182 ELELEDAIHIALLTLKESVEGE-FNGDTIEIAIV--GNNNQ 219

>YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}
           PUP2Alpha 5 subunit of the 20S proteasome involved in
           ubiquitin-dependent catabolism; human homolog is subunit
           zeta
          Length = 260

 Score =  154 bits (390), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 139/241 (57%), Gaps = 8/241 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AG+D   GYQLF + PSG +  + A ++G+ +  AQ  L  E
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLS 239
           +   + L+ A  L LK L +  +   L  +  + + I K +  K+Y      E IK+L  
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCITKQDGFKIYDNEKTAELIKELKE 245

Query: 240 K 240
           K
Sbjct: 246 K 246

>Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C
           (REAL)
          Length = 260

 Score =  154 bits (389), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 139/241 (57%), Gaps = 8/241 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AG+D   GYQLF + PSG +  + A ++G+ +  AQ  L  E
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLS 239
           +   + L+ A  L LK L +  +   L  +  + + I K +  K+Y      E IK+L  
Sbjct: 187 WHSSLTLKEAELLILKILKQVMEEK-LDENNAQLSCITKQDGFKIYDDKKTAELIKELKE 245

Query: 240 K 240
           K
Sbjct: 246 K 246

>Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON}
           similar to Ashbya gossypii AER296W
          Length = 261

 Score =  154 bits (388), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 142/238 (59%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + +++ +I  A++GLTADA  +I  AR+ +  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEVDKHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQL 237
           +   + L+ A  L LK L +  +   L  +  + +++ +     +Y +    E I+QL
Sbjct: 187 WYSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSVTEEHGFSIYPESKTAEIIEQL 243

>Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  154 bits (388), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 139/241 (57%), Gaps = 8/241 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+EDI VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ + AG+D   GYQLF + PSG +  + A ++G+ +  AQ  L  E
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLS 239
           +   + L+ A  L LK L +  +   L  +  + + I K +  K+Y      E IK+L  
Sbjct: 187 WHSSLSLKEAELLILKILKQVMEEK-LDENNAQLSCITKEDGFKIYDDNKTAELIKELKK 245

Query: 240 K 240
           K
Sbjct: 246 K 246

>TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  153 bits (386), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 136/220 (61%), Gaps = 6/220 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTL-LEQDTST 63
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S+L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKTSSSLALTEDIS- 62

Query: 64  EKLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGY 122
            K+  L  +I    +G+  D  +L++ +R  A  NY + Y E    ++LV +++ + Q  
Sbjct: 63  -KISALTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPSTKLLVSEIAKVMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKD 182
           TQ GG+RPFGVS + AG+DE  G+ L+  +PSG+Y  WKA S+G  ++AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNN 181

Query: 183 DIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN 222
           +++LE AI +AL TL ++ +      D +E A +   ENN
Sbjct: 182 ELELEDAIHIALLTLKESVEGE-FNGDTIEIAVVGD-ENN 219

>Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  152 bits (385), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 134/219 (61%), Gaps = 5/219 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAISETLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+  L  +I    +G+  D  +L++ +R  A  NY + Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AG+DE  G+ L+  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN 222
           ++LE AI +AL TL ++ +      D +E A I  G+ N
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII--GDEN 218

>KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}
           Anc_5.64 YGR253C
          Length = 267

 Score =  152 bits (384), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 134/238 (56%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + +++ +I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTSAITHDLYYDENIKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
                    RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDADDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQL 237
           +   + +  A  L LK L +  +   L  + V+   I K    ++Y      E IK L
Sbjct: 187 WHSSLNMRDAEVLTLKILKQVMEEK-LDQNNVQLCCITKDGGFEIYDNKKTGEIIKLL 243

>Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/219 (37%), Positives = 134/219 (61%), Gaps = 5/219 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKTSSPLAMSETLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+  L  +I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AG+DE  G+ L+  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN 222
           ++LE AI +AL TL ++ +      D +E A I  G+ N
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII--GDEN 218

>SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,
           250 aa] {ON} highly similar to uniprot|P23639
           Saccharomyces cerevisiae YML092C PRE8 20S proteasome
           beta-type subunit
          Length = 250

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 81/219 (36%), Positives = 134/219 (61%), Gaps = 4/219 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S L   + S  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTE-SLS 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+  +  +I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV +++   Q  T
Sbjct: 63  KVALITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKILVSEIAKTMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AGYDE  GY L+  +PSG+Y  WKA ++G + +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKSATAAKTFLEKRWNEE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN 222
           ++LE AI +AL TL ++ +      D +E A + + ENN
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAIVSE-ENN 219

>TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 82/220 (37%), Positives = 134/220 (60%), Gaps = 5/220 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YA  ++    T+IGI A +G+V+A+E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGIKATNGVVIASEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+  +  +I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSVITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AGYDE  G+ L+  +PSG+Y  WKA ++G  ++AA+T L+  +  +
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHSGFGLYQVDPSGSYFPWKATAIGRGSTAAKTFLEKRWNAE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNK 223
           ++LE AI + L TL ++ +      D +E A +  GE NK
Sbjct: 183 LELEDAIHIVLLTLKESVEGE-FNGDTIEIAVV--GEENK 219

>KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 262

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/226 (38%), Positives = 137/226 (60%), Gaps = 9/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG++  +GIVL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNEGIVLGVEKRVTSALLESD-SIEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK----QG 121
           + +++ +I  A++GLTADA  ++  ARV A  +   Y+E I VE L + + D+     +G
Sbjct: 67  IVEVDTHIGCAMSGLTADARSMLEHARVNAVTHDLYYDEKITVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
            +    L  RPFGV+ +  GYD+  G+QL+ + PSG +  + A ++G+ +  AQ+ LQ E
Sbjct: 127 ASGEERLMSRPFGVALLIGGYDQEQGFQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 FKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVY 225
           +   + L+ A  L LK L +  +   L  +  + ++I K E  ++Y
Sbjct: 187 WHSSLTLKEAESLVLKILKQVMEEK-LDENNAQLSSITK-EGFQIY 230

>Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  151 bits (381), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/219 (37%), Positives = 134/219 (61%), Gaps = 5/219 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+  L  +I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AG+DE  G+ L+  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN 222
           ++LE AI +AL TL ++ +      D +E A I  G+ N
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII--GDEN 218

>YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}
           PRE8Alpha 2 subunit of the 20S proteasome
          Length = 250

 Score =  151 bits (381), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 83/219 (37%), Positives = 134/219 (61%), Gaps = 5/219 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+  L  +I    +G+  D  +L++ +R  A  +Y + Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AG+DE  G+ L+  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN 222
           ++LE AI +AL TL ++ +      D +E A I  G+ N
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII--GDEN 218

>NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  150 bits (379), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL +++   T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+  +  +I    +G+  D  +L++ +R  A  NY + Y    P ++LV +++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGVYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RPFGVS + AG+DE  G+ L+  +PSG+Y  WKA ++G  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHKGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATI 216
           ++LE AI +AL TL ++ +      D +E   I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIGVI 214

>ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  150 bits (378), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 132/220 (60%), Gaps = 5/220 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YA  ++    T+IG+ A +G+V+A E+K +S L   +T   
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGVKATNGVVIATEKKSSSPLALTET-LN 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+ ++  NI    +G+  D  +L++ +R  A  +Y + Y E  P ++LV +++ I Q  T
Sbjct: 63  KISQITPNIGTVYSGMGPDYRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           Q GG+RP+G S + AGYDE  G+ L+  +PSG+Y  WKA ++G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPYGASLLVAGYDEHTGFGLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNEE 182

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNK 223
           ++LE AI   L TL ++ +      D +E A I  G+ NK
Sbjct: 183 LELEDAIHTVLLTLKESVEGE-FNGDTIEIAVI--GDENK 219

>NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120
          Length = 253

 Score =  149 bits (376), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 122/204 (59%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K++ ++ ++ +GL AD+ ILI  ARV AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERLGY-QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD- 183
           GG+RPFGVS + AG+D R    +L+ + PSG Y+ W A ++G N+   +  L+  +  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDNKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --IKLEGAIELALKTLSKTTDSSA 205
               +E  + L +K+L +   + A
Sbjct: 184 PPKNVEECVRLTVKSLLEVVQTGA 207

>KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P40303 Saccharomyces cerevisiae
           YOL038W PRE6 20S proteasome alpha-type subunit
          Length = 254

 Score =  149 bits (375), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 112/176 (63%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGADCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K+++++ ++ AGL AD+ ILI  ARV AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERLGY-QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GG+RPFGVS + AG+D R    +L+ + PSG Y+ W A S+G N++  +  L+  +
Sbjct: 124 GGVRPFGVSVLIAGFDPRDNKPRLYQTEPSGIYSAWCAQSIGRNSNTVREFLEKNY 179

>KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893)
           [765 bp, 254 aa] {ON} highly similar to uniprot|P40303
           Saccharomyces cerevisiae YOL038W PRE6 20S proteasome
           alpha-type subunit
          Length = 254

 Score =  148 bits (373), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 122/204 (59%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  +D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVIGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K++ ++ ++ AGL AD+ ILI  ARV AQ++  T  + + V+ L R ++ ++Q YTQ 
Sbjct: 64  IAKIDSHVVLSFAGLNADSRILIEKARVEAQSHKLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDER-LGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDI 184
           GG+RPFGVS + AG+D R    +L+ + PSG Y+ W A ++G N+   +  L+  +  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGVYSAWSAQAIGRNSKTVREFLEKNYARDA 183

Query: 185 KL---EGAIELALKTLSKTTDSSA 205
                +  ++L +K L +   + A
Sbjct: 184 PPATEQECVKLTVKALLEVVQTGA 207

>TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.120
           YOL038W
          Length = 254

 Score =  147 bits (372), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 122/204 (59%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++      +GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCTVGIKGTDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K++++I ++ +GL AD+ ILI  ARV AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHKLTVEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERLGY-QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD- 183
           GG+RPFG+S + AG+D R    +L+ + PSG Y+ W A ++G N+   +  L+  +  D 
Sbjct: 124 GGVRPFGISTLIAGFDPRDNTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYDRDE 183

Query: 184 --IKLEGAIELALKTLSKTTDSSA 205
                E  I+L +K+L +   + A
Sbjct: 184 PPSTAEECIKLTIKSLLEVVQTGA 207

>Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131)
           [765 bp, 254 aa] {ON} ANNOTATED BY YGOB -
          Length = 254

 Score =  147 bits (372), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 122/204 (59%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  +D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVVGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K++ ++ ++ AGL AD+ ILI  ARV AQ++  T  + + V+ L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDER-LGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDI 184
           GG+RPFGVS + AG+D R    +L+ + PSG Y+ W A ++G N+   +  L+  +  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYVRDA 183

Query: 185 KL---EGAIELALKTLSKTTDSSA 205
                +  ++L +K L +   + A
Sbjct: 184 PPATEQDCVKLTVKALLEVVQTGA 207

>TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.120
           YOL038W
          Length = 256

 Score =  147 bits (371), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI  ED +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGEDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K++++I ++ +GL AD+ ILI  AR+ AQ++  T  + + +E L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIILSFSGLNADSRILIEKARIEAQSHKLTLEDPVSIEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERLGY-QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD- 183
           GG+RPFGVS + AG+D      +L+ + PSG Y+ W A ++G N+   +  L+  +  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPNDNKPRLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYNKDE 183

Query: 184 --IKLEGAIELALKTLSKTTDSSA 205
                E  I+L +K+L +   + A
Sbjct: 184 PPKNKEECIKLTVKSLLEVVQTGA 207

>KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON}
           Anc_7.120 YOL038W
          Length = 254

 Score =  147 bits (370), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGTNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K++++I ++ +GL AD+ ILI  ARV AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERLGY-QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD- 183
           GG+RPFGVS + AG D R    +L+ + PSG Y+ W A ++G N+   +  L+  +  D 
Sbjct: 124 GGVRPFGVSTLIAGLDPRDNTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNKDE 183

Query: 184 --IKLEGAIELALKTLSKTTDSSA 205
               +E  ++L +K+L +   + A
Sbjct: 184 PPSTVEECVKLTIKSLLEVVQTGA 207

>AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, 251
           aa] {ON} syntenic homolog of Saccharomyces cerevisiae
           YOL038W (PRE6); 1-intron
          Length = 251

 Score =  147 bits (370), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 121/204 (59%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP G ++QVEYALE++      +GI  ED +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGIKGEDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + ++++++ ++ AGL AD+ ILI  ARV AQ++  T  + + VE + R ++ ++Q YTQ 
Sbjct: 64  ISRIDNHLILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERLGY-QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDI 184
           GG+RPFGVS + AG+D R    +L+ + PSG Y+ W A ++G N+   +  L+  +    
Sbjct: 124 GGVRPFGVSTLVAGFDPRDARPRLYQTEPSGIYSAWAAQAIGRNSKTVREFLEKNYSKHT 183

Query: 185 KL---EGAIELALKTLSKTTDSSA 205
                +  ++L +K+L +   + A
Sbjct: 184 PPASEQDCVKLTVKSLLEVVQTGA 207

>SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 aa]
           {ON} highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 252

 Score =  146 bits (368), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + +++ ++ ++ AGL AD+ ILI  ARV AQ++  T  + + ++ L R ++ I+Q YTQ 
Sbjct: 64  ISQIDTHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSIDYLTRYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERLGY-QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD- 183
           GG+RPFGVS + AG+D   G  +L+ + PSG Y+ W A ++G N+   +  L+  +  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPNDGVPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKEE 183

Query: 184 --IKLEGAIELALKTLSKTTDSSA 205
                + A++L +K+L +   + A
Sbjct: 184 PPATEQEAVKLTVKSLLEVVQTGA 207

>TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {ON}
           Anc_8.871 YML092C
          Length = 256

 Score =  146 bits (368), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 126/225 (56%), Gaps = 9/225 (4%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    TA+GI A +G+VLA E+K  S+L   + S +
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYALTAVKQGVTALGIKATNGVVLATEKKSGSSLALAE-SLD 62

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYT 123
           K+  L  NI    AG+  D  +L++ AR  A  NY + Y E  P   LV  ++ I Q  T
Sbjct: 63  KISLLTPNIGTVYAGMGPDCRVLVDKARKAAHTNYKRVYGEYPPTRQLVADVAAIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDE------RLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
           Q GG+RPFGVS + AG+D         G+ L+  +PSG Y  WKA +VG    AA+T L+
Sbjct: 123 QSGGVRPFGVSLLVAGHDNANENDSNSGFALYQVDPSGAYFPWKATAVGRGAVAAKTFLE 182

Query: 178 MEFKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENN 222
             + D+++LE A+ +AL  L +  +      D +E A + +  N+
Sbjct: 183 KRWHDELELEDAVHIALLALREAVEGE-FNGDTLEIAVVGEPNND 226

>Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa]
           {ON} similar to Ashbya gossypii AAR012C  1-intron
          Length = 251

