Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0A056903.498ON47847823650.0
Kpol_480.113.498ON4634837846e-99
TDEL0D056603.498ON4424826703e-82
ZYRO0D09768g3.498ON4604916497e-79
SAKL0F02552g3.498ON4784835881e-69
Suva_16.4803.498ON4524895451e-63
Kwal_47.188953.498ON4434785311e-61
KLLA0E03939g3.498ON4354735241e-60
YPR152C (URN1)3.498ON4654795147e-59
Skud_16.4463.498ON4564865111e-58
KAFR0G037203.498ON4094745002e-57
KLTH0G02398g3.498ON4624854929e-56
KNAG0A079703.498ON3884724861e-55
Smik_16.4043.498ON4604804892e-55
NDAI0B059003.498ON5225064512e-49
CAGL0L08404g3.498ON4104894145e-45
Ecym_12313.498ON3292593473e-36
AFR317C3.498ON3282543315e-34
NCAS0F035803.498ON4131442413e-21
TBLA0D029303.498ON2762471495e-10
KAFR0A002302.649ON556279850.091
Ecym_33972.649ON57578800.31
Suva_11.2162.649ON58569790.38
TBLA0C009302.649ON65878790.47
TDEL0B074402.649ON57070780.50
NCAS0C051102.649ON60480780.55
ZYRO0E00682g2.649ON57081780.55
KLTH0C00924g2.649ON56455780.57
TDEL0B059401.412ON407133751.0
Kpol_1073.42.649ON53079751.3
Smik_11.2432.649ON57973751.4
Suva_13.3382.354ON13875711.6
Skud_11.2172.649ON58370741.6
YKL012W (PRP40)2.649ON58373722.8
TPHA0J013505.663ON220111703.4
Kwal_14.9392.649ON56230696.2
CAGL0L05368g2.649ON59068696.4
Skud_11.394.285ON74646688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0A05690
         (478 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   915   0.0  
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   306   6e-99
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   262   3e-82
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   254   7e-79
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...   231   1e-69
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   214   1e-63
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   209   1e-61
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...   206   1e-60
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   202   7e-59
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   201   1e-58
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   197   2e-57
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   194   9e-56
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   191   1e-55
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   192   2e-55
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...   178   2e-49
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...   164   5e-45
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   138   3e-36
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...   132   5e-34
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...    97   3e-21
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    62   5e-10
KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649...    37   0.091
Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar t...    35   0.31 
Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012...    35   0.38 
TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {O...    35   0.47 
TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa] ...    35   0.50 
NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON} Anc_2...    35   0.55 
ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar ...    35   0.55 
KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar ...    35   0.57 
TDEL0B05940 Chr2 (1050753..1050830,1050892..1052037) [1224 bp, 4...    33   1.0  
Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON} (4004..559...    33   1.3  
Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012...    33   1.4  
Suva_13.338 Chr13 complement(553692..554105) [414 bp, 138 aa] {O...    32   1.6  
Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012...    33   1.6  
YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1 s...    32   2.8  
TPHA0J01350 Chr10 complement(316134..316796) [663 bp, 220 aa] {O...    32   3.4  
Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W ...    31   6.2  
CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa] ...    31   6.4  
Skud_11.39 Chr11 complement(75575..77815) [2241 bp, 746 aa] {ON}...    31   8.9  

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/478 (95%), Positives = 456/478 (95%)

Query: 1   MKIRVWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWY 60
           MKIRVWKEFIAPNGQKYYYNL      WDEPESLFEGNAVSQGQKDESPVFAFPLFNDWY
Sbjct: 1   MKIRVWKEFIAPNGQKYYYNLKTKKTTWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWY 60

Query: 61  LVISSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYE 120
           LVISSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYE
Sbjct: 61  LVISSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYE 120

Query: 121 EIMENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSSSDEEVD 180
           EIMENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSSSDEEVD
Sbjct: 121 EIMENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSSSDEEVD 180

Query: 181 IREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYFQLFEKY 240
           IREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYFQLFEKY
Sbjct: 181 IREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYFQLFEKY 240

Query: 241 QLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKDDQTDSS 300
           QLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKDDQTDSS
Sbjct: 241 QLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKDDQTDSS 300

Query: 301 GAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFXXXXXXXXXXXXX 360
           GAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIF             
Sbjct: 301 GAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFQDIKKDNKKLFKQ 360

Query: 361 XXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHVVEHSDKVLE 420
              NKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHVVEHSDKVLE
Sbjct: 361 FKINKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHVVEHSDKVLE 420

Query: 421 TLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLECLKNYLRNLT 478
           TLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLECLKNYLRNLT
Sbjct: 421 TLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLECLKNYLRNLT 478

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  306 bits (784), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 179/483 (37%), Positives = 302/483 (62%), Gaps = 29/483 (6%)

Query: 1   MKIRVWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQ-KDESPVFAFPLFNDW 59
           M +++WKEF AP+G+KYYYN+      W +P+SL++      G  +  +P+F FPL N W
Sbjct: 1   MPVKIWKEFNAPDGRKYYYNIKSKESTWTKPDSLYDTEKGKVGSDRAGAPLFVFPLLNGW 60

Query: 60  YLVISSLGKKFYFNAVENISV-LELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQV 118
           +L+I   G+K+Y+N V N ++  EL D+ + QLL ++DK KLILL+ VARG+ + +Y ++
Sbjct: 61  HLIICVGGEKYYYNKVLNDTISKELSDDSSLQLLNAVDKDKLILLIAVARGYNWPDYEKL 120

Query: 119 YEEIMENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDN-GIVNDYYSSSDE 177
           Y+E+++  + + N++  + ++ +V   ++ +E  D+   G+++A  N G++  Y SS DE
Sbjct: 121 YDELLKEFELISNDMM-QTQQAEVTSTEDEDEDEDENQEGNVVAVSNTGLIGGYLSSDDE 179

Query: 178 EVDIREDKFNEIDLAED-NLQQNDGIRTEVIRTETDFN--EENLNSVETLDFNASKEKYF 234
           E        N+++++E+ N++++   R++    + + N  +  L+S++ +D   SK  + 
Sbjct: 180 ESSDE----NQVEVSENTNIEEDLAKRSDQNDVDENLNSIDHGLDSLDDIDLEKSKSLFT 235

Query: 235 QLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNS-ITSVDK 293
           +LFE++QL+ +S+W  Q K + + PD++ ITDNS RE++FE WCS K +   S +T+ + 
Sbjct: 236 RLFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTREELFESWCSSKFNGGKSNVTNFEG 295

Query: 294 DDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFXXXXXX 353
           +D+   +                 ++EE++ EPTK+HYL+HIISKA+I+ DTIF      
Sbjct: 296 EDEETLT-----------------SDEEDDFEPTKFHYLAHIISKADIAADTIFLDIKEN 338

Query: 354 XXXXXXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHVVE 413
                       FI SK+D E+FSSKL+F+YKKF  ++R+++F  +L++N+  I  ++  
Sbjct: 339 NKSLFKEFKIKDFIKSKKDQEAFSSKLLFFYKKFQLNERKNLFLQLLKENENLIIPNINS 398

Query: 414 HSDKVLETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLECLKNY 473
           + + V   +   V+E +E ETQLL++E I+GL   L  LANDPKYYILGIKDKL  LK Y
Sbjct: 399 NIEIVRHIIKNDVDEAYEIETQLLQIEKIIGLQNMLVDLANDPKYYILGIKDKLILLKEY 458

Query: 474 LRN 476
           L++
Sbjct: 459 LKD 461

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  262 bits (670), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 172/482 (35%), Positives = 272/482 (56%), Gaps = 57/482 (11%)

Query: 4   RVWKEFIAPNGQKYYYNLXXXXXXWDEPESLFE--GNAVSQGQKDESPVFAFPLFNDWYL 61
           R+W  F AP+G+KYYYNL      W  PES +E  GN   +  ++  P +A PL NDW+L
Sbjct: 3   RLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDWFL 62

Query: 62  VISSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYEE 121
           VI  +G K+YF++    +   L D  + +LL +IDK K+ILLV +ARG+  +   +VY+E
Sbjct: 63  VIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDRVYQE 122

Query: 122 IMENLDFVKN----EISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSSSDE 177
           ++++L  ++     E   E +  Q + +  SE   +++ P  LIA   G  +     ++ 
Sbjct: 123 VIDDLKALRKGSAVEEEGEQEGEQESESIPSESEEEEKRPSGLIA---GYSSSEEEENEI 179

Query: 178 EVDIREDKFNEI---DLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYF 234
           + D+  +K N +   DL ++N +    IR +                           +F
Sbjct: 180 DSDV--EKLNNLGDDDLPKENHEDESQIRND---------------------------FF 210

Query: 235 QLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKD 294
           QL +++Q + +STWS Q++ + +DP FY ITD+S+RE +FEEWC +  +      + +  
Sbjct: 211 QLLQRHQCDPYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINR-----TTNPQ 265

Query: 295 DQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFXXXXXXX 354
           D  D        EDNLDD+  ++ EE+E  EP  +HYL+HI+SKANI+P TIF       
Sbjct: 266 DLVD--------EDNLDDDSREEEEEDEL-EPLPFHYLAHIVSKANITPSTIFQDIKDQN 316

Query: 355 XXXXXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHVVEH 414
                     +F+ SK   E+F SKL+FYYKKF   +R++IF  +LE +  +I K++ + 
Sbjct: 317 KADFKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHDLLESHSRSIKKNLEQE 376

Query: 415 SDKVLETLN--TSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLECLKN 472
           S+ +  TL+     N+ +  ET+LLK+E+++GL+  +E+LANDPKYY+LGIKDK+  L +
Sbjct: 377 SESMRSTLSEEAGSNDAYAIETKLLKMENLIGLARDMEELANDPKYYVLGIKDKMIELMH 436