 Score =  145 bits (366), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 119/204 (58%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP G ++QVEYALE++      +G+   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGVKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K++ ++ ++ AGL AD+ ILI  ARV AQ++  T  + + VE + R ++ ++Q YTQ 
Sbjct: 64  ISKIDRHVILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDER-LGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF---K 181
           GG+RPFGVS + AG+D R    +L+ + PSG Y+ W A ++G N+   +  L+  +    
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTRPRLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKHN 183

Query: 182 DDIKLEGAIELALKTLSKTTDSSA 205
                E  ++L +K+L +   + A
Sbjct: 184 PPTSEEACVKLTVKSLLEVVQTGA 207

>CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038w PRE6
          Length = 254

 Score =  145 bits (366), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 123/207 (59%), Gaps = 9/207 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTST-- 63
           YD   +IFSP+G ++QVEYALE++     A+G+  +D +VL  ER+  STL  QDT    
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGKDCVVLGCERR--STLKLQDTRVIA 61

Query: 64  EKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYT 123
            K+  ++ ++ ++ AGL AD+ IL+N ARV AQ++  T  + + VE + R ++ ++Q YT
Sbjct: 62  SKVLPIDSHLVLSFAGLNADSRILVNMARVEAQSHRLTLEDPVTVEYMARYVAGVQQKYT 121

Query: 124 QHGGLRPFGVSFIYAGYDER--LGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFK 181
           Q GG+RPFGVS + AG+D R     +L+ + PSG Y+ W A ++G N+   +  L+  + 
Sbjct: 122 QSGGVRPFGVSTLIAGFDPRDTENPRLYQTEPSGIYSSWCAQAIGRNSKTVREFLEKNYN 181

Query: 182 DD---IKLEGAIELALKTLSKTTDSSA 205
            +      E  I L +K L +   + A
Sbjct: 182 REEPPSNKEECIRLTVKALLEVVQTGA 208

>Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  145 bits (366), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 129/220 (58%), Gaps = 7/220 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  ++ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K++ ++ ++ +GL AD+ ILI  ARV AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERLG-YQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF---K 181
           GG+RPFGVS + AG+D R    +L+ + PSG Y+ W A ++G N+   +  L+  +   +
Sbjct: 124 GGVRPFGVSTLIAGFDARDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGEN 221
               +E  ++L +++L +   + A     +E   +K   N
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA---KNIEITVVKPDSN 220

>YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha 4
           subunit of the 20S proteasome; may replace alpha 3
           subunit (Pre9p) under stress conditions to create a more
           active proteasomal isoform; GFP-fusion protein relocates
           from cytosol to the mitochondrial surface upon oxidative
           stress
          Length = 254

 Score =  144 bits (364), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  ++ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K++ ++ ++ +GL AD+ ILI  ARV AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERLG-YQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF---K 181
           GG+RPFGVS + AG+D R    +L+ + PSG Y+ W A ++G N+   +  L+  +   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDIKLEGAIELALKTLSKTTDSSA 205
               +E  ++L +++L +   + A
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA 207

>Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  144 bits (364), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  ++ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K++ ++ ++ +GL AD+ ILI  ARV AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERLG-YQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF---K 181
           GG+RPFGVS + AG+D R    +L+ + PSG Y+ W A ++G N+   +  L+  +   +
Sbjct: 124 GGVRPFGVSTLIAGFDSRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDIKLEGAIELALKTLSKTTDSSA 205
               +E  ++L +++L +   + A
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA 207

>Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  144 bits (363), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  ++ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K++ ++ ++ +GL AD+ ILI  ARV AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERLG-YQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF---K 181
           GG+RPFGVS + AG+D R    +L+ + PSG Y+ W A ++G N+   +  L+  +   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDIKLEGAIELALKTLSKTTDSSA 205
               +E  ++L +++L +   + A
Sbjct: 184 PPATVEDCVKLTVRSLLEVVQTGA 207

>NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120
          Length = 252

 Score =  144 bits (362), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 122/204 (59%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  ++ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K++ ++ ++ +GL AD+ ILI  AR+ AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARIEAQSHRLTLEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERLGY-QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDI 184
           GG+RPFGVS + AG+D R    +L+ + PSG Y+ W A ++G N+   +  L+  +  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNREE 183

Query: 185 KLEG---AIELALKTLSKTTDSSA 205
             E     + L +++L +   + A
Sbjct: 184 PPENVDECVRLTVRSLLEVVQTGA 207

>Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON}
           (252377..253141) [765 nt, 255 aa]
          Length = 254

 Score =  143 bits (360), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI  E+ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGENCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K+++++ ++ +GL AD+ ILI  AR+ AQ++  T  + I VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVILSFSGLNADSRILIEKARIEAQSHKLTLEDPISVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDER-LGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF---K 181
           GG+RPFG+S + AG+D      +L+ + PSG Y+ W A ++G N+   +  L+  +   +
Sbjct: 124 GGVRPFGISTLIAGFDPNDKTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYDRNE 183

Query: 182 DDIKLEGAIELALKTLSKTTDSSA 205
               +E  ++L +K+L +   + A
Sbjct: 184 PPKTVEECVKLTVKSLLEVVQTGA 207

>TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON}
           Anc_7.120 YOL038W
          Length = 256

 Score =  142 bits (357), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 125/218 (57%), Gaps = 7/218 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYAAEAVKRGTCAVGIKGRDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ ++ ++ +GL AD+ ILI  ARV AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISTIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERLGY-QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD- 183
           GG+RPFGV+ + AG+D +    +L+ + PSG Y+ W A ++G N+   +  L+  +  D 
Sbjct: 124 GGVRPFGVATLIAGFDPQDDTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKG 219
                E  ++L +++L +   + A     +E   +K G
Sbjct: 184 PPATAEECVKLTVRSLLEVVQTGA---KNIEITLVKPG 218

>ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 254

 Score =  142 bits (357), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 111/179 (62%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYASEAVKRGTCAVGIKGKDCVVLGCERRSTLKLQDSRITPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           + K++ ++ ++ +GL AD+ ILI  ARV AQ++  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVSVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDERLGY-QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
           GG+RPFGV+ + AG+D+     +L+ + PSG Y+ W A ++G N+   +  L+  +  D
Sbjct: 124 GGVRPFGVATLIAGFDKDDDTPKLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRD 182

>KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {ON}
           Anc_7.120 YOL038W
          Length = 266

 Score =  136 bits (343), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 107/176 (60%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+     +VL  ER+ T  L +  T+  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVRRGTCAVGVKGPRCVVLGCERRSTLKLQDPRTTPSK 63

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ ++ ++ AGL+ADA +LI  AR  AQ++  T  + + VE + R ++ I+Q YTQ 
Sbjct: 64  VALVDTHVALSFAGLSADARVLIERARTEAQSHRLTLEDPVSVEYMARYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDE-RLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
           GG+RPFGVS + AG+D      +L+ + PSG Y+ W A ++G N    +  L+  +
Sbjct: 124 GGVRPFGVSTLVAGFDSGDDTPRLYHTEPSGIYSAWTAQTIGRNAKTVREFLEKNY 179

>AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL011C (SCL1)
          Length = 246

 Score =  124 bits (310), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/202 (34%), Positives = 102/202 (50%), Gaps = 9/202 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I  +   VL  ++KV   LLE 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCTVLVNQKKVPDKLLEP 60

Query: 60  DTSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK 119
            T T  L+ +  +I +   G  ADA  +    R  A  +   Y  D+PV VL ++ +++ 
Sbjct: 61  STVT-YLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGYDMPVHVLAKRFANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
           Q YTQ   +RP GV   +   DE  G  +F  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 FK-------DDIKLEGAIELAL 194
           FK       D+   E  +E A+
Sbjct: 180 FKKLQKDRLDEDSWEKVVEFAI 201

>TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON}
           Anc_7.20 YOR362C
          Length = 278

 Score =  124 bits (310), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 109/195 (55%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI  +DG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCDDGVVFAVEKIISSKLLVPKRNV-K 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A N+ + Y + IPV  L  ++S   Q YT +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRYLVNRGREEASNFKKLYTKPIPVSALADRISQYVQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFK---D 182
             +RPFG+S I  G DE  G  L+   PSG   G+K  + G    AA+  L+  F    D
Sbjct: 127 NSVRPFGISAIIGGIDED-GSHLYMVEPSGTCWGYKGAATGKGRQAAKAELEKLFDRSTD 185

Query: 183 DIKLEGAIELALKTL 197
            + ++ AI+ A + +
Sbjct: 186 GLSVKDAIKEAARVI 200

>Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to
           Ashbya gossypii AGL089W
          Length = 246

 Score =  120 bits (302), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 63/182 (34%), Positives = 98/182 (53%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I  ++ +VL  ++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIKGKNCVVLVNQKKVPDKLLDP 60

Query: 60  DTSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK 119
            T +  ++ ++ +I +   G   DA  +    +  A  +   Y  DIPV VL ++L+++ 
Sbjct: 61  ATVS-YMFPISKHIGMCATGPIGDARNVAVRCKSMAAEFRYEYGYDIPVHVLAKRLANLA 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
           Q YTQ   +RP GV   +   DE  G  +F  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEKGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 FK 181
           FK
Sbjct: 180 FK 181

>Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON}
           complement(86524..87348) [825 nt, 275 aa]
          Length = 274

 Score =  120 bits (301), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 102/175 (58%), Gaps = 2/175 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI   DG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCNDGVVFAVEKLISSKLLVPKKNV-K 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  ++++ Q Y++ IP+     ++    Q +T +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESKSFSQMYSKRIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
             +RPFGVS I+ G D+  G  L+   PSG+Y G+K  + G+    A+T L+  F
Sbjct: 127 NSVRPFGVSAIFGGIDDE-GSHLYMIEPSGSYWGYKGAAAGSGRQIAKTELEKLF 180

>KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20
           YOR362C
          Length = 279

 Score =  120 bits (300), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 109/202 (53%), Gaps = 14/202 (6%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDT---- 61
           YD   ++FSP+GR +QVEYA +++ +  T++G++ EDG+VLA E+ V S LL + +    
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAAKAVENGATSVGLLCEDGVVLAVEKLVASKLLVKASPQNK 67

Query: 62  ---STEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDI 118
              +  K+  +  +I  A +GL  D   L+N AR  +Q + Q Y  DIP   L  ++   
Sbjct: 68  GSGANTKIQTVGRHIGCACSGLVPDGRHLVNRAREESQQFKQLYKRDIPPVALADRMGQY 127

Query: 119 KQGYTQHGGLRPFGVSFIYAGYD-ERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            Q +T +  +RPFGV+ I+ G D E     L+   PSG Y G++  + G    +A+  L+
Sbjct: 128 VQAHTLYNSVRPFGVAAIFGGVDPETAEPHLYMLEPSGVYWGYRGAATGKGRQSAKAELE 187

Query: 178 --MEFKDD----IKLEGAIELA 193
             +  +DD      LE   ELA
Sbjct: 188 KLISSRDDNSPITTLEAVKELA 209

>ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 290

 Score =  119 bits (298), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 101/172 (58%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ V+S LL    +  K
Sbjct: 8   YDLANSVFSPDGRNFQVEYAVKAVENGTTSIGIRCNDGVVFAVEKLVSSKLLVPKRNV-K 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ ++    +GL  D   L+N  R  AQ++ +T+ E IP++ L  +L    Q +T +
Sbjct: 67  IQTIDRHVGCVYSGLIPDGRHLVNRGREEAQSHKKTFGESIPLQALADRLGYYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D++ G  L+   PSG + G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGVDDK-GPHLYMLEPSGTFWGYKGAATGKGRQTAKAELE 177

>KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  118 bits (295), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 104/205 (50%), Gaps = 9/205 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I ++   V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAIRSKTASVVISQKKVPDKLLDP 60

Query: 60  DTSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK 119
            T +  ++ +  +I     G   DA  +    +  A  +   Y  DIP  VL ++++++ 
Sbjct: 61  KTVS-YIFPVARHIGFCATGPVPDARNIALRCKAEASEFRYKYGYDIPCSVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
           Q YTQ   +RP G+   +  YDE  G  +F  +P+G YTG+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGIILTFISYDEETGPAIFKCDPAGYYTGYKATATGPKQQELNSALEKH 179

Query: 180 FK-------DDIKLEGAIELALKTL 197
           FK       D+   E  +E  + TL
Sbjct: 180 FKKLKDDKIDEESWEKTVEFGITTL 204

>NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  119 bits (297), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ VTS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCDDGVVFAVEKIVTSKLLVPKRNV-K 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D    +N  R  A N+ + Y+  IP+     ++    Q +T +
Sbjct: 67  IQGIDRHIGCVYSGLIPDGRHFVNRGREEASNFKKLYSNAIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G DE  G  L+   PSG Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEN-GPHLYMLEPSGTYWGYKGAATGKGRQTAKAELE 177

>Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  118 bits (296), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ + YN  IP+     +L    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYNTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G D+  G  L+   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGVDKN-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 bp,
           279 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YOR362C (PRE10); 1-intron
          Length = 279

 Score =  118 bits (295), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 101/178 (56%), Gaps = 2/178 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TS LL    + +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIRCKDGVVFAVEKLITSKLLVPHKN-KK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ + Y + IP+     ++    Q +T +
Sbjct: 67  IQTVDKHIGCVYSGLMPDGRHLVNIGRQEAADFRKYYRQPIPLPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
             +RPFG+  I+ G DE+ G  L+   PSG Y G++  + G    AA+  L+    +D
Sbjct: 127 NSVRPFGIIAIFGGVDEK-GPHLYMLEPSGAYWGYRGAAAGKGRQAAKAELEKLIGND 183

>KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20
           YOR362C
          Length = 281

 Score =  118 bits (295), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 58/172 (33%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TS L+  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCNDGVVFAVEKLITSKLMVPNKNI-K 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  + ++ + Y + IP+  L  +L    Q +T +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRHLVNRGREESSSFKKLYGKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG++ I+ G DE  G  L+   PSG+Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGITAIFGGVDED-GSHLYMLEPSGSYWGYKGAATGKGRQTAKAELE 177

>Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}
           YOR362C (REAL)
          Length = 292

 Score =  118 bits (295), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TS LL    +T K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCDDGVVFAVEKLITSKLLVPQKNT-K 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ + Y   IP+     +L    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G D+  G  L+   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGVDKD-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 aa]
           {ON} similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 275

 Score =  117 bits (294), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI  EDG+VLA E+ +TS LL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSLGIKCEDGVVLAVEKLITSKLL-VPGKNKK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ + Y+  IP+     ++    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKMYSTPIPIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D   G  L+   PSG Y G+K+ + G    +A+  L+
Sbjct: 127 NSVRPFGVTAIFGGVDSD-GAHLYMLEPSGTYWGYKSAATGKGRQSAKAELE 177

>CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362c PRE10
          Length = 290

 Score =  117 bits (294), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI   DG+V A E+ +TS LL  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYANKAVENGATSIGIKFNDGVVFAVEKIITSKLLVPNKNL-K 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I V  +GL  D   L+N AR  +QN+ + Y   IPV+    ++    Q +T  
Sbjct: 67  IQTVDKHIGVVYSGLIPDGRHLVNRAREESQNFRKMYGSAIPVDAFAERVGQYVQAHTLF 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D+  G  L+   PSG Y G+   + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGCDKN-GPHLYMLEPSGTYWGYNGAATGKGRQTAKAELE 177

>TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  116 bits (291), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 104/201 (51%), Gaps = 10/201 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I      V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNKCAVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQ 124
            ++ ++  I +   G   DA+     A+     Y   Y  D+P +VL +++++I Q YTQ
Sbjct: 71  YIFPISKTIGLVANGPIPDAKNAATKAKTETAEYRYKYGYDMPCDVLAKRMANIAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF-KDD 183
              +RP GV   +  YDE LG  ++ ++P+G Y G+KA + G       T L+  F K+D
Sbjct: 131 RAYMRPLGVILTFISYDEELGPSIYKTDPAGYYVGYKATATGPKQQEINTGLENWFKKND 190

Query: 184 IK-------LEGAIELALKTL 197
           +K        E  +E A+  L
Sbjct: 191 VKEKINEDAWEKVVEFAITQL 211

>KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {ON}
           highly similar to uniprot|P21242 Saccharomyces
           cerevisiae YOR362C PRE10 20S proteasome alpha-type
           subunit
          Length = 277

 Score =  117 bits (292), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 130/247 (52%), Gaps = 9/247 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA+++  +  T++G+  +DGIVLA E+ VTS LL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKDGIVLAVEKLVTSKLL-VPGKNKK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ ++  A +GL  D   L+N  R  A ++ +TY   IP+  L  +L    Q +T +
Sbjct: 67  IQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKTYATPIPLPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIK 185
             +RPFG++ I  G D+  G  L+   PSG Y G+K  + G    +A+  L+    +  +
Sbjct: 127 NSVRPFGITAIVGGVDDD-GAHLYMLEPSGTYWGYKGAATGKGRQSAKAELEKVISNKPE 185

Query: 186 LEG--AIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSKAGI 243
           L+   A++ A + +    + +      +E +     E N +++ +      K LL +A  
Sbjct: 186 LDAREAVKEAARIIYLAHEDNKEKDFELEMSWCSISETNGLHKAV-----PKDLLDEAIA 240

Query: 244 TKKSEDG 250
             K+E+G
Sbjct: 241 FAKAENG 247

>Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  116 bits (291), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ + Y   IPV     +L    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYKTPIPVPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G D+  G  L+   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGVDKD-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}
           PRE10Alpha 7 subunit of the 20S proteasome
          Length = 288

 Score =  116 bits (290), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ + Y   IP+     +L    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G D+  G  L+   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGVDKN-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON}
           YML092C (PRE8) - proteasome component Y7 [contig 336]
           FULL
          Length = 173

 Score =  111 bits (277), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 90/145 (62%), Gaps = 4/145 (2%)

Query: 80  LTADAEILINTARVFAQ-NYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYA 138
           +  D  +LI+ +R  A   Y + YNE  P ++LV +++ I Q  TQ GG+RPFGVS + A
Sbjct: 1   MGPDFRVLIDKSRKVAHTQYKRIYNEYPPTKILVAEVAKIMQEATQSGGVRPFGVSLLVA 60

Query: 139 GYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLS 198
           GYDE  G+ L+  +PSG+Y  WKA ++G   +AA+T L+  + D+++LE AI +AL TL 
Sbjct: 61  GYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDELELEDAIHIALLTLK 120

Query: 199 KTTDSSALTYDRVEFATIKKGENNK 223
           ++ +      D +E A +  GE N+
Sbjct: 121 ESVEGE-FNGDTIEIAVV--GEENQ 142

>TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON}
           Anc_7.20 YOR362C
          Length = 274

 Score =  113 bits (283), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QV+YA++++ +  T+IGI  +DG+V A E+ VTS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVQYAVKAVENGTTSIGIKFKDGVVFAVEKLVTSKLLVPKKNV-K 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  + ++ + Y + IP+  L  +L    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLMPDGRQLVNRGREESSSFKKLYQKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G DE  G  L+   PSG + G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEE-GPHLYMLEPSGAHWGYKGAATGKGRQTAKAELE 177

>Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C
           (SCL1) - Proteasome subunit YC7alpha/Y8 (protease yscE
           subunit 7) [contig 207] FULL
          Length = 246

 Score =  112 bits (281), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/182 (33%), Positives = 98/182 (53%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I   D  V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSIAIRGTDCCVIISQKKVPDKLLDP 60

Query: 60  DTSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK 119
            T +  L++++ ++ +   G   DA      A+  A  Y   Y  D+P +VL ++++++ 
Sbjct: 61  STMS-YLFQISRHVGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
           Q YTQ   +RP GV   +   DE LG  ++  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 FK 181
           FK
Sbjct: 180 FK 181

>KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  112 bits (281), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 95/182 (52%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I   D  V+  ++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSMAIRGNDCCVVINQKKVPDKLLDP 60

Query: 60  DTSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK 119
            T +  L+ ++ +I +   G   DA      A+     Y   Y  D+P +VL ++++++ 
Sbjct: 61  STMS-YLFPISKHIGMVANGPIPDARNAALRAKAEVAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
           Q YTQ   +RP GV   +   DE LG  ++  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 FK 181
           FK
Sbjct: 180 FK 181

>TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20
           YOR362C
          Length = 277

 Score =  112 bits (280), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 97/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR++QVEYA +++ +  T+IGI   DG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRIFQVEYANKAVENGATSIGIKCTDGVVFAVEKIISSKLLVPKKNV-K 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  + N+ + Y + I +     ++    Q YT +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESANFKKVYGQPIGIPAFADRIGQYIQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKD 182
             +RPFGVS I+ G D   G  L+   P+G + G+K  + G    +A+  L+  F +
Sbjct: 127 NSVRPFGVSAIFGGIDSE-GPHLYMVEPNGAFWGYKGAATGKGRQSAKAELEKLFNE 182

>Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}
           similar to Ashbya gossypii ADR401C
          Length = 285

 Score =  112 bits (281), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 121/232 (52%), Gaps = 7/232 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ + S LL   +  EK
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSIGIKCKDGVVFAVEKLINSKLL-VPSKNEK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ + Y + I +     ++    Q +T +
Sbjct: 67  IQTIDKHIGCVYSGLMPDGRHLVNIGRQEANSFRKLYRKPITIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF---KD 182
             +RPFG+  I+ G D+  G  L+   PSG Y G+K  + G    +A+  L+      K 
Sbjct: 127 NSVRPFGIIAIFGGVDDE-GAHLYMLEPSGAYWGYKGAATGKGRQSAKAELEKLVAGDKP 185

Query: 183 DIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEI 234
           ++    A++ A + +    + +      +E +     E N +++++  P+E+
Sbjct: 186 ELSAREAVKEAARIIYVAHEDNKEKEFEIELSWCSISETNGLHERV--PKEL 235

>NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  112 bits (280), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 104/195 (53%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI  +DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAGKAVENGATSIGIKCKDGVVFAVEKIITSKLLVPKKNV-K 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ + Y+  IP+     +L    Q +T +
Sbjct: 67  IQGVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYDLPIPISAFAERLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQM---EFKD 182
             +RPFGV+ I+ G DE+ G  L+   PSG   G+   + G     A+  L+    +  D
Sbjct: 127 NSVRPFGVTSIFGGIDEK-GPHLYMLEPSGTCWGYNGAATGKGRQTAKAELEKLADQHPD 185

Query: 183 DIKLEGAIELALKTL 197
            +    A++ A K +
Sbjct: 186 GLTTRDAVKYAAKII 200

>SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369)
           [846 bp, 281 aa] {ON} similar to uniprot|P21242
           Saccharomyces cerevisiae YOR362C PRE10 20S proteasome
           alpha-type subunit
          Length = 281

 Score =  112 bits (279), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 120/227 (52%), Gaps = 4/227 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +++SP+GR +QVEYA++++ +  T++GI   DG+V A E+ VTS LL    + +K
Sbjct: 8   YDLSNSVYSPDGRNFQVEYAVKAVENGATSVGIKFRDGVVFAVEKLVTSKLLVPGKN-KK 66

Query: 66  LYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQH 125
           +  ++ +I    +GL  D   L+N  R  A ++ + Y++ IPV     ++    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKLYSQPIPVPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ--MEFKDD 183
             +RPFGV+ I+ G D+  G  L+   PSG Y G+   + G    +A+  L+     K D
Sbjct: 127 NSVRPFGVTAIFGGVDKD-GAHLYMLEPSGTYWGYTGAATGKGRQSAKAELEKLATSKPD 185

Query: 184 IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYK 230
           +    A++ A + +    + +      +E + +   E N +++ I K
Sbjct: 186 LSPREAVKEAARIIYLAHEDNKDKDFELEVSWVSTSETNGLHKYIPK 232

>YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}
           SCL1Alpha 1 subunit of the 20S proteasome involved in
           the degradation of ubiquitinated substrates; 20S
           proteasome is the core complex of the 26S proteasome;
           essential for growth; detected in the mitochondria
          Length = 252

 Score =  111 bits (277), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 97/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  +D  V+ +++KV   LL+  T+  
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P +VL ++++++ Q YTQ
Sbjct: 71  YIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFK 181
              +RP GV   +   DE LG  ++ ++P+G Y G+KA + G       T L+  FK
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {ON}
           complement(125355..126125) [771 nt, 257 aa]
          Length = 256

 Score =  110 bits (275), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 95/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I   +  V+  ++KV   LL+ +T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNNCSVIINQKKVPDKLLDAETVS- 71

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQ 124
            +++++  I +   G   DA       +  A  +   Y  D+PV+VL ++++++ Q YTQ
Sbjct: 72  YIFQISRTIGMVANGPIPDARNAAIRCKAEAAEFRYKYGYDMPVDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFK 181
              +RP GV   +   DE  G  ++ S+PSG Y G+KA + G       T L+  FK
Sbjct: 132 RAYMRPLGVILTFVSLDEEKGPSIYKSDPSGYYVGYKATATGPKQQEISTSLENFFK 188

>YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha 6
           subunit of the 20S proteasome
          Length = 234

 Score =  109 bits (273), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 112/229 (48%), Gaps = 8/229 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           +  +K+ K ++++ +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN T     ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDKS-GAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDIKLEG----AIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVY 225
              IK++G     I+  ++ +S++    +LT D +  A + K     +Y
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIY 225

>Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  110 bits (274), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 98/177 (55%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I  ++  V+ +++KV   LL+ +T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGKNCTVVISQKKVPDKLLDPNTVS- 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P +VL ++++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFK 181
              +RP GV   +   DE LG  ++ ++P+G Y G+KA + G       T L+  FK
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  110 bits (274), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 105/197 (53%), Gaps = 9/197 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  ++  V+ +++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPATVS- 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P +VL ++++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFK--- 181
              +RP GV   +   DE LG  ++ ++P+G Y G+KA + G       T L+  FK   
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKSK 190

Query: 182 -DDIK---LEGAIELAL 194
            D IK    E  +E A+
Sbjct: 191 IDHIKEESWEKVVEFAI 207

>Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  109 bits (272), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 111/225 (49%), Gaps = 10/225 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           +  +K+ K +D++ +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDKS-GAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDIKLEG----AIELALKTLSKTTDSSALTYDRVEFATIKKGEN 221
              IK++G     I+  ++ +S++    +LT D +  A +  GEN
Sbjct: 177 DTFIKIDGNPDELIKAGIEAISQSLRDESLTVDNLSIAIV--GEN 219

>Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  109 bits (272), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 97/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  ++  V+ +++KV   LL+  T+  
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  D+P +VL ++++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFK 181
              +RP GV   +   DE LG  ++ ++P+G Y G+KA + G       T L+  FK
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314w PRE5
          Length = 233

 Score =  108 bits (270), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 116/242 (47%), Gaps = 13/242 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++D  VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKDYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQ-TYNEDIPVEVLVRKLSDIK 119
           +  +K+ K ++++ +++AGL  DA +L N  R    NY Q  YN  + VE     L D  
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQC-NYSQLVYNRKLSVEKAGHMLCDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
           Q  TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +  A+T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLIIGYDNS-GPHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERV 175

Query: 180 FKDDIKLEGAIEL---ALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQ 236
             D + +  A EL    ++ L ++     L  D +  A + K     +   IY  E + Q
Sbjct: 176 LDDYLAITDATELIKSGVEALRQSLKDETLNTDNLSIAVVGK----DIPFTIYDGESVSQ 231

Query: 237 LL 238
            L
Sbjct: 232 YL 233

>NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON}
           Anc_4.110
          Length = 253

 Score =  108 bits (270), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 104/200 (52%), Gaps = 9/200 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-AIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+  ++KV   LL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNVNSVAVRGTNCTVVINQKKVPDKLLDPSTVS- 71

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQ 124
            ++ ++ ++ +   G   DA      A++ A  +   Y  D+P +VL ++++++ Q YTQ
Sbjct: 72  YIFPISRHVGMVANGPIPDARNAAMRAKMEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFK--- 181
              +RP GV   +   DE LG  ++ ++P+G Y G+KA + G       T L+  FK   
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPRQQEITTSLENYFKKKT 191

Query: 182 ----DDIKLEGAIELALKTL 197
               ++   E  +E A+  L
Sbjct: 192 TDHLEEESWEKVVEFAIAHL 211

>Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON}
           similar to Ashbya gossypii AGL336W
          Length = 233

 Score =  108 bits (269), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 103/193 (53%), Gaps = 6/193 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +E  +VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSEKYVVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQ-TYNEDIPVEVLVRKLSDIK 119
           +  +K+ K ++++ +++AGL  DA +L N  R    NY Q  YN ++ +      LSD  
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQC-NYSQLVYNRNLSLVKAGHLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
           Q  TQ  G RP+GV  + AGYD   G  L    PSGN       ++GA +  A+T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERV 175

Query: 180 FKDDIKLEGAIEL 192
            ++ +K+E A EL
Sbjct: 176 MEEYLKIETADEL 188

>KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  108 bits (270), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 103/200 (51%), Gaps = 9/200 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-AIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ I  E   V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNVNSMAIRGETCSVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  D+P +VL ++++++ Q YTQ
Sbjct: 71  YIFPISKTIGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFK--- 181
              +RP GV   +   DE LG  ++ S+P+G Y G+KA + G       T L+  FK   
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYKATATGPKQQEITTNLENYFKKSK 190

Query: 182 -DDIK---LEGAIELALKTL 197
            D +K    E  +E A+  L
Sbjct: 191 TDTLKEDAWEKVVEFAITHL 210

>Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  107 bits (268), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 70/220 (31%), Positives = 108/220 (49%), Gaps = 8/220 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           +  +K+ K ++++ +++AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDKS-GAHLLEFQPSGNVMELYGTSIGARSQGAKTYLERTL 176

Query: 181 KDDIKLEG----AIELALKTLSKTTDSSALTYDRVEFATI 216
              IK++G     I+  ++ +S++    +LT D +  A +
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAVV 216

>TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.110
           YGL011C
          Length = 257

 Score =  107 bits (268), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 100/204 (49%), Gaps = 13/204 (6%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   D  V+  ++KV   LL+ DT + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKACNQTNINSVAVRGNDCTVIINQKKVPDKLLDADTVS- 71