Query: 473 YL 474
           YL
Sbjct: 437 YL 438

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  254 bits (649), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 168/491 (34%), Positives = 258/491 (52%), Gaps = 55/491 (11%)

Query: 4   RVWKEFIAPNGQKYYYNLXXXXXXWDEPESLFE---GNAVSQGQKDES-PVFAFPLFNDW 59
           R+W+E++AP+G+KYYYN       W +PESL E      V + +K ES P  A  L++ W
Sbjct: 3   RIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYHGW 62

Query: 60  YLVISSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVY 119
           +LVI   GKKFY+N   N S   L DE +  L+ ++DK KL+ L+G+ARG+     L +Y
Sbjct: 63  HLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGYSPGG-LHIY 121

Query: 120 EEIMENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSSSDEEV 179
           EE++ +L  ++ E             +E++ +   Q+  +    +    ++    ++ E 
Sbjct: 122 EELVTDLVKLRQE-------------REAKRAEGDQEKDEATGEEVKDEDEEKDKANGE- 167

Query: 180 DIREDKFNEIDLAEDNLQQNDGI------------RTEVIRTETDFNEENLNSVE-TLDF 226
           +++E+  ++ D  EDN  QN  +                   E   N     SVE  +D 
Sbjct: 168 EVKEEDRDQND-GEDNDAQNGLVAGYSSSSESEDEGEGEGEGEEPLNIPITESVEEPVDI 226

Query: 227 NASKEKYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHN 286
           +  K+  + LF +Y LN +S W  + K + DDPDF  + D+S+RED+FEEWC    +H  
Sbjct: 227 SGDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWC----AHAI 282

Query: 287 SITSVDKDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTI 346
           S   V+  D+  S                       +LEPTKYHYL+HI+SK+NI+P TI
Sbjct: 283 SGDQVEPVDEIKSEDFDEEE----------------DLEPTKYHYLAHIVSKSNITPTTI 326

Query: 347 FXXXXXXXXXXXXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTA 406
           F                  F+TSK+D ESF SKL+FYYK+    +R+++F  +L+QN   
Sbjct: 327 FMDIKNDNKSSFKKYNIKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKT 386

Query: 407 INKHVVEHSDKVLETLNTSV--NEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIK 464
           I +++    DKV   L   +  N+ +  ET+L K+E  +GL G+L  L  +PKYYILGI+
Sbjct: 387 IEENLSNDMDKVRHCLAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIR 446

Query: 465 DKLECLKNYLR 475
           DK+  L +YL+
Sbjct: 447 DKMLELNDYLK 457

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score =  231 bits (588), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 160/483 (33%), Positives = 260/483 (53%), Gaps = 19/483 (3%)

Query: 6   WKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVISS 65
           W EF  P+G KYYYNL       ++P    +  +  + +    P +  PL   W LV+ +
Sbjct: 5   WNEFTTPSGDKYYYNLETKQSTLEKPAGFDDQKSRKRQKLQHKPKYLVPLDKGWSLVLCN 64

Query: 66  LGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYEEIMEN 125
            G KFY N + N S   L D  + +LLQ +DK+KL+LL+G++RG+ Y     VY+EI+ +
Sbjct: 65  TGTKFYHNKITNESHWTLDDPCSIELLQQLDKEKLVLLIGISRGY-YCPRRNVYDEIIND 123

Query: 126 LDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSSSDEEVDIREDK 185
           L F+K++ S E + ++  +A+  EE  +    G+      G+V  Y SS D E +  E++
Sbjct: 124 LKFLKDK-SLEKQGVEPEMARADEEQVEYLHQGEEQGL--GLVTGYGSSDDSEDENIEEE 180

Query: 186 FNEIDLAEDNLQQNDGIRTEVIRT-ETDFNE-ENLNSVETLDFNASKEKYFQLFEKYQLN 243
             + ++  +  ++ +    E     + D +E  NL+    LD   +K ++  LF+KY L+
Sbjct: 181 EEKAEVEGEGEEEEEEKAGEQETVDQADIDELNNLSEPPQLD---AKNRFTILFDKYNLD 237

Query: 244 SFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHN------SITSVDKDDQT 297
            +S W  QS+ +  DPDFYL+T+ S R+D+FE+WC+   ++        +I   D D + 
Sbjct: 238 PYSMWEFQSRKINKDPDFYLVTNGSSRKDLFEQWCTETIANSKDAISDANINENDADQRQ 297

Query: 298 DSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFXXXXXXXXXX 357
           +S       ++   +   D   ++ENLEPT++HYLSHIISK++I   TIF          
Sbjct: 298 ESEATQKEEQEEKKEVEEDGEPDDENLEPTRFHYLSHIISKSSIEQTTIFLDIKKENKAL 357

Query: 358 XXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHVVEHSDK 417
                    +  K+D E F+SKL+FYYK+ D  QR+ IF+ +L  +K  I +  + + +K
Sbjct: 358 FKTFRIKSSL-KKKDQEDFASKLLFYYKRMDLEQRKLIFQKLL-LSKLDIIRSNLRNVEK 415

Query: 418 V--LETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLECLKNYLR 475
           +  + T  ++  + +  ETQLL +ED + + G L  L  +  YYILGIKDK   LK +L+
Sbjct: 416 LRDIATEQSTPADSYAIETQLLMMEDCMDIHGKLSFLQGEVHYYILGIKDKTIQLKQFLQ 475

Query: 476 NLT 478
             T
Sbjct: 476 KFT 478

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  214 bits (545), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 163/489 (33%), Positives = 248/489 (50%), Gaps = 81/489 (16%)

Query: 5   VWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQ-----GQKDESPVFAFPLFNDW 59
           VW+EF  P G++Y+YN       WD+P+  F+  + +Q      Q +  P+FA  L +DW
Sbjct: 6   VWQEFKTPAGKRYFYNKNTKESRWDKPD--FKKASGAQDRAKVAQVERKPMFALELIDDW 63

Query: 60  YLVISSLGKKFYFNAVENISVLELHDELNTQ---LLQSIDKQKLILLVGVARGFIYDEYL 116
           +L+I + G KFY+N   NIS  E+ +E   Q   L+ S+DK+KLILL+GVARG+   E  
Sbjct: 64  HLIICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVRE-- 121

Query: 117 QVYEEIMENLDFVKNEISNEYKELQVNVAQE-----SEESADKQDPGDLIATDNGIVNDY 171
           +  E+I E+L    NE  + +K+ QV V +E     +EE+ D + P    A   G+V+ Y
Sbjct: 122 EDVEKIFESL----NEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQ--ANSAGLVSGY 175

Query: 172 YSSSDEEVDIREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKE 231
            SSS+EE +  E + ++  + +D  Q + G          D NE  L             
Sbjct: 176 GSSSEEEEEEEEPENDDAGIIDDLNQIDSG----------DVNERGL------------- 212

Query: 232 KYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSV 291
            +FQL ++Y+L+ FSTWS Q K + +DPDFY + D ++RE +FEEWC+   +  +   S 
Sbjct: 213 -FFQLCDRYELDKFSTWSLQCKKIENDPDFYKVGDAAVRESLFEEWCASASASASGNESE 271

Query: 292 DKDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFXXXX 351
           D+DD                          + LEPTK+HYL+ I++KA I+PD I     
Sbjct: 272 DEDDA-------------------------DLLEPTKFHYLAQIVAKAEIAPDCIPQDIR 306

Query: 352 XXXXXXXXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHV 411
                        +++ SKRD + F S+L+FYYK F   QR++IF+  L  ++      V
Sbjct: 307 KQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECLRDHERDFACAV 366

Query: 412 ------VEHSDKVLETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKD 465
                 V    +    L  +  +    E  LL +E   G+ G++  LA DP+YY+LGI D
Sbjct: 367 QSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGV-GAI-ALA-DPRYYVLGILD 423

Query: 466 KLECLKNYL 474
           K      +L
Sbjct: 424 KTAGWVRWL 432

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  209 bits (531), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 152/478 (31%), Positives = 258/478 (53%), Gaps = 42/478 (8%)

Query: 4   RVWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEG-NAVSQGQK-DESPVFAFPLFNDWYL 61
           R W+E+  P+G KYYYNL      ++ P+   E  N+  + +K D  P+FA  LFNDW L
Sbjct: 3   RQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDWAL 62

Query: 62  VISSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYEE 121
           +I + G +F++N+  + S  +L DE + +LL  +D++KL+LLVGVA+GF   +   VY+E
Sbjct: 63  IICNTGLRFFYNSESHTSRWDLDDEASLELLAKLDREKLVLLVGVAKGFDPGDR-NVYQE 121

Query: 122 IMENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSSSDEEVDI 181
           + +++  +K + +N  ++ +   A+ES  +A    PG  + +  G  ++     DEE + 
Sbjct: 122 LSDSISELKEDSNN--RDFRKETAEESIPTA---VPGQSLVSGYGSSDESDKDEDEEEEE 176

Query: 182 REDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYFQLFEKYQ 241
            ++  +   ++  N+   D      +  E D++ +               ++  LF KY 
Sbjct: 177 NDEGDSTEAVSCTNVPDADVDDLGTVLPEHDYSND--------------AEFISLFSKYA 222

Query: 242 LNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKDDQTDSSG 301
           ++ +STW+ QS+ + DDP FY IT+++ R+++FE WC  + S+ + + ++  D+Q  SS 
Sbjct: 223 VDPYSTWNMQSRKIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAI--DEQIISSD 280

Query: 302 AHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFXXXXXXXXXXXXXX 361
                         D++   ++LEP++YHYL+HI+SK+ I+  T+               
Sbjct: 281 --------------DEDPAIDSLEPSRYHYLAHIVSKSKITSSTLPKDIRTDQKELFKQF 326

Query: 362 XXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHVV--EHSDKVL 419
                + SKR+ ++F SKL+FYYK+    QR  IF+  LE  K A+ K +   E    +L
Sbjct: 327 RIKDSL-SKREQDAFLSKLLFYYKRMTPEQRIAIFKRFLEGKKKALKKGLKNQERLSTIL 385