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQ 124
            ++ ++  I +   G   DA       +  A  +   Y  D+P +VL ++++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGPIPDARNAALRCKAEAAEFRYKYGYDMPADVLAKRMANLAQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFK--- 181
              +RP GV   +   DE  G  ++ S+PSG Y G+K  + G       T L+  FK   
Sbjct: 132 RAYMRPLGVILTFISVDEEKGPSIYKSDPSGYYIGYKVTATGPKQQEIATSLENFFKKQK 191

Query: 182 --------DDIKLEGAIELALKTL 197
                   D+   E  +E A+  L
Sbjct: 192 NPSKKDHYDEDTWEKVVEFAITQL 215

>KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON}
           Anc_5.1 YMR314W
          Length = 233

 Score =  107 bits (266), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 97/192 (50%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +     L A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYACLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           +  +K+ K +D++ +++AGL  DA +L N  R         YN ++ +E +   LSD  Q
Sbjct: 58  SYQKKIIKCDDHVGLSLAGLAPDARVLSNFVRQHCNYSKLVYNRELSMEKIGYLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  ++T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLVGYDKS-GPHLIEFQPSGNILELYGAAIGARSQGSRTYLERVM 176

Query: 181 KDDIKLEGAIEL 192
            D + +E A EL
Sbjct: 177 DDFLPVEDATEL 188

>TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  107 bits (266), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 96/179 (53%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   +  V+  ++KV   LLE  T + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGRNSTVVINQKKVPDKLLEASTVS- 71

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  D+P +VL ++++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGAIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
              +RP GV   +   DE LG  ++ ++P+G + G+KA + G       T L+  FK++
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYFVGYKATATGPKQQEISTRLENSFKNN 190

>SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 248

 Score =  107 bits (266), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 99/182 (54%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I   + +V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGTNCVVVVSQKKVPDKLLDS 60

Query: 60  DTSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK 119
           +T +  ++K++ ++ +   G   DA      A+  A  +   Y  D+P +VL ++++++ 
Sbjct: 61  NTVS-YIFKVSPHVGMVANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRIANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
           Q YTQ   +RP GV   +   DE  G  ++  +P+G + G+KA + G       T L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEENGPSVYKCDPAGYFVGYKATATGPKQQELDTSLEKF 179

Query: 180 FK 181
           FK
Sbjct: 180 FK 181

>KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  106 bits (264), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 108/219 (49%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           +  +K+ K ++++ +++AGL  D  +L N  R         YN  + +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
             TQ  G RP+GV  + AGYD   G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERTL 176

Query: 181 KDDIKLEGA---IELALKTLSKTTDSSALTYDRVEFATI 216
           +D ++L+ A   I +A++ L +      L+   +  A +
Sbjct: 177 QDYLELDDADDLIRVAVEALRQCLKDEVLSTKNLSIAVV 215

>Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  105 bits (263), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 108/220 (49%), Gaps = 8/220 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           +  +K+ K ++++ +++AGL  DA +L N  R         +N  + +E     L D  Q
Sbjct: 58  SFQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAIERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDKS-GAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDIKLEG----AIELALKTLSKTTDSSALTYDRVEFATI 216
              IK++G     I+  ++ +S++    +LT D +  A +
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIV 216

>CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011c SCL1
          Length = 254

 Score =  105 bits (261), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 95/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  ++  V+  ++KV   LL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNLNSLAVRGKNCSVIINQKKVPDKLLDPSTVS- 71

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQ 124
            ++K++  I +   G   DA      A+  A  +   Y  D+P +VL ++++++ Q YTQ
Sbjct: 72  YIFKISKTIGMVANGPIPDARNAAARAKGEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFK 181
              +RP GV   +   DE LG  ++  +P+G Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFISVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTTSLENYYK 188

>ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 253

 Score =  105 bits (261), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 104/202 (51%), Gaps = 10/202 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I  ++  V+ +++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTSINSLAIRGKNCSVIISQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQ 124
            ++K++  I + + G   DA      A+     +   +  D+P +VL ++++++ Q YTQ
Sbjct: 71  YIFKISKTIGMVINGPIPDARNAALRAKAETAEFRYKFGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   Y   DE  G  ++ S+P+G + G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVIQTYVSVDEEQGPSIYKSDPAGYFVGYKATATGPKQQEITTRLENYIKKTP 190

Query: 178 -MEFKDDIKLEGAIELALKTLS 198
             ++  +   E  +E  + TL+
Sbjct: 191 SQDYMQEESWEKVVEFGITTLT 212

>Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {ON}
           YMR314W (PRE5) - alpha-type of subunit of 20S proteasome
           [contig 73] FULL
          Length = 233

 Score =  104 bits (260), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 107/221 (48%), Gaps = 7/221 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           +  +K+ K ++++ +++AGL  D  +L N  R         YN  + +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
             TQ  G RP+GV  + AGYD   G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERTL 176

Query: 181 KDDIKLEGAIEL---ALKTLSKTTDSSALTYDRVEFATIKK 218
            + +++E   EL   A++ L +      L+   +  A + K
Sbjct: 177 NEYLEIEDEDELIGVAVEALKQCLKDETLSTKNLSIAIVSK 217

>KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1
           YMR314W
          Length = 235

 Score =  103 bits (258), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 113/231 (48%), Gaps = 11/231 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAED-GIVLAAERKVTSTLLEQ 59
           M    YD  T  FSP GRL+Q+EYA+E+I      +G+ +++   V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQLEYAIEAIKQGSVTVGLRSKNYACVVALKRNAD----EL 56

Query: 60  DTSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK 119
            +  +K+ K +D++ +++AGL  DA +L N  R         +N D+ VE     LSD  
Sbjct: 57  SSYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSKLVFNRDLSVEKAGFLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQM- 178
           Q  TQ  G RP+GV  +  GYD + G  L    PSGN       ++GA +  ++T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLVVGYD-KTGPHLLEFQPSGNVMELYGTAIGARSQGSKTYLERV 175

Query: 179 --EFK--DDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVY 225
             EFK  +D   E  I++ ++ + ++     L  D +    + K     VY
Sbjct: 176 LDEFKELEDEDPESIIKVGVQAIQQSLKDEVLNTDNLSIGIVGKDLPFTVY 226

>ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  103 bits (258), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 111/223 (49%), Gaps = 9/223 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKLGSVTVGLRSNKHAVVVALKRNADDL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQ-TYNEDIPVEVLVRKLSDIK 119
           +  +K+ K ++++ +++AGL  DA +L N  R    NY Q  YN  + VE +   L D  
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNFLRQQC-NYSQLVYNRKLSVERVGHLLCDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
           Q  TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +  A+T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLVVGYDNS-GPHLLEFQPSGNVLELYGTAIGARSQGAKTYLEKT 175

Query: 180 FKDDIKLEGA---IELALKTLSKTTDSSALTYDRVEFATIKKG 219
            +  +++E     I+L ++ L ++     L+   +  A + +G
Sbjct: 176 LEQFLEVEDPNELIKLGVEALRQSLKDETLSTKNLSIAVVGEG 218

>NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON}
           Anc_5.1
          Length = 233

 Score =  103 bits (257), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 106/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           +  +K+ K ++++ +A+AGL  DA +L N  R         +N  + VE     L D  Q
Sbjct: 58  SFQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSDMVFNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGYDKS-GPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDIKLEGAIEL---ALKTLSKTTDSSALTYDRVEFATI 216
              +++E A EL    ++ L ++     L+ D +  A +
Sbjct: 177 DKFVEIEDAEELIKTGVEALKQSLKDETLSTDNLSIAIV 215

>Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON}
           complement(1850..2551) [702 nt, 234 aa]
          Length = 233

 Score =  103 bits (257), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 106/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VLAA ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNKYAVLAALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           +  +K+ K ++++ +++AGL  DA +L N  R         +N  + VE     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCHYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
             TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLLIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLEKVM 176

Query: 181 KDDIKLEGAIEL---ALKTLSKTTDSSALTYDRVEFATI 216
            + + LE   EL    ++ L ++     LT + +  A +
Sbjct: 177 DNFVDLEDPEELIKTCVEALRQSLKDETLTTENLSIAIV 215

>AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR314W (PRE5)
          Length = 306

 Score =  105 bits (261), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 112/222 (50%), Gaps = 9/222 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +   +VL A ++    L    
Sbjct: 74  MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSNKYVVLVALKRNADEL---S 130

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQ-TYNEDIPVEVLVRKLSDIK 119
           +  +K+ K +D++ +++AGL  DA +L N  R    NY Q  Y  D+ V    + LSD  
Sbjct: 131 SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQC-NYSQLVYARDLSVVKAGQLLSDKA 189

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
           Q  TQ  G RP+GV  + AGYD   G  L    PSGN       ++GA +  A+T L+  
Sbjct: 190 QKNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERV 248

Query: 180 FKDDIKLEGA---IELALKTLSKTTDSSALTYDRVEFATIKK 218
            ++ +++E A   I+  ++ L  +     L+   +  A + K
Sbjct: 249 MEEYLEIEDADALIKHGVEALKHSLKDETLSTKNLSIAIVGK 290

>TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON} 
          Length = 233

 Score =  103 bits (257), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 111/222 (50%), Gaps = 9/222 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +++  V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKNYAVITALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQ-TYNEDIPVEVLVRKLSDIK 119
           +  +K+ + ++++ +++AGL  DA +L N  R    NY Q  +N  + VE     LSD  
Sbjct: 58  SYQKKIIRCDEHLGLSLAGLAPDARVLSNYLRQQC-NYSQLVFNRKLSVEKAGHLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
           Q  TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +  A+T L+  
Sbjct: 117 QQNTQSYGGRPYGVGLLIIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERV 175

Query: 180 FKDDIKLEGAIEL---ALKTLSKTTDSSALTYDRVEFATIKK 218
               I++E   EL    ++ L ++     LT D +  A + K
Sbjct: 176 MDKYIEIEDPEELIKTCVEALRQSLKDETLTTDNLSIAIVGK 217

>NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1
          Length = 233

 Score =  102 bits (253), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 106/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKKHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           +  +K+ K ++++ +A+AGL  DA +L N  R         YN  + VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSSLIYNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
             TQ  G RP+GV  +  G+D   G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGHDNS-GPHLLEFQPSGNTVELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDIKLEGAIEL---ALKTLSKTTDSSALTYDRVEFATI 216
              I++E   EL    +++L ++     L+ + +  A +
Sbjct: 177 DQFIEIEDPEELIKTGVESLKQSLKDETLSTENLSIAIV 215

>KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  102 bits (253), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 96/193 (49%), Gaps = 6/193 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAED-GIVLAAERKVTSTLLEQ 59
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    +V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSTKYAVVVALKRNAD----EL 56

Query: 60  DTSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIK 119
            +  +K+ K +D++ V++AGL  DA +L N  R         YN  + +E     LSD  
Sbjct: 57  SSYQKKIIKCDDHLGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRKLALERAGYLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQME 179
           Q  TQ  G RP+GV  +  GYD   G  L    PSGN       ++GA +  A+T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLLIGYDNT-GAHLLEFQPSGNTLELYGTAIGARSQGAKTYLERV 175

Query: 180 FKDDIKLEGAIEL 192
             D  ++E A EL
Sbjct: 176 LDDFREIEDADEL 188

>KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  100 bits (248), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 97/179 (54%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMAEDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +  ++  V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGKNCAVVINQKKVPDKLLDPATLS- 70

Query: 65  KLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQ 124
            ++ ++ ++ +   G   DA      A+  A  +   Y  D+P + L ++++++ Q YTQ
Sbjct: 71  YIFPISRHVGMLANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDALAKRMANLAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
              +RP GV   +  +DE LG  ++ ++P+G + G+KA + G       T L+  FK +
Sbjct: 131 RAYMRPLGVILTFISFDEELGPSIYKTDPAGYFVGYKATATGPKQQEITTSLENYFKKN 189

>SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314W PRE5 20S proteasome alpha-type subunit
          Length = 233

 Score = 97.4 bits (241), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 114/241 (47%), Gaps = 11/241 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSKKHAVVVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           +   K+ K ++++ +++AGL  DA +L N  R         +N  + +E     L D  Q
Sbjct: 58  SYQNKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLSLEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
             TQ  G RP+GV  +  G+D   G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGHDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDIKLEGAIEL---ALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQL 237
           ++ +++E A EL    ++ L ++     L+   +  A +  GEN      IY  E +   
Sbjct: 177 EEYLEIEDADELIKKGVEALKQSLKDETLSTKNLSIAIV--GENKPF--TIYDGESVSPY 232

Query: 238 L 238
           L
Sbjct: 233 L 233

>TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5.1
           YMR314W
          Length = 233

 Score = 97.1 bits (240), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 94/192 (48%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60
           M    YD  +  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDSVTFSPTGRLFQVEYALEAIKQGSVTVGLRSHKYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120
           +  +K+ K + ++ +++AGL  DA +L N  R         ++  + VE     LSD  Q
Sbjct: 58  SYQKKIIKCDTHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFDRKLSVEKAGSLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180
             TQ  G RP+GV  +  GYD   G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLVIGYDNS-GSHLLEFQPSGNVLELYGSSIGARSQGAKTYLERVL 176

Query: 181 KDDIKLEGAIEL 192
            D ++++   EL
Sbjct: 177 DDFLEIDNVEEL 188

>TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON}
           Anc_5.1 YMR314W
          Length = 238

 Score = 90.5 bits (223), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 114/246 (46%), Gaps = 16/246 (6%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEY-----ALESISHAGTAIGIMAEDGIVLAAERKVTST 55
           M    YD  T  FSP GRL+QV+Y     ALE+I      +G+ ++   VL A ++    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVDYTKLYDALEAIKQGSVTVGLHSKKYAVLVALKRNADE 60

Query: 56  LLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKL 115
           L    +   K+ K ++++ +++AGL  DA +L N  R         +N  + VE     L
Sbjct: 61  L---SSYQRKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCNYSNLVFNRKLSVEKAGHLL 117

Query: 116 SDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTL 175
            D  Q  TQ  G RP+GV  +  G+D+  G  L    PSGN       ++GA +  A+T 
Sbjct: 118 CDKAQKNTQSYGGRPYGVGLLIIGHDKS-GAHLLEFQPSGNTLELYGSAIGARSQGAKTY 176

Query: 176 LQMEFKDDIKLEGAIEL---ALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPE 232
           L+      +++E   EL    ++ L ++     L+ + +  A +  GE+    Q  Y  E
Sbjct: 177 LERTLDTFLEIEDPNELIKQGVEALRQSLKDETLSNNNLSIAIV--GEDLPFTQ--YDNE 232

Query: 233 EIKQLL 238
            + Q L
Sbjct: 233 AVSQFL 238

>NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON}
           Anc_4.110
          Length = 172

 Score = 66.2 bits (160), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (57%)

Query: 102 YNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWK 161
           Y  D+P +VL ++++++ Q YTQ   +RP GV   +   DE LG  ++ S+P+G Y G+K
Sbjct: 28  YGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYK 87

Query: 162 AISVGANTSAAQTLLQMEFK 181
           A + G       T L+  FK
Sbjct: 88  ATATGPKQQEITTNLENYFK 107

>Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C
           (PRE10) - proteasome component YC1 (protease yscE
           subunit 1) [contig 44] FULL
          Length = 196