Query: 420 ETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLECLKNYLRNL 477
            T +    E++  ETQLL LED +   GS   L  D +YY+LGIKDK   L++ L++L
Sbjct: 386 STPSLP-QENYAIETQLLILEDCIDTHGSNAFLQEDVQYYVLGIKDKTVALRDILKDL 442

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score =  206 bits (524), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 154/473 (32%), Positives = 241/473 (50%), Gaps = 47/473 (9%)

Query: 6   WKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVISS 65
           WK F  P+G  YY+N        ++P+    G+  +  ++   PVF  PL N W LVI  
Sbjct: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEF--GSQQAGMKELRVPVFCLPLRNYWNLVICK 61

Query: 66  LGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYEEIMEN 125
            G KF+ N   N+S  +L D+ +  LL  +D   L LL+GVARGF       VY EI + 
Sbjct: 62  DGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGEIRD- 120

Query: 126 LDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSSSDEEVDIREDK 185
                         LQ  +    +E  D  +    +   N    D   SS+  V      
Sbjct: 121 -------------VLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILVSGYSSS 167

Query: 186 FNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYFQLFEKYQLNSF 245
            ++     +  ++ND        +  D  EE+  ++ +L+    + K+ QL  + QL+ +
Sbjct: 168 SDDSGEESEVEEKNDP-------SSIDVKEED--TLPSLNNTEIESKFIQLLNEIQLDPY 218

Query: 246 STWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKDDQTDSSGAHSS 305
           STWS Q+K +M DP +YLIT N  R+++F+ WCS++         ++  +  + + A  S
Sbjct: 219 STWSIQAKRIMHDPRYYLITSNDKRDELFQTWCSQQ---------LNNSNNDNENNAQDS 269

Query: 306 AEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFXXXXXXXXXXXXXXXXNK 365
           AE+      +D+ + +  LEPTKYHYL+HIISKANI+P+T+F                NK
Sbjct: 270 AEN------SDEEDSDVTLEPTKYHYLAHIISKANITPETLFSNIKKENKSLFKELEINK 323

Query: 366 FITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHVVEHSDKVLETLNTS 425
            +T K++ E F+SK+I YYK+ D  QR ++F+ ++ +NK        + S  +LE    +
Sbjct: 324 TLT-KKEQEQFASKVIAYYKRMDNLQRTELFKKMM-KNKLRFPPISEKLSQLMLE---ET 378

Query: 426 VNEDFEKETQLLKLEDILGLSGSLEK--LANDPKYYILGIKDKLECLKNYLRN 476
            ++ F+ ETQLL+LE+ L +  +L+   + N+  YYILGIKDKL  LK  LR+
Sbjct: 379 PSDSFKLETQLLQLENALLILDNLQNSYMQNEIMYYILGIKDKLAALKEILRD 431

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  202 bits (514), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 160/479 (33%), Positives = 249/479 (51%), Gaps = 67/479 (13%)

Query: 6   WKEFIAPNGQKYYYNLXXXXXXWDEPE----SLFEGNAVSQGQKDESPVFAFPLFNDWYL 61
           W+EF  P G+KYYYN       W++P     S  E NA  + Q +  P F+  L N W+L
Sbjct: 5   WQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNA-KESQTERKPTFSLELVNGWHL 63

Query: 62  VISSLGKKFYFN----AVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQ 117
           +I + G K YFN      +N  + +  D     L++S+DK+KL+LL+GVARG+   E   
Sbjct: 64  IIYNDGTKLYFNDDSKEFKN-DISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMRE--- 119

Query: 118 VYEEIMENLDFVKNEISNEYKELQVNVAQE---SEESADKQDPGDLIATDNGIVNDYYSS 174
             E+I + L+    EI + +K  Q  V ++   SEE+ D + P  L  +  G+V+ Y SS
Sbjct: 120 --EDIDKILESCNEEI-HLFKRNQDEVERKDEISEEAGDVKSP--LQESHTGLVSGYGSS 174

Query: 175 SDEEVDIREDKFNEIDLAEDNLQQNDGIRTEVIRTETD-FNEENLNSVETLDFNASKEKY 233
           S EE +  +++ +E +  +  + Q+  I  ++ R +TD  +E N+              +
Sbjct: 175 SGEEDEEEDEEEDEENEEQ-IVNQDISIIDDLNRIDTDDIDERNI--------------F 219

Query: 234 FQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDK 293
           F+LF++Y+L+ FSTWS QSK + +DPDFY I D+++RE +FEEWC  +  +         
Sbjct: 220 FELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGERSGN--------- 270

Query: 294 DDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKAN-ISPDTIFXXXXX 352
                ++   S +EDN +D+        E LEPTKYHYL+ I++ A  I+PDTI      
Sbjct: 271 -----ATAEESDSEDNSEDD-------SEVLEPTKYHYLAQIVANAGTIAPDTIPQDIRK 318