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 73/150 (48%), Gaps = 3/150 (2%)

Query: 83  DAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDE 142
           D   L+N AR  A ++ +TY   I +  L  +L    Q +T +  +RPFG++ I  G DE
Sbjct: 3   DGRHLVNRAREEAASFKKTYGTPITLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDE 62

Query: 143 RLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQ--MEFKDDIKLEGAIELALKTLSKT 200
             G  L+   PSG+Y G+K  + G    +A+  L+  +  K DI  + A++ A + +   
Sbjct: 63  N-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKILSSKPDISAKEAVKEAARVVYLA 121

Query: 201 TDSSALTYDRVEFATIKKGENNKVYQKIYK 230
            D +      +E +     E N +++ + K
Sbjct: 122 HDDNKEKEFELEMSWCSVSETNGLHKAVPK 151

>AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL041W (PRE7)
          Length = 243

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 79/171 (46%), Gaps = 8/171 (4%)

Query: 32  AGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           AGT +GI  ED  VLA + + T+          K++   DNI ++  G  AD + L+   
Sbjct: 31  AGTILGIAGEDFAVLAGDTRHTTGYSINSREEPKVFDCGDNILISANGFAADGDALVKRF 90

Query: 92  RVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTS 151
           +   + Y   +N+ + ++   R +  +  G      + P+ V  I AG DE     +++ 
Sbjct: 91  KNSMKWYRFDHNKKMTIKSAARSIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYSY 146

Query: 152 NPSGNYTGWKAISVGANTSAAQTLL--QMEFKDDIKLE--GAIELALKTLS 198
           +P G+Y   +  + GA  S     L  Q+ FK+  + +  G  + AL+ LS
Sbjct: 147 DPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSNGTKKRALRFLS 197

>NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 87/192 (45%), Gaps = 10/192 (5%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           +S E     +E+A    + + GT +GI  ED  +LA + + T+          K++   D
Sbjct: 8   YSSEVNSTPIEHAFNPYTDNGGTILGIAGEDFAILAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  NITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGG-LRP 130
           NI ++  G  AD E L+   +    N L+ Y+ D   + L  K +     +  +G    P
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSLKWYHFDHNDKKLSMKSAARNIQHLLYGKRFFP 123

Query: 131 FGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDDIK--L 186
           + V  I AG DE     +++ +P G+Y   +  + GA  S     L  Q+ FK+  +   
Sbjct: 124 YYVHTIIAGLDENGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQFEPGT 183

Query: 187 EGAIELALKTLS 198
           +G ++  LK LS
Sbjct: 184 DGKVKKPLKYLS 195

>NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON}
           Anc_5.507 YOR157C
          Length = 263

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 81/161 (50%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARV 93
           T +G+   DG+V+AA+ + T   +  D +  KL++++  I  A AG  AD E +  T  +
Sbjct: 32  TIVGLKYRDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 89

Query: 94  FAQNYLQT-YNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  LF+ +
Sbjct: 90  GSNIELHSLYTSRSP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELA 193
             G+      +S+G+ + AA  +L+ +++ ++  E AIELA
Sbjct: 145 AHGSTDVGYYLSLGSGSLAAMAVLESQWRPELSKEEAIELA 185

>NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 86/196 (43%), Gaps = 18/196 (9%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           +S E R   +E+     S + GT +GI  ED  VLA + + T+          K++   D
Sbjct: 8   YSSEVRNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  NITVAVAGLTADAEILINTARVFAQNYLQTYNED-----IPVEVLVRKLSDIKQGYTQHG 126
           NI ++  G  AD E L+   +    N L+ Y+ D     + +    R +  +  G     
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSLKWYHFDHNDKKLAMSSAARNIQHLLYGKR--- 120

Query: 127 GLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDDI 184
              P+ V  I AG DE     +++ +P G+Y   +  + GA  S     L  Q+ FK+  
Sbjct: 121 -FFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY 179

Query: 185 K--LEGAIELALKTLS 198
           +   +G ++  LK L+
Sbjct: 180 EPGTDGKVKRPLKYLT 195

>KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 83/192 (43%), Gaps = 17/192 (8%)

Query: 20  YQVEYALESISH--------AGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           Y  E A + I H         GT +GI  ED  VLA + + T+          K++   D
Sbjct: 8   YSNEVAQQPIEHRFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  NITVAVAGLTADAEILINTARVFAQNYLQTYNE-DIPVEVLVRKLSDIKQGYTQHGGLRP 130
           NI ++  G  AD E L+   +   + Y   +N+  + ++   R +  +  G        P
Sbjct: 68  NIVISANGFAADGEALVKRFKNSIKWYHFDHNDKKLSIKSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDDIKL-- 186
           + V  I AG DE     +++ +P G+Y   +  + GA  S     L  Q+ FK+  +   
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGS 183

Query: 187 EGAIELALKTLS 198
           +G ++  LK L+
Sbjct: 184 DGKVKRPLKYLN 195

>SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 104/228 (45%), Gaps = 18/228 (7%)

Query: 20  YQVEYALESISHA-------GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           YQ    L + SHA       GT I G+    G+V+AA+ + T   +  D + EKL++++ 
Sbjct: 9   YQRNQFLAAKSHAQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCEKLHRISP 68

Query: 72  NITVAVAGLTADAEILINTARVFAQNYLQT-YNEDIPVEVLVRKLSDIKQGYTQHGGLRP 130
            I  A AG  AD E +  T  + +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TQLIGSNIELHSLYTNREP--RVVSALQMLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAI 190
            G   I AG D   G  LF+ +  G+       S+G+ + AA  +L+  +K ++  E AI
Sbjct: 123 VGAYLIVAGVDPT-GAHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWKQNLSREEAI 181

Query: 191 ELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKP--EEIKQ 236
           ELA   +     +   +   V+   ++ G++ ++ +    P   E KQ
Sbjct: 182 ELASNAIEAGIWNDLGSGSNVDICVMEVGKDAELLRNYLTPNVREAKQ 229

>KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 81/161 (50%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARV 93
           T +G+   +G+V+AA+ + T   +  D +  KL++++  I  A AG  AD E +  T  +
Sbjct: 32  TIVGVKFHNGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAV--TQLI 89

Query: 94  FAQNYLQT-YNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSN 152
            +   L + Y +  P   +V  L  +KQ   ++ G    G   I AG D   G  LF+  
Sbjct: 90  GSNVELHSLYAKRQP--RVVTALQMLKQHLFKYQG--HIGAYLIVAGTDPT-GAHLFSVQ 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELA 193
             G+      +S+G+ + AA  +L+  +K+D+  E AI+LA
Sbjct: 145 AHGSTDVGFYLSLGSGSLAAMAVLESNWKEDLSKEEAIKLA 185

>YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}
           PUP1Beta 2 subunit of the 20S proteasome; endopeptidase
           with trypsin-like activity that cleaves after basic
           residues; synthesized as a proprotein before being
           proteolytically processed for assembly into 20S
           particle; human homolog is subunit Z
          Length = 261

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 80/161 (49%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARV 93
           T +G+   +G+V+AA+ + T   +  D +  KL++++  I  A AG  AD E +  T  +
Sbjct: 31  TIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  FAQNYLQT-YNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  LF+ +
Sbjct: 89  GSNIELHSLYTSREP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELA 193
             G+      +S+G+ + AA  +L+  +K D+  E AI+LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLA 184

>TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 84/172 (48%), Gaps = 9/172 (5%)

Query: 24  YALESISHAGTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTA 82
           YA    +  GT I G+  + G+V+AA+ + T   +  D +  KL+++   I  A AG  A
Sbjct: 20  YAQPKATSTGTTIVGVKFKGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAA 79

Query: 83  DAEILINTARVFAQNYLQT-YNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYD 141
           D E +  T  + +   L + Y E  P   +V  L  +KQ   ++ G    G   I AG D
Sbjct: 80  DTEAV--TQLIGSNIELHSLYTERAP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVD 133

Query: 142 ERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELA 193
              G  LF+ +  G+       ++G+ + AA  +L+ ++K D+  E AI+LA
Sbjct: 134 PT-GAHLFSIHAHGSTDVGYYHTLGSGSLAAMAVLESQWKQDLSKEDAIKLA 184

>Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 80/161 (49%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARV 93
           T +G+   DG+V+AA+ + T   +  D +  KL++++  I  A AG  AD E +  T  +
Sbjct: 31  TIVGVKYNDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  FAQNYLQT-YNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  LF+ +
Sbjct: 89  GSNIELHSLYTSREP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELA 193
             G+      +S+G+ + AA  +L+  +K D+  + A++LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAVKLA 184

>KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 86/186 (46%), Gaps = 22/186 (11%)

Query: 20  YQVEYALESISH--------AGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           YQ    L S SH          T +G+    G+V+AA+ + T   +  D +  KL++++ 
Sbjct: 9   YQRNSFLSSKSHKQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  NITVAVAGLTADAEILINTARVFAQNY----LQTYNEDIPVEVLVRKLSDIKQGYTQHGG 127
            I  A AG  AD E +    ++ + N     L T  E      +V  L  +KQ   ++ G
Sbjct: 69  RIWCAGAGTAADTEAV---TQLISSNIELHSLSTRRE----PRVVTTLQMLKQHLFRYQG 121

Query: 128 LRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLE 187
               G   I AG D   G  LF+ +  G+      +S+G+ + AA  +L+ +++ DI  +
Sbjct: 122 --HIGAYLIVAGVDP-TGAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESKWRADISKD 178

Query: 188 GAIELA 193
            AIELA
Sbjct: 179 EAIELA 184

>KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 240

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 69/153 (45%), Gaps = 9/153 (5%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +GI  ED  VLA + + T+          K+++  DNI ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFECEDNILISANGFAADGEALVKR 86

Query: 91  ARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFT 150
            +     Y   +N+ + ++   R +  +  G      + P+ V  I AG DE     +++
Sbjct: 87  FKNSQMWYHFNHNKKLTIKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYS 142

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQMEFKDD 183
            +P G+Y   +  + G+  S     L M F D+
Sbjct: 143 FDPVGSYEREQCRAGGSAAS-----LIMPFLDN 170

>Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 81/161 (50%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARV 93
           T +G+  ++G+V+AA+ + T   +  D +  KL++++  I  A AG  AD E +  T  +
Sbjct: 31  TIVGVKYKNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  FAQNYLQT-YNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  LF+ +
Sbjct: 89  GSNIELHSLYTSREP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELA 193
             G+      +S+G+ + AA  +L+  +K D+  + AI+LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLA 184

>Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON}
           (211095..211823) [729 nt, 243 aa]
          Length = 242

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 82/187 (43%), Gaps = 18/187 (9%)

Query: 22  VEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGL 80
           +E+     S + GT +GI  ED  VLA + + T+          K++   DNI ++  G 
Sbjct: 18  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIVISANGF 77

Query: 81  TADAEILINTARVFAQNYLQTYNED-----IPVEVLVRKLSDIKQGYTQHGGLRPFGVSF 135
            AD E L+   +    N ++ Y+ D     + +    R +  +  G        P+ V  
Sbjct: 78  AADGEALVKRFK----NSIKWYHFDNNDKTLSLSSAARNIQHLLYGKR----FFPYYVHT 129

Query: 136 IYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDDIKL--EGAIE 191
           I AG DE     +++ +P G+Y   +  + GA  S     L  Q+ FK+  +   +G ++
Sbjct: 130 IIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSDGTVK 189

Query: 192 LALKTLS 198
             LK LS
Sbjct: 190 RPLKFLS 196

>Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to
           Ashbya gossypii AAR119W
          Length = 258

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 96/205 (46%), Gaps = 8/205 (3%)

Query: 34  TAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARV 93
           T +G+  E+G+V+AA+ + T   +  + + EKL+K++  I  A AG  AD + +  T  +
Sbjct: 31  TIVGVKFENGVVIAADTRSTQGPIVANKNCEKLHKISSRIWCAGAGTAADTDAV--TGLI 88

Query: 94  FAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNP 153
            +   L +        V V  L  +KQ   ++ G    G   I AG D   G  LF+ + 
Sbjct: 89  GSNLELHSLFTGREPRV-VSALQKLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSVHA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTYDRVEF 213
            G+       S+G+ + AA  +L+  +K+ +  E AI+LA   +     +   +   V+ 
Sbjct: 145 HGSTDVGYYQSLGSGSLAAMAVLEANWKEHLTKEEAIKLAADAIEAGIWNDLGSGSNVDV 204

Query: 214 ATIKKGENNKVYQKIYKP--EEIKQ 236
             ++ G++ ++ +    P   E KQ
Sbjct: 205 CVMEVGKDAELLRNYITPNVREAKQ 229

>Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 80/161 (49%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARV 93
           T +G+   +G+V+AA+ + T   +  D +  KL++++  I  A AG  AD E +  T  +
Sbjct: 31  TIVGVKYNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  FAQNYLQT-YNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  LF+ +
Sbjct: 89  GSNIELHSLYTSREP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELA 193
             G+      +S+G+ + AA  +L+  +K D+  + AI+LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLA 184

>TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 85/183 (46%), Gaps = 16/183 (8%)

Query: 20  YQVEYALESISHA--------GTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           YQ    L S SHA         T +G+   +G+V+AA+ + T   +  D +  KL++++ 
Sbjct: 9   YQRNNFLASKSHAQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  NITVAVAGLTADAEILINTARVFAQNYLQT-YNEDIPVEVLVRKLSDIKQGYTQHGGLRP 130
            I  A AG  AD E +  T  + +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TQLISSNLELHSLYASREP--RVVSALQMLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAI 190
            G   I AG D   G  LF+ +  G+       S+G+ + AA  +L+  +K D+  E AI
Sbjct: 123 IGAYLIVAGVDP-TGAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKQDLTKEEAI 181

Query: 191 ELA 193
            LA
Sbjct: 182 NLA 184

>Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {ON}
           YOR157C (PUP1) - putative proteasome subunit [contig
           190] FULL
          Length = 263

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 94/205 (45%), Gaps = 11/205 (5%)

Query: 34  TAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARV 93
           T +G+    G+V+AA+ + T   +  + +  KL++++  I  A AG  AD E      ++
Sbjct: 31  TIVGVKYNGGVVIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTE---EVTKL 87

Query: 94  FAQN--YLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTS 151
              N      Y    P   +V  L  +KQ   ++ G    G   I AG D   G  LF+ 
Sbjct: 88  IGSNLELHSLYASRAP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSI 142

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTYDRV 211
           +  G+       S+G+ + AA  +L+  +K+DI  E A++LA   +     +   +   V
Sbjct: 143 HAHGSTDVGYYQSLGSGSLAAMAVLESHWKEDINREEAMQLASDAIEAGIWNDLGSGSNV 202

Query: 212 EFATIKKGENNKVYQKIYKPEEIKQ 236
           +   ++ G++ + Y + YK   +++
Sbjct: 203 DLCVMEVGKDAE-YLRNYKTPNVRE 226

>CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {ON}
           highly similar to uniprot|P25043 Saccharomyces
           cerevisiae YOR157c PUP1
          Length = 261