Query: 353 XXXXXXXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHVV 412
                       ++I SKRD + F S+L+FYYK FD  QR++IF   L  ++      V 
Sbjct: 319 QQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKEIFCDCLRDHERDFTGAVE 378

Query: 413 E-HSDKVL----ETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDK 466
               DK L    +TL  +  +    E  LL +E    +S     +  +P+YY++GI +K
Sbjct: 379 SLRQDKELIDRWQTLLKAPADSSSIEDILLSIEHRCCVSPI---VVTEPRYYVVGILEK 434

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  201 bits (511), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 157/486 (32%), Positives = 253/486 (52%), Gaps = 69/486 (14%)

Query: 5   VWKEFIAPNGQKYYYNLXXXXXXWDEPE-SLF--EGNAVSQGQKDESPVFAFPLFNDWYL 61
           +W+EF  P G +YYYN       W+ P+  +F  + N     + +  P F+  L + W+L
Sbjct: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60

Query: 62  VISSLGKKFYFNAVENISVLELHDELNTQ---LLQSIDKQKLILLVGVARGFIYDEYLQV 118
           VI + G KFY+N+   +   E+  E ++Q   L++S+DK+KL+LL+GVARG  YD   + 
Sbjct: 61  VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARG--YDMRDED 118

Query: 119 YEEIMENLDFVKNEISNEYKELQVNVAQESEESADKQDPGD----LIATDNGIVNDYYSS 174
            ++I E+L    NE  N +K+ Q N A   +E+   ++PGD    L     G+++ Y SS
Sbjct: 119 VDKIFESL----NEEINLFKKNQ-NEAGRVDEA--NEEPGDVNPPLKEHHTGLISGYGSS 171

Query: 175 SDEEVDIREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYF 234
           S+EE    E++  E D  E +L ++  I             ++LN ++T D +  +  +F
Sbjct: 172 SEEEE--EEEEEEEEDDGEQDLNKDATII------------DDLNQIDTGDAD-ERGLFF 216

Query: 235 QLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKD 294
           +LF++Y+L+ FSTWS QSK + +DPDFY I D+++RE  FEEWC  +HS           
Sbjct: 217 RLFDRYELDKFSTWSLQSKKIENDPDFYTIGDDAVREGFFEEWCGHEHS----------- 265

Query: 295 DQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKAN-ISPDTIFXXXXXX 353
              DS+ A +S  +++ D           LEPTKYHYL+ I++KA  I PD +       
Sbjct: 266 ---DSAAAEASGSEDVGD----------VLEPTKYHYLAQILAKAGTIPPDAVPQDIRKQ 312

Query: 354 XXXXXXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGIL---EQNKTAINKH 410
                      +++ SKR+ + F S+L+FYYK F   QR++IF+  L   E++     K 
Sbjct: 313 QKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQDCLRDHERDFAGAVKS 372

Query: 411 VVEHSDKV--LETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLE 468
           +   S  +   + +  +  +    E  LL +E    +      +A DP+YY++GI DK  
Sbjct: 373 IRRESGLISQWQAVLEAPADGASVEEVLLNIEYRCNIV-----VAADPRYYVVGILDKTM 427

Query: 469 CLKNYL 474
               +L
Sbjct: 428 VWVRWL 433

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  197 bits (500), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 150/474 (31%), Positives = 230/474 (48%), Gaps = 78/474 (16%)

Query: 4   RVWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDE-SPVFAFPLFNDWYLV 62
           ++WKE+ APNG+KYYYN       W++PE+          +++E  PVF   L NDW LV
Sbjct: 3   KIWKEYRAPNGKKYYYNTETKKTTWEKPEA---------AKREEIEPVFVIRLMNDWKLV 53

Query: 63  ISSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYEEI 122
           I + G K+Y +  EN    EL DE + +L++  DK+KL+ L+G+ARG+  +   ++Y  I
Sbjct: 54  ICNNGMKYYLDN-ENEPTKELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIYGNI 112

Query: 123 MENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSSSDEEVDIR 182
           +E ++F+K ++ NE + L+                                  + E ++R
Sbjct: 113 VEEVEFLKEDMKNEQERLK---------------------------------KEAESEVR 139

Query: 183 EDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYFQLFEKYQL 242
           E    E +    NL +           E + + E LN+V     +  K K+ +LF++Y L
Sbjct: 140 EIVLKEAEKPRMNLVEGYDSSESEEEEEEEDDYEFLNNVADEGLSGDKAKFMELFDRYGL 199

Query: 243 NSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKDDQTDSSGA 302
           + FS WS +   V  DPDFYL+TD+  RED+FE WCS                     G 
Sbjct: 200 DKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCS-------------------GQGI 240

Query: 303 HSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFXXXXXXXXXXXXXXX 362
           HS++++   +    +  EE  LEPTK+HYLS I+SK+ I   TIF               
Sbjct: 241 HSTSDEEAKEGGEPEEHEERPLEPTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFKEYK 300