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 98/209 (46%), Gaps = 9/209 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARV 93
           T +G+    G+V+AA+ + T   +  D +  KL++++  I  A AG  AD E +  T  +
Sbjct: 31  TIVGVKFAGGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAV--TQLI 88

Query: 94  FAQNYLQT-YNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  LF+ +
Sbjct: 89  GSNIELHSLYTNRSP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTYDRVE 212
             G+       S+G+ + AA  +L+  +K D+  E AI+LA   +     +   +   V+
Sbjct: 144 AHGSTDVGYYQSLGSGSLAAMAVLESHWKPDMTKEEAIQLAADAIEAGIWNDLGSGSNVD 203

Query: 213 FATIKKGENNKVYQKIYKPEEIKQLLSKA 241
              ++ G++ + Y + Y+   +++   K+
Sbjct: 204 VCVMEIGKDAE-YLRNYRTPNVREAKQKS 231

>TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 73/177 (41%), Gaps = 15/177 (8%)

Query: 20  YQVEYALESISH--------AGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           Y  E A   I H         GT +GI  ED  VLA + + T+          K++   D
Sbjct: 8   YSNEVAHTPIQHQFNPYTDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRHESKVFDCGD 67

Query: 72  NITVAVAGLTADAEILINTARVFAQNYLQTYNE-DIPVEVLVRKLSDIKQGYTQHGGLRP 130
           NI ++  G  AD E L+   +   + Y   +N+  + +    R +  +  G        P
Sbjct: 68  NIVMSANGFAADGEALVKRFKNSVKWYHFDHNDKKLSLSSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDDIK 185
           + V  I AG DE     +++ +P G+Y   +  + GA  S     L  Q+ FK+  +
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQFE 180

>SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 261

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 76/174 (43%), Gaps = 8/174 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           +S E +   +E+     S + GT +GI  ED  VLA + + T+          K++   D
Sbjct: 28  YSNETKNVPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 87

Query: 72  NITVAVAGLTADAEILINTARVFAQNYLQTYNE-DIPVEVLVRKLSDIKQGYTQHGGLRP 130
           NI ++  G  AD E L+   +   + Y   +N+  + +    R +  +  G        P
Sbjct: 88  NILISANGFAADGEALVKRFQNSLKWYHFNHNDRKLSLSSAARNIQHLLYGKR----FFP 143

Query: 131 FGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKD 182
           + V  I AG DE     +++ +P G+Y   +  + GA  S     L  Q+ FK+
Sbjct: 144 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 197

>ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa]
           {ON} highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 244

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 74/173 (42%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +GI  ED  VLA + + T+          K++   DNI +   G  AD E L+  
Sbjct: 30  NGGTVLGIAGEDFAVLAGDTRHTTDYSINSRYESKVFDCGDNIVITANGYAADGEALVKR 89

Query: 91  ARVFAQNYLQTYNE-DIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLF 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG DE     ++
Sbjct: 90  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVQTIIAGLDEEGKGAVY 145

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDDIKLE--GAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  Q+ F +    E  G ++  LK LS
Sbjct: 146 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFHNQYVPESNGRVKRPLKFLS 198

>KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON}
           Anc_7.480 YBL041W
          Length = 248

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 92/231 (39%), Gaps = 21/231 (9%)

Query: 15  PEGRLYQVEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNI 73
           P      +E+     S + GT +GI  ED  VLA + + T+       S  K++ + D I
Sbjct: 19  PSAMSQPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRSESKVFDVGDGI 78

Query: 74  TVAVAGLTADAEILINTARVFAQNYLQTYNED-IPVEVLVRKLSDIKQGYTQHGGLRPFG 132
            ++  G  AD+  L+   R   + Y    NE  + +    R +  +  G        P+ 
Sbjct: 79  VISANGFAADSTALVKRFRNSLKWYHFNENEKRLSLSAAARNIQHLLYGKR----FFPYY 134

Query: 133 VSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDD------- 183
           V  I AG DE     +++ +P G+Y   +  + GA  S     L  Q+ FK+        
Sbjct: 135 VHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPGTGE 194

Query: 184 ------IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKI 228
                 + +E  ++L   + +  T+      D +E   + K    + Y ++
Sbjct: 195 KRPITYLSVEEVVKLVRDSFTSATERHIHVGDGLEILIVTKDGVRREYHEL 245

>TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 77/173 (44%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +GI  ED  VLA + +  +          K++   DNI ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRFEPKVFDCGDNIVISANGFAADGEALVQR 86

Query: 91  ARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGG-LRPFGVSFIYAGYDERLGYQLF 149
            +    N ++ Y+ D   + L  K +     +  +G    P+ V  I AG DE     ++
Sbjct: 87  FK----NSIKWYHFDHNDKKLTMKSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDDIKLE--GAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  Q+ FK+    E  G ++  LK L+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPESNGKVKRPLKYLT 195

>CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041w PRE7
          Length = 242

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 75/172 (43%), Gaps = 9/172 (5%)

Query: 32  AGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
            GT +GI  ED  VLA + + T+          K++   DNI ++  G  AD E L+   
Sbjct: 29  GGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIIMSANGFAADGEALVKRF 88

Query: 92  RVFAQNYLQTYNE-DIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFT 150
           +   + Y   +N+  + +    R +  +  G        P+ V  I AG D+     +++
Sbjct: 89  KNSIKWYHFDHNDKKLSISSAARNIQHLLYGKR----FFPYYVHTIIAGLDDEGKGAVYS 144

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDDI--KLEGAIELALKTLS 198
            +P G+Y   +  + GA  S     L  Q+ FK+      +G ++  LK LS
Sbjct: 145 FDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPGTDGKVKRELKYLS 196

>KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 242

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 90/229 (39%), Gaps = 31/229 (13%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           +S E +   +E+     S + GT +GI  ED  VLA + + T+          K++   D
Sbjct: 9   YSNEVKNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 68

Query: 72  NITVAVAGLTADAEILINTARVFAQNYLQTYNED-----IPVEVLVRKLSDIKQGYTQHG 126
           NI ++  G  AD   L+       QN L+ Y+ D     + +    R +  +  G     
Sbjct: 69  NILISANGFAADGNALVKR----FQNSLKWYHFDHNDKKLSMRSAARNIQHLLYGKR--- 121

Query: 127 GLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDD- 183
              P+ V  I AG DE     +++ +P G+Y   +  + GA  S     L  Q+ FK+  
Sbjct: 122 -FFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQY 180

Query: 184 --------------IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKK 218
                         + +E  ++L     S  T+      D VE   + K
Sbjct: 181 EPDSHGTKRKHVKFLTVEEVVQLVRDAFSSATERHIHVGDGVEILIVTK 229

>Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON}
           complement(238..1023) [786 nt, 262 aa]
          Length = 261

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 79/161 (49%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARV 93
           T +G+  + G+V+AA+ + T   +  D +  KL+++   I  A AG  AD E +  T  +
Sbjct: 31  TIVGVKFDGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAV--TQLI 88

Query: 94  FAQNYLQT-YNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSN 152
            +   L + Y+   P   +V  L  +KQ   ++ G    G   I AG D   G  LF+ +
Sbjct: 89  GSNIELHSLYSNREP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELA 193
             G+       S+G+ + AA  +L+  +K D+  E AI+LA
Sbjct: 144 AHGSTDVGYYHSLGSGSLAAMAVLESNWKQDLTKEEAIKLA 184

>NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507
          Length = 264

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 91/188 (48%), Gaps = 17/188 (9%)

Query: 20  YQVEYALESISHA--------GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLN 70
           YQ   AL + SH+        GT I G+   +G+++AA+ + T   +  + +  KL++++
Sbjct: 9   YQRNAALAAKSHSQQPKATSTGTTIVGVKYANGVIIAADTRSTQGPIVANKNCAKLHRIS 68

Query: 71  DNITVAVAGLTADAEILINTARVFAQNYLQT-YNEDIPVEVLVRKLSDIKQGYTQHGGLR 129
             I  A AG  AD E +  T  + +   L + Y    P   +V  L  +KQ   ++ G  
Sbjct: 69  PRIWCAGAGTAADTEAV--TQLIGSNIELHSLYTSREP--RVVSALQMLKQHLFKYQG-- 122

Query: 130 PFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGA 189
             G   I AG D   G  LF+ +  G+      +S+G+ + AA  +L+  ++ ++  E A
Sbjct: 123 HIGAYLIVAGTDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWEPEMSKEAA 181

Query: 190 IELALKTL 197
           +ELA + +
Sbjct: 182 VELASQAI 189

>Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W
           (PRE7) - proteasome subunit [contig 159] FULL
          Length = 242

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 87/216 (40%), Gaps = 23/216 (10%)

Query: 22  VEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGL 80
           +E+     S + GT +GI  ED  VLA + + T+          K++   DNI ++  G 
Sbjct: 18  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNILISANGF 77

Query: 81  TADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGG-LRPFGVSFIYAG 139
            AD   L+       QN L+ Y+ D   + L  K +     +  +G    P+ V  I AG
Sbjct: 78  AADGTALVKR----FQNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKRFFPYYVHTIIAG 133

Query: 140 YDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDD-------------- 183
            DE     +++ +P G+Y   +  + GA  S     L  Q+ FK+               
Sbjct: 134 LDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSKGTKRKELK 193

Query: 184 -IKLEGAIELALKTLSKTTDSSALTYDRVEFATIKK 218
            + +E  ++L     S  T+      D VE   + K
Sbjct: 194 FLSVEEVVQLVRDAFSSATERHIHVGDGVEILIVTK 229

>ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 75/160 (46%), Gaps = 6/160 (3%)

Query: 34  TAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARV 93
           T +G+  + G+V+AA+ + T   +  D +  KL+++   I  A AG  AD E +      
Sbjct: 31  TIVGVKYDKGVVIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAVTQLIGS 90

Query: 94  FAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNP 153
             + + Q  N +  V   V  L  +KQ   ++ G    G   I AG D   G  LF+   
Sbjct: 91  NLELHSQYANREPRV---VSALQMLKQHLFRYQG--HIGAYLIVAGVDP-TGAHLFSVQA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELA 193
            G+      +S+G+ + AA   L+  +K ++  + A++LA
Sbjct: 145 HGSTDVGHYLSLGSGSLAAMATLESNWKQNLTKDEAVKLA 184

>Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON}
           similar to Ashbya gossypii AGL324W
          Length = 242

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 84/208 (40%), Gaps = 28/208 (13%)

Query: 32  AGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
            GT +GI  ED  V+A + + T+       +  K++   DNI ++  G  AD + L+   
Sbjct: 29  GGTILGIAGEDFAVIAGDTRHTTGYSINSRNEPKVFDCGDNILISANGFAADGDALV--- 85

Query: 92  RVFAQN----YLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQ 147
           + F  N    +    N+ + ++   R +  +  G      + P+ V  I AG DE     
Sbjct: 86  KKFKNNLKWYHFDHNNKKMTLKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEDGKGA 141

Query: 148 LFTSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDD---------------IKLEGAI 190
           +++ +P G+Y   +  + GA  S     L  Q+ FK+                + L+  I
Sbjct: 142 VYSFDPVGSYEREQCRAGGAAASIIMPFLDNQVNFKNQYEPDSKGTKPKSIRFLSLDEVI 201

Query: 191 ELALKTLSKTTDSSALTYDRVEFATIKK 218
           EL     +  T+      D ++   I K
Sbjct: 202 ELVRDAFTSATERHIHVGDSLQIMIITK 229

>KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {ON}
           highly similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 262

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 91/199 (45%), Gaps = 8/199 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARV 93
           T +G+    G+++AA+ + T   +  D + EKL+++   I  A AG  AD E +  T  +
Sbjct: 32  TIVGVKFNGGVIIAADTRSTQGPIVADKNCEKLHRIAPRIWCAGAGTAADTEAV--TQLI 89

Query: 94  FAQNYLQT-YNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  LF+ +
Sbjct: 90  SSNIELHSLYTGREP--RVVSSLQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTYDRVE 212
             G+       S+G+ + AA  +L+  +  D+  E AI+LA   +     +   +   V+
Sbjct: 145 AHGSTDVGYYQSLGSGSLAAMAVLEANWNQDLSKEEAIKLASDAIEAGIWNDLGSGSNVD 204

Query: 213 FATIKKGENNKVYQKIYKP 231
              ++ G++ ++ +    P
Sbjct: 205 VCVMEVGKDAQLLRNYLCP 223

>TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON}
           Anc_5.507 YOR157C
          Length = 259

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 74/161 (45%), Gaps = 8/161 (4%)

Query: 34  TAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILIN-TAR 92
           T +G+   +G+++AA+ + T   +  D +  KL+++   I  A AG  AD E +      
Sbjct: 31  TIVGVKFNNGVIIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAVTQLVGS 90

Query: 93  VFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSN 152
               + L T+ E      +V  L  +KQ   ++ G    G   I AG D   G  LF   
Sbjct: 91  NLELHSLYTHRE----PRVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GPHLFAVQ 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELA 193
             G+       S+G+ + AA  +L+  +K D+  E A++LA
Sbjct: 144 AHGSTDVGFYHSLGSGSLAAMAVLETNWKQDLTKEEAMKLA 184

>Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 76/173 (43%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +GI  ED  VLA + +  +          K++   DN+ ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNLVMSANGFAADGDALVKR 86

Query: 91  ARVFAQNYLQTYNE-DIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLF 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG DE     ++
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDDIK--LEGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  Q+ FK+  +   +G ++  LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTDGKVKKPLKYLS 195

>YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6
           subunit of the 20S proteasome
          Length = 241

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 75/173 (43%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +GI  ED  VLA + +  +          K++   DNI ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARVFAQNYLQTYNE-DIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLF 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG DE     ++
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDDIK--LEGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  Q+ FK+  +    G ++  LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLS 195

>Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 75/173 (43%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +GI  ED  VLA + +  +          K++   DNI ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARVFAQNYLQTYNE-DIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLF 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG DE     ++
Sbjct: 87  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDDIK--LEGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  Q+ FK+  +    G ++  LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLS 195

>KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 263

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 101/211 (47%), Gaps = 9/211 (4%)

Query: 27  ESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEI 86
           ++ S   T +G+  + G+++AA+ + T   +  + +  KL++++  I  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYDGGVLIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTE- 82

Query: 87  LINTARVFAQNYLQTYNEDIPVEV-LVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLG 145
                ++   N L+ ++     E  +V  L  +KQ   ++ G    G   I AG D   G
Sbjct: 83  --EVTKLIGSN-LELHSMYASREPRVVSALQMLKQHLFKYQG--HIGAYLIVAGADP-TG 136

Query: 146 YQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSA 205
             LF+ +  G+       S+G+ + AA  +L+  ++ D+K E A++LA   +     +  
Sbjct: 137 THLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWRPDLKKEEAMQLASDAIEAGIWNDL 196

Query: 206 LTYDRVEFATIKKGENNKVYQKIYKPEEIKQ 236
            +   V+   ++ G++ + Y + Y+   +++
Sbjct: 197 GSGSNVDLCIMETGKDAE-YLRNYRTPNVRE 226

>Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 75/173 (43%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINT 90
           + GT +GI  ED  VLA + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDKIVMSANGFAADGDALVKR 86

Query: 91  ARVFAQNYLQTYNE-DIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLF 149
            +   + Y   +N+  + +    R +  +  G        P+ V  I AG DE     ++
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDDIK--LEGAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  Q+ FK+  +   +G ++  LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTDGKVKKPLKYLS 195

>TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 79/187 (42%), Gaps = 18/187 (9%)

Query: 22  VEYALESIS-HAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGL 80
           +E+     S + GT +GI  ED  VLA + + T+          K++   D+I ++  G 
Sbjct: 17  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDDIIISANGF 76

Query: 81  TADAEILINTARVFAQNYLQTYNED-----IPVEVLVRKLSDIKQGYTQHGGLRPFGVSF 135
            AD E L+   +    N ++ Y+ D     + +    R +  +  G        P+ V  
Sbjct: 77  AADGEALVKRFK----NSIKWYHFDNNDKKLALSSAARNIQHLLYGKR----FFPYYVHT 128

Query: 136 IYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLL--QMEFKDDIKLE--GAIE 191
           I AG DE     +++ +P G+Y      + GA  S     L  Q+ FK+    +  G ++
Sbjct: 129 IIAGLDEEGKGAVYSFDPVGSYEREFCRAGGAAASLIMPFLDNQVNFKNQYTPDSNGKVK 188

Query: 192 LALKTLS 198
              K LS
Sbjct: 189 RPFKHLS 195

>AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR157C (PUP1)
          Length = 259

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 81/174 (46%), Gaps = 16/174 (9%)

Query: 20  YQVEYALESISH--------AGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLND 71
           YQ    L S SH          T +G+  E G+V+AA+ + T   +  + + EKL+++  
Sbjct: 9   YQRNQHLASTSHKQPRATSTGTTIVGVKFEGGVVIAADTRSTQGPIVANKNCEKLHRIAP 68

Query: 72  NITVAVAGLTADAEILINTARVFAQNYLQT-YNEDIPVEVLVRKLSDIKQGYTQHGGLRP 130
            I  A AG  AD E +  T  + +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TWLIGSNLELHSLYTGREP--RVVSALQKLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDI 184
            G   I AG D   G  LF+ +  G+    +  S+G+ + AA  +L+ ++++ +
Sbjct: 123 IGAYLIVAGVDP-TGAHLFSVHAHGSTDVGQYQSLGSGSLAAMAVLEAQWREGM 175

>Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON}
           (145742..146389) [648 nt, 216 aa]
          Length = 215

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 86/209 (41%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVFAQNYLQTYNE---DIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
           +   + Y   Y E   ++   +      + K   T            I AGYDE    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTY 208
           ++    G+         G+ ++         FK+D+  E  IE    +LS+       + 
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSAFIYGYCDKNFKEDMTKEETIEFMKHSLSQAIKWDGSSG 189

Query: 209 DRVEFATIKKGENNKVYQKIYKPEEIKQL 237
             +    + K    ++   I+ P+E ++L
Sbjct: 190 GVIRMVVLTKDGAERL---IFYPDEYEKL 215

>Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON}
           (258951..259598) [648 nt, 216 aa]
          Length = 215

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 86/209 (41%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVFAQNYLQTYNE---DIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
           +   + Y   Y E   ++   +      + K   T            I AGYDE    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTY 208
           ++    G+         G+ ++         FK+D+  E  IE    +LS+       + 
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSTFIYGYCDKNFKEDMTKEETIEFMKHSLSQAIKWDGSSG 189

Query: 209 DRVEFATIKKGENNKVYQKIYKPEEIKQL 237
             +    + K    ++   I+ P+E ++L
Sbjct: 190 GVIRMVVLTKDGAERL---IFYPDEYEKL 215

>KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590)
           [648 bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 74/169 (43%), Gaps = 9/169 (5%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL K++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTS 151
           +   + Y   Y E    +V       +      H          I AGYDE+   +++ S
Sbjct: 79  QYHLELYTSQYGEP-TTKVAASIFKTLCYENKDH-----LTAGIIVAGYDEKNKGEVY-S 131

Query: 152 NPSGNYTGWKAISVGANTSA-AQTLLQMEFKDDIKLEGAIELALKTLSK 199
            P G     ++ S+  + SA         +K+D+  E  IE    +LS+
Sbjct: 132 IPLGGSVHKQSYSIAGSGSAFIYGYCDKNYKEDMTKEETIEFVKHSLSQ 180

>AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR103W
           (PRE2)
          Length = 285

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 82/200 (41%), Gaps = 10/200 (5%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYW- 128

Query: 89  NTARVFAQNYLQTYNED--IPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGY 146
               + AQ  L    E   I V    + LS++   Y   G      +  +  GY ++ G 
Sbjct: 129 -ETWLGAQCRLHELKEKERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKEGP 183

Query: 147 QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSAL 206
            ++  +  G         VG+  + A  +L   ++ D+ +E A+ L  +++       A 
Sbjct: 184 TIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYRWDLSVEDALYLGKRSILAAAHRDAY 243

Query: 207 TYDRVEFATIKKGENNKVYQ 226
           +   V  + +   EN  VY 
Sbjct: 244 SGGSVNLSHVT--ENGWVYH 261

>AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 aa]
           {ON} syntenic homolog of Saccharomyces cerevisiae
           YJL001W (PRE3); 1-intron
          Length = 215

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 70/168 (41%), Gaps = 7/168 (4%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVKFRDGVILGADSRTTTGTYIANRVTDKLTRVHDRIWCCRSGSAADTQAVADMV 78

Query: 92  RVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTS 151
           + + + Y   Y E           S I      H          I AGYD++   ++++ 
Sbjct: 79  QHYLELYTMQYGEP-SASTAASLFSTICYENKDH-----LTAGIIVAGYDDKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSK 199
              G+         G+ ++         F++D+  E  I+    +LS+
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKHFREDMSKEETIDFMKHSLSQ 180

>ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 45/208 (21%), Positives = 86/208 (41%), Gaps = 14/208 (6%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T      +  T+KL +++D +    +G  AD + + +  
Sbjct: 19  GTSIMAVSFKDGVILGADSRTTMGPYVANRVTDKLTRVHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RVFAQNYLQTYNEDIPVEVLVRKLSDIKQ--GYTQHGGLRPFGVSFIYAGYDERLGYQLF 149
           + +   Y   Y E  P     R  + I Q   Y     L       I AGYDE+   +++
Sbjct: 79  QYYLDLYTAQYGE--PS---TRTAAAIFQQLCYENKDALTA---GIIVAGYDEKNQGEVY 130

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTYD 209
           +    G+    K    G+ ++         +KD +  +  ++    +LS+       +  
Sbjct: 131 SIPIGGSLHKQKYAIAGSGSTFIYGYCDKNYKDGMTKDETVDFIKHSLSQAIKWDGSSGG 190

Query: 210 RVEFATIKKGENNKVYQKIYKPEEIKQL 237
            +    + K   N V + I  PEE + L
Sbjct: 191 VIRMVVLTK---NGVERLIVYPEEFENL 215

>TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 37.4 bits (85), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 44/208 (21%), Positives = 86/208 (41%), Gaps = 10/208 (4%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTMAGGAADCQYW- 130

Query: 89  NTARVFAQNYLQTYNED--IPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGY 146
               + AQ  L    E   I V    + LS++   Y   G      +  +  GY ++ G 
Sbjct: 131 -ETWLGAQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSAL 206
            ++  +  G         VG+  + A  +L   +K ++ +E A+EL  +++   T   A 
Sbjct: 186 TVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDANYKWELGVEEALELGKRSILAATHRDAY 245

Query: 207 TYDRVEFATIKKGENNKVYQKIYKPEEI 234
           +   V    +   E+  VY   +   E+
Sbjct: 246 SGGSVNLYHVT--EDGWVYHGNHDINEL 271

>KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 36/177 (20%), Positives = 73/177 (41%), Gaps = 4/177 (2%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 89  NTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY ++ G  +
Sbjct: 132 TWLGTQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSA 205
           +  +  G         VG+  + A  +L   +K D+ +E A+ L  +++   T   A
Sbjct: 188 YYVDSDGTRLKGDMFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSILAATHRDA 244

>CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P38624 Saccharomyces
           cerevisiae YJL001w PRE3
          Length = 215

 Score = 36.2 bits (82), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 42/206 (20%), Positives = 86/206 (41%), Gaps = 10/206 (4%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL +++DNI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDNIWCCRSGSAADTQAVAD-- 76

Query: 92  RVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTS 151
               Q YL  Y             +  K    Q+      G+  I AGYDE+   ++++ 
Sbjct: 77  --IVQYYLDMYEGQFGEPDTYTAANMFKTLCYQNKDALTAGI--IVAGYDEKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTYDRV 211
              G+         G+ ++         F++++  +  I+    +LS+       +   +
Sbjct: 133 PLGGSIHKQPYAIAGSGSTFIYGYCDKNFRENMSKDETIDFIKHSLSQAIKWDGSSGGVI 192

Query: 212 EFATIKKGENNKVYQKIYKPEEIKQL 237
               + K    ++   I+ PEE + L
Sbjct: 193 RMVVLTKDGPERL---IFYPEEYENL 215

>TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON}
           Anc_3.417 YPR103W
          Length = 287

 Score = 36.2 bits (82), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 39/198 (19%), Positives = 80/198 (40%), Gaps = 6/198 (3%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY ++ G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTY 208
           +  +  G         VG+  + A  +L   +K D+ +E A+ L  +++   T   A + 
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSILAATHRDAYSG 247

Query: 209 DRVEFATIKKGENNKVYQ 226
             +    +   EN  +Y 
Sbjct: 248 GSINLYHVT--ENGWIYH 263

>KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 35.8 bits (81), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 35/179 (19%), Positives = 73/179 (40%), Gaps = 4/179 (2%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
                  + Y     + I V    + L+++   Y   G      +  +  GY ++ G  +
Sbjct: 132 TWLGSQCRLYELKEKQRITVAAASKILANLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALT 207
           +  +  G         VG+  + A  +L   +K D+ +E A+ L  + +   T   A +
Sbjct: 188 YYVDSDGTRLKGDVFCVGSGQTFAYGVLDTNYKWDLSVEDALYLGKRAILAATHRDAYS 246

>TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 bp,
           219 aa] {ON} Anc_5.216 YJL001W
          Length = 219

 Score = 35.4 bits (80), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 87/207 (42%), Gaps = 17/207 (8%)

Query: 35  AIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARVF 94
           ++ +  +DG++L A+ + T+     +  T+KL ++++ I    +G  AD + + +  +  
Sbjct: 26  SMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHEKIWCCRSGSAADTQAIADIVQYH 85

Query: 95  AQNYLQTYNEDI--PVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSN 152
              Y   Y E        + ++L      Y     L       I AGYDE+   ++++  
Sbjct: 86  LDLYTAQYGEPSTKTAAAVFKELC-----YENKDNLTA---GIIVAGYDEKNKGEVYSIP 137

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTT--DSSALTYDR 210
             G+    K    G+ ++         FKDD+  +  +     +LS+    D S+    R
Sbjct: 138 LGGSMHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVNFMKNSLSQAIKWDGSSGGVIR 197

Query: 211 VEFATIKKGENNKVYQKIYKPEEIKQL 237
           +   T +  E     + I+ PE+ ++L
Sbjct: 198 MVVLTKEGAE-----RLIFYPEDYEKL 219

>Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 35.8 bits (81), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 70/169 (41%), Gaps = 4/169 (2%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTL 197
           +  +  G         VG+  + A  +L   +K D+ +E A+ L  +++
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSIEDALYLGKRSI 236

>Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 35.4 bits (80), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 35/179 (19%), Positives = 73/179 (40%), Gaps = 4/179 (2%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 89  NTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY ++ G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALT 207
           +  +  G         VG+  + A  +L   +K D+ +E A+ L  +++       A +
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAFS 246

>Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 35.4 bits (80), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 71/169 (42%), Gaps = 4/169 (2%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY ++ G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTL 197
           +  +  G         VG+  + A  +L   +K D+ +E A+ L  +++
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSI 236

>ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 40/200 (20%), Positives = 82/200 (41%), Gaps = 10/200 (5%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + ++       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRASAGSWVASQTVKKVIEINPFLLGTMAGGAADCQYW- 130

Query: 89  NTARVFAQNYLQTYNED--IPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGY 146
               + AQ  L    E   I V    + L ++   Y  +G      +  +  GY ++ G 
Sbjct: 131 -ETWLGAQCRLHELKEKERISVAAASKILCNLVYEYKGYG----LSMGTMICGYTKKEGP 185

Query: 147 QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSAL 206
            ++  +  G         VG+  + A  +L   +K D+ +E A+ L  +++   T   A 
Sbjct: 186 TVYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSIIAATHRDAY 245

Query: 207 TYDRVEFATIKKGENNKVYQ 226
           +   V    +   EN  V+ 
Sbjct: 246 SGGSVNLYHVT--ENGWVFH 263

>NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 42/211 (19%), Positives = 85/211 (40%), Gaps = 11/211 (5%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY ++ G  +
Sbjct: 132 TWLGSQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALT- 207
           +  +  G         VG+  + A  +L   +K D+ +E A+ L  +++       A + 
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDTNYKWDLTVEDALYLGKRSILAAAHRDAYSG 247

Query: 208 -----YDRVEFATIKKGENNKVYQKIYKPEE 233
                Y   E   I  G N+ V Q  ++ +E
Sbjct: 248 GSINLYHVTESGWIYHG-NHDVGQTFWEIKE 277

>Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL001W
           (PRE3) - Subunit of 20S proteasome [contig 94] FULL
          Length = 193

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/202 (18%), Positives = 84/202 (41%), Gaps = 9/202 (4%)

Query: 36  IGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTARVFA 95
           + +  +DG++L A+ + T+     +  T+KL +++D +    +G  AD + + +      
Sbjct: 1   MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKVWCCRSGSAADTQAVAD----IV 56

Query: 96  QNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSG 155
           Q+YL+ Y             S  K    ++      G+  I AG+D++   ++++    G
Sbjct: 57  QHYLELYTAQFGEPSTKTAASIFKTLCYENKDNLTAGI--IVAGFDDKNKGEVYSIPLGG 114

Query: 156 NYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTYDRVEFAT 215
           +    K    G+ ++         FK+D+  +  I     +LS+       +   +    
Sbjct: 115 SVHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETISFMKNSLSQAIKWDGSSGGVIRMVV 174

Query: 216 IKKGENNKVYQKIYKPEEIKQL 237
           + K    ++   I+ PEE + L
Sbjct: 175 LTKEGAERL---IFYPEEYENL 193

>YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5
           subunit of the 20S proteasome, responsible for the
           chymotryptic activity of the proteasome
          Length = 287

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/169 (19%), Positives = 70/169 (41%), Gaps = 4/169 (2%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTL 197
           +  +  G         VG+  + A  +L   +K D+ +E A+ L  +++
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSI 236

>Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 aa]
           {ON} YJL001W (REAL)
          Length = 216