Query: 363 XNKFITSKRDLESFSSKLIFYYKKFDQSQ-RRDIFEGILEQNKTAINKHVVEHSDKVLET 421
              FI S ++ E F SKL+FYYK F Q + R   F   L +     N +    SD  + T
Sbjct: 301 IKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREK----NANYTSMSD--MNT 354

Query: 422 LNTSV--NEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDK-LECLKN 472
           L+  +  N+ +  ET LL++E         + + +D +YYIL +K K +E +KN
Sbjct: 355 LSEHIKRNDTYAIETTLLQIE-----CNFPQDVLSDVRYYILDLKQKTIELVKN 403

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  194 bits (492), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 142/485 (29%), Positives = 238/485 (49%), Gaps = 45/485 (9%)

Query: 4   RVWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESP--VFAFPLFNDWYL 61
           R W+E+  P+G KYYYN+       D+P+   E  +     +   P   F  PL NDW L
Sbjct: 8   RYWREYKTPDGTKYYYNVNTKRSTTDKPDDFEESQSFRSKSRRVDPGVTFVVPLSNDWVL 67

Query: 62  VISSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYEE 121
            +   G++F++ +    S  ++ DE + ++L  +DK KL+LL+  ARGF   E   VY+E
Sbjct: 68  SVCENGQRFFYKSSTEESRWDIEDEESLRILSLVDKNKLVLLLATARGFDIGER-DVYQE 126

Query: 122 IMENLDFVKNEISNEYKELQVNVAQESEESADK-----QDPGDLIATDNGIVNDYYSSSD 176
           ++E+++ +K           +  A+E   +A +     ++P   + T            D
Sbjct: 127 LLEDINNLKQSRGVPEGSEVIEAAEEPSHTAGEPSNATEEPSQAVRTLISAYESSDEDGD 186

Query: 177 EEVDIREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYFQL 236
              +I  +K    ++  DN   N  I             E+LN+       A+K+ +  L
Sbjct: 187 SSDEINAEK----EVHSDNEGSNSDI-------------EDLNAASHQYNEATKQMFTSL 229

Query: 237 FEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKDDQ 296
           F++Y L+ +STW+ QSK + D+P FY +  ++ R ++FE+WC         +  V  +D 
Sbjct: 230 FDEYDLDPYSTWNMQSKKICDNPLFYQVASDAERRELFEDWC---------VAKVKLEDV 280

Query: 297 TDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFXXXXXXXXX 356
            +   AH +   + D +  D + +E  LEPT+YHYL+HI+SKA ++P T+          
Sbjct: 281 IEDP-AHQAVSSDGDGDDDDTSTDE--LEPTRYHYLAHIVSKAEVAPSTLPRDLRSEQKQ 337

Query: 357 XXXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHV--VEH 414
                   + +  K+  + F SKL+FYYK   + QR ++    L+  +  I K    +E 
Sbjct: 338 LFKQFKIKESL-GKKQQDEFLSKLLFYYKNMTEEQRLEVLVKFLKTRRKLIMKGFRNIEQ 396

Query: 415 SDKVL--ETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLECLKN 472
            + VL  + L TS    F  E+QLL+LED + + G  + L ++ +YY+LGIK K   LK 
Sbjct: 397 LESVLSQQDLPTS---GFAIESQLLRLEDCIDIHGVSKALQDEVQYYVLGIKQKTTALKE 453

Query: 473 YLRNL 477
           +L+ L
Sbjct: 454 FLKQL 458

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  191 bits (486), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 140/472 (29%), Positives = 221/472 (46%), Gaps = 92/472 (19%)

Query: 5   VWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDES--PVFAFPLFNDWYLV 62
           VW+E+ APNG+KYY+N       WD P +        + Q++ S  P +  PL N W LV
Sbjct: 4   VWREYRAPNGKKYYHNTTTGETTWDSPYT-------RKPQRELSIKPQYVIPLLNAWNLV 56

Query: 63  ISSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYEEI 122
           I + G KFY N  +   VL L D  +++LL  +D++KLILL+GVARG+      +VY  +
Sbjct: 57  ICNNGAKFYLNP-DGDPVLTLDDADSSELLSLVDREKLILLIGVARGYHCTSGDKVYNSV 115

Query: 123 MENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSSSDEEVDIR 182
           +E + F+K++++N+   L                                    EE +++
Sbjct: 116 LEEISFLKDDLANDKAPLA-----------------------------------EERELQ 140

Query: 183 EDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYFQLFEKYQL 242
           E+        E N+Q        V    +  +  +       D +A++  YF LF +Y L
Sbjct: 141 EEPL------ETNVQSEPVPSALVSGYGSSSDGSDDEEEVPPDTDANRISYFNLFSEYGL 194

Query: 243 NSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKDDQTDSSGA 302
           + +S WS +S  + +DP F++I+D+  RE+IFEEWC        S    D +D+  SSG 
Sbjct: 195 DKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCC-------SGVVDDSEDEGYSSG- 246

Query: 303 HSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFXXXXXXXXXXXXXXX 362
                             +++L PTKYHYLS I++K+ ++P TIF               
Sbjct: 247 ------------------DDDLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFKQYG 288