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 42/211 (19%), Positives = 87/211 (41%), Gaps = 20/211 (9%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVFAQNYLQTY---NEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
           +   + Y   Y   + +    V      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTY 208
           +T    G+         G+ ++         F+D++  E  +     +LS+     A+ +
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRDNMSKEETVNFIKHSLSQ-----AIKW 184

Query: 209 DRVEFATIKKG--ENNKVYQKIYKPEEIKQL 237
           D      I+        V + ++ P+E +QL
Sbjct: 185 DGSSGGVIRMVVLTAAGVERLVFYPDEYEQL 215

>Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp,
           215 aa] {ON} similar to Ashbya gossypii AAL172C 1-intron
          Length = 215

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 83/206 (40%), Gaps = 10/206 (4%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTYKDGVILGADSRTTTGTYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQLFTS 151
           +     Y   Y E   V       S I   Y     L       I AGYD++   +++T 
Sbjct: 79  QHHLDLYAAQYGEP-SVNTAASLFSTI--CYENKDFLT---AGIIVAGYDDKNKGEVYTI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTYDRV 211
              G+         G+ ++         FK+++  E  I     +LS+       +   +
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKNFKENMSKEETIRFMKHSLSQAIKWDGSSGGVI 192

Query: 212 EFATIKKGENNKVYQKIYKPEEIKQL 237
               + K     V + I+ PE+ + L
Sbjct: 193 RMVVLTK---EGVERLIFYPEDYESL 215

>Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar to
           Ashbya gossypii AEL326C
          Length = 285

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 81/203 (39%), Gaps = 10/203 (4%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYW- 128

Query: 89  NTARVFAQNYLQTYNED--IPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGY 146
               + AQ  L    E   I V    + L ++   Y   G      +  +  GY ++ G 
Sbjct: 129 -ETWLGAQCRLHELKEKERISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKEGP 183

Query: 147 QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSAL 206
            ++  +  G         VG+  + A  +L   +K D+ +E A+ L  +++       A 
Sbjct: 184 TIYYVDSDGMRLKGDLFCVGSGQTFAYGVLDTNYKWDLTVEEALYLGKRSILAAAHRDAY 243

Query: 207 TYDRVEFATIKKGENNKVYQKIY 229
           +   V    +   EN  V+   Y
Sbjct: 244 SGGSVNLYHVT--ENGWVFHGNY 264

>Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON}
           YPR103W (PRE2) - proteasome subunit [contig 47] FULL
          Length = 287

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/169 (19%), Positives = 70/169 (41%), Gaps = 4/169 (2%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           ++H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  LAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGTQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTL 197
           +  +  G         VG+  + A  +L   +K D+ +E A+ L  +++
Sbjct: 188 YYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYKWDLTVEEALYLGKRSI 236

>YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {ON}
            PRE3Beta 1 subunit of the 20S proteasome, responsible
           for cleavage after acidic residues in peptides
          Length = 215

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 42/211 (19%), Positives = 88/211 (41%), Gaps = 20/211 (9%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVFAQNYLQTY---NEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
           +   + Y   Y   + +    V      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTY 208
           +T    G+         G+ ++         F++++  E  ++    +LS+     A+ +
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQ-----AIKW 184

Query: 209 DRVEFATIKKG--ENNKVYQKIYKPEEIKQL 237
           D      I+        V + I+ P+E +QL
Sbjct: 185 DGSSGGVIRMVVLTAAGVERLIFYPDEYEQL 215

>SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137)
           [648 bp, 215 aa] {ON} similar to uniprot|P38624
           Saccharomyces cerevisiae YJL001W PRE3 20S proteasome
           beta-type subunit, responsible for cleavage after acidic
           residues in peptides
          Length = 215

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 41/209 (19%), Positives = 84/209 (40%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVFAQNYLQTYNE---DIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
           +   + Y   Y E        V      + K   T            I AGYDE+   ++
Sbjct: 79  QYHLELYDSQYGEPSTKTAASVFKTLCYENKDNLT---------AGIIVAGYDEKNKGEV 129

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTY 208
           ++    G+         G+ ++         FK+ +  E  I+    +LS+       + 
Sbjct: 130 YSIPLGGSIHKQNYAIAGSGSTFIYGYCDKNFKEGMTKEETIDFIKHSLSQAIKWDGSSG 189

Query: 209 DRVEFATIKKGENNKVYQKIYKPEEIKQL 237
             +    + K   + V + ++ P+E + L
Sbjct: 190 GVIRMVVLTK---DGVERLVFYPDEYENL 215

>Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 41/211 (19%), Positives = 89/211 (42%), Gaps = 20/211 (9%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVFAQNYLQTY---NEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
           +   + Y   Y   + +    V      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYTSQYGPPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTY 208
           +T    G+         G+ ++         F++++  E  ++    +LS+     A+ +
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQ-----AIKW 184

Query: 209 DRVEFATIKKG--ENNKVYQKIYKPEEIKQL 237
           D      I+      + V + I+ P+E ++L
Sbjct: 185 DGSSGGVIRMVVLTADGVERLIFYPDEYERL 215

>NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {ON}
           Anc_3.417
          Length = 287

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 73/171 (42%), Gaps = 8/171 (4%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFW- 130

Query: 89  NTARVFAQNYLQTYNED--IPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGY 146
               + +Q  L    E   I V    + LS++   Y   G      +  +  GY ++ G 
Sbjct: 131 -ETWLGSQCRLHELKEKNRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTL 197
            ++  +  G         VG+  + A  +L   +K D+ +E A+ L  +++
Sbjct: 186 TIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSI 236

>CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103w PRE2
          Length = 286

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 33/169 (19%), Positives = 70/169 (41%), Gaps = 4/169 (2%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIVVAVDSRATAGQWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 130

Query: 89  NTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
                  + +     E I V    + L ++   Y   G      +  +  GY ++ G  +
Sbjct: 131 TWLGSQCRLHELKEKERISVAAASKILGNLVYQYKGAG----LSMGTMICGYTKKEGPTI 186

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTL 197
           +  +  G         VG+  + A  +L   +K D+ +E A+ L  +++
Sbjct: 187 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSI 235

>KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 40/200 (20%), Positives = 81/200 (40%), Gaps = 10/200 (5%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQYW- 130

Query: 89  NTARVFAQNYLQTYNED--IPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGY 146
               + +Q  L    E   I V    + LS++   Y   G      +  +  GY ++ G 
Sbjct: 131 -ETWLGSQCRLHELKEKDRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSAL 206
            ++  +  G         VG+  + A  +L   +K D+ +E A+ L  +++       A 
Sbjct: 186 TVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSILAAAHRDAY 245

Query: 207 TYDRVEFATIKKGENNKVYQ 226
           +   +    +   EN  VY 
Sbjct: 246 SGGSINLYHVT--ENGWVYH 263

>TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.417
           YPR103W
          Length = 286

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 37/198 (18%), Positives = 78/198 (39%), Gaps = 6/198 (3%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + T+       +  K+ ++N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVNKVIRINPFLLGTMAGGAADCQYWE 130

Query: 89  NTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY ++ G  +
Sbjct: 131 TWLGSQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTV 186

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTY 208
           +  +  G         VG+  + A  +L   +K D+ ++ A+ L  +++       A + 
Sbjct: 187 YYVDSDGTRLKGNVFCVGSGQTFAYGVLDSNYKWDLTVDEALYLGKRSILAAAHRDAYSG 246

Query: 209 DRVEFATIKKGENNKVYQ 226
             +    +   EN  VY 
Sbjct: 247 GSINLYHVT--ENGWVYH 262

>Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa]
           {ON} complement(382038..382904) [867 nt, 289 aa]
          Length = 288

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 39/200 (19%), Positives = 81/200 (40%), Gaps = 10/200 (5%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFW- 130

Query: 89  NTARVFAQNYLQTYNED--IPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGY 146
               + +Q  L    E   I V    + LS++   Y   G      +  +  GY ++ G 
Sbjct: 131 -ETWLGSQCRLHELKEKSRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSAL 206
            ++  +  G         VG+  + A  +L   +K D+ ++ A+ L  +++       A 
Sbjct: 186 TIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVDEALYLGKRSILAAAHRDAY 245

Query: 207 TYDRVEFATIKKGENNKVYQ 226
           +   +    +   EN  VY 
Sbjct: 246 SGGSINLYHVT--ENGWVYH 263

>Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W
           (REAL)
          Length = 349

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 4   RRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIV 45
           RR++   T+  P+G LY V++A    +H G  +  +  DGI+
Sbjct: 96  RRWNKLCTLNDPKGSLYSVKFA---PAHLGLKLACLGNDGIL 134

>SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 31/169 (18%), Positives = 70/169 (41%), Gaps = 4/169 (2%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGSWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
                  + +     + I V    + L ++   Y   G      +  +  GY ++ G  +
Sbjct: 132 TWLGTQCRLHELKEKQRISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTL 197
           +  +  G         VG+  + A  +L   +K D+ +E A+ L  +++
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYKWDLTIEDALYLGKRSI 236

>KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 285

 Score = 32.7 bits (73), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 36/198 (18%), Positives = 79/198 (39%), Gaps = 6/198 (3%)

Query: 29  ISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 69  IAHGTTTLAFRFKGGIIVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 128

Query: 89  NTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY ++ G  +
Sbjct: 129 TWLGSQCRLHELREKERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKEGPTI 184

Query: 149 FTSNPSGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALTY 208
           +  +  G         VG+  + A  +L   ++ D+ +E A+ +  +++       A + 
Sbjct: 185 YYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYRWDLSVEEALYIGKRSILAAAHRDAYSG 244

Query: 209 DRVEFATIKKGENNKVYQ 226
             +    +   EN  VY 
Sbjct: 245 GSINLYHVT--ENGWVYH 260

>KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly
           similar to uniprot|P30657 Saccharomyces cerevisiae
           YFR050C PRE4 20S proteasome beta-type subunit
          Length = 265

 Score = 32.7 bits (73), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 57/128 (44%), Gaps = 7/128 (5%)

Query: 20  YQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAG 79
           Y   +  + I    + I +  +DG+++AA+R  +   L + +  E+L+ +  N  V ++G
Sbjct: 29  YPSMHTQQPIVTGTSVISMKYKDGVIIAADRLGSYGSLLRFSDVERLFPVGRNTVVGISG 88

Query: 80  LTADAEILINTARVFA--QNYLQTYNED---IPVEVLVRKLSDIKQGYTQHGGLRPFGVS 134
             +D + L N         NY   Y ED   +    +   L+++   Y +   + P   +
Sbjct: 89  DISDMQHLENLLDEMQTENNYDNEYAEDEEALKPSYVFEYLANVM--YNRRSKMNPLWNA 146

Query: 135 FIYAGYDE 142
            I AG ++
Sbjct: 147 LIVAGLED 154

>NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 32.3 bits (72), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL +++D +    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRIHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RVFAQNYLQTY 102
           + +   Y   Y
Sbjct: 79  QYYLDLYTTQY 89

>TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/210 (19%), Positives = 83/210 (39%), Gaps = 17/210 (8%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL ++ D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVFAQNYLQTYNE---DIPVEVLVRKLSDIKQGYTQHGGLRPFGVSFIYAGYDERLGYQL 148
           +   + Y   + E    +   +      D K   +            I AG+D++     
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 149 FTSNP-SGNYTGWKAISVGANTSAAQTLLQMEFKDDIKLEGAIELALKTLSKTTDSSALT 207
             S P  G+    K    G+ ++         FKDD+  +  +     +LS+       +
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSAFIYGYCDKNFKDDMTKDETVNFMKHSLSQAIKWDGSS 189

Query: 208 YDRVEFATIKKGENNKVYQKIYKPEEIKQL 237
              +    + K   + V + I+ P+E + L
Sbjct: 190 GGVIRMVVLTK---DGVERLIFYPDEYENL 216

>KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [651
           bp, 216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVFAQNYLQTY 102
           +   + Y   Y
Sbjct: 79  QYHLELYESQY 89

>NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 5/72 (6%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL K++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVAD-- 76

Query: 92  RVFAQNYLQTYN 103
               Q +L  Y+
Sbjct: 77  --IVQYHLDIYS 86

>Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVFAQNYLQTY 102
           +   + Y   Y
Sbjct: 79  QYHLELYTSQY 89

>TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 3/76 (3%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T      +  T+KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTMGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVFAQNYLQTYNEDIP 107
           +   + Y   Y   IP
Sbjct: 79  QYHLEVYTSQYG--IP 92

>KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL ++++ +    +G  AD + + +  
Sbjct: 19  GTSIMAVTFRDGVILGADSRTTTGAYIANRVTDKLTRVHEKVWCCRSGSAADTQAVAD-- 76

Query: 92  RVFAQNYLQTY 102
               Q+YL+ Y
Sbjct: 77  --IVQHYLELY 85

>TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  +DG++L A+ + T+     +  T+KL ++ D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVFAQNYLQTYNE 104
           +   + Y   + E
Sbjct: 79  QYQLELYTAQFGE 91

>Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C -
           Hypothetical ORF [contig 247] FULL
          Length = 1617

 Score = 31.2 bits (69), Expect = 3.1,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 7/64 (10%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQDTSTEKL 66
           DS   I     RLY+ E A+  I+H     GI + D + L AER      +  + +  KL
Sbjct: 158 DSLPAILRARSRLYERETAILGINHKNKETGI-SWDKLYLRAER------VAHELTKHKL 210

Query: 67  YKLN 70
           YK++
Sbjct: 211 YKMD 214

>KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 bp,
           216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 33  GTAI-GIMAEDGIVLAAERKVTSTLLEQDTSTEKLYKLNDNITVAVAGLTADAEILINTA 91
           GT+I  +  + G++L A+ + T+     +  T+KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFDGGVILGADSRTTTGAYIANRVTDKLTRIDDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVFAQNYLQTY 102
           +   + Y   Y
Sbjct: 79  QYHLELYTSQY 89

>KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly
           similar to uniprot|P38236 YBR057C Saccharomyces
           cerevisiae MUM2 Cytoplasmic protein essential for
           meiotic DNA replication and sporulation
          Length = 316

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 63/127 (49%), Gaps = 15/127 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERK----VTSTLLEQDTS 62
           DSR +  S +GR  ++  +LESI H  +++ I A+D  +    R+    VT+  L    S
Sbjct: 188 DSRVSSASQKGRTVEMPVSLESIFHKMSSV-IAAKDKELEETSRRLESIVTAIALNPSNS 246

Query: 63  TEKLYK-----LNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSD 117
             KL +     L   + V +  LT + +   + A++    Y ++  + I +E++ R+  +
Sbjct: 247 VTKLGRYDEEALAHKMVVRLETLTKENQ---DMAKMLG--YGRSKEQHIELELIKRENQE 301

Query: 118 IKQGYTQ 124
           +K+  +Q
Sbjct: 302 LKRKLSQ 308

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,536,511
Number of extensions: 1041136
Number of successful extensions: 3203
Number of sequences better than 10.0: 256
Number of HSP's gapped: 2999
Number of HSP's successfully gapped: 256
Length of query: 256
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 149
Effective length of database: 41,212,137
Effective search space: 6140608413
Effective search space used: 6140608413
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)