Query: 363 XNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHVVEHSDKVLETL 422
             +F+ SKR+ E F S+L+FYYKKF   +R  +F   + +++T         +D      
Sbjct: 289 IKQFL-SKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAESRTGTVPSPTSPAD------ 341

Query: 423 NTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLECLKNYL 474
            ++  ED   ET LL++E  L  +     + ++  YY L IK K   L   L
Sbjct: 342 -SATPEDI--ETNLLQMESHLPPT-----VLDNTVYYTLDIKTKQSVLHRML 385

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  192 bits (489), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 148/480 (30%), Positives = 242/480 (50%), Gaps = 72/480 (15%)

Query: 5   VWKEFIAPNGQKYYYNLXXXXXXWDEPE----SLFEGNA-VSQGQKDESPVFAFPLFNDW 59
           VW+EF  P G+KYYYN       W++P     S  E +A VSQ ++   P FA  L + W
Sbjct: 4   VWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIER--MPTFALELIDGW 61

Query: 60  YLVISSLGKKFYFNAVENISVLELHDELNTQ---LLQSIDKQKLILLVGVARGFIYDE-- 114
           +L+I + G K YFN    I   ++  E   +   L++S+DK KL+LL+G+ARG+   E  
Sbjct: 62  HLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEED 121

Query: 115 YLQVYEEIMENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSS 174
             +++E + E +D  K       +E++        +S        L  +  G+++ Y SS
Sbjct: 122 IDKIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSL-------LSESHTGLISGYGSS 174

Query: 175 SDEEVDIREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEK-- 232
           S+EE +  E++  E D AE  + QN  I             ++LN ++  D +  +E+  
Sbjct: 175 SEEEEEEEEEE-EEEDHAEQGVNQNVSII------------DDLNHIDADDIDEGRERSL 221

Query: 233 YFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVD 292
           +FQL ++Y+L+ FSTWS QSK + +DP+FY I D+++RE +FEEWC +            
Sbjct: 222 FFQLCDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEK------------ 269

Query: 293 KDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKA-NISPDTIFXXXX 351
                     HS+ E       +D  +E   LEPTKYHYL+ I++KA NI+PD I     
Sbjct: 270 ----------HSAKE-------SDSEDESNVLEPTKYHYLAQIVAKAGNIAPDAIPQDIR 312

Query: 352 XXXXXXXXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHV 411
                        +++  KR+ + F S+L+FYYK F+  QR+ IF+  L  ++      +
Sbjct: 313 KRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQDCLWDHERDFGGAI 372

Query: 412 --VEHSDKVLETLNTSVNEDFEK---ETQLLKLEDILGLSGSLEKLANDPKYYILGIKDK 466
             +   +K++      + +  +    E  LL +E+   +S     +  DP+YY++GI +K
Sbjct: 373 ASLRQDNKLISRWQALLEDPIDGTSIEDVLLSIENRCCVSAI---VVADPRYYVVGILEK 429

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score =  178 bits (451), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 155/506 (30%), Positives = 271/506 (53%), Gaps = 47/506 (9%)

Query: 4   RVWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGN-------AVSQGQKDESPVFAFPLF 56
           R+WKE+  PNG+KYYYN+      W++P S ++ N       A+ Q   +    FAF L 
Sbjct: 10  RIWKEYKTPNGKKYYYNIETKQSTWEKPFSFYKTNKNNSNTKALGQTHHEIENKFAFKLL 69

Query: 57  NDWYLVISSLGKKFYFNAVENISVLEL-----HDELNTQLLQSIDKQKLILLVGVARGFI 111
           N+WYL++ S G KFY+NA  N SVL+L      ++L+  L++ +DK  LI L+G+ RG+ 
Sbjct: 70  NEWYLILRSDGSKFYYNARSNRSVLKLVEDKEDEKLSFDLMKYLDKNNLIKLIGLIRGY- 128

Query: 112 YDEYLQV---YEEIMENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIV 168
            D  + +   YEEI+ N+ F+K +I  E  E++     E EE  +K++  D ++   G +
Sbjct: 129 NDPSIDIKGLYEEIVANIGFLKQDILTEQMEIEDGGEDEEEEEEEKEEKEDDVS---GKI 185

Query: 169 NDYYSSSDEEVDIREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETL---- 224
                SS ++ D+  +  N+ D    +  + +         + +     LN++ +     
Sbjct: 186 EG--KSSGDDKDVEGNASNKPDNISTDEMREEEGEERFEDEDDNDELNTLNNLTSKGGEE 243

Query: 225 ---DFNAS----KEKYFQLFEKYQLNSFSTWSNQSKVVMDDPD-FYLITDNSLREDIFEE 276
              + NAS    K+ +F+L +K +L+ +STWS QS+ +++ P  FY I+++S RE+IFE+
Sbjct: 244 GEDNINASVQKVKQAFFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFED 303

Query: 277 WC-SRKHSHHNSITSVDKDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHI 335
           WC +R HS     ++V +++  D+    S  E+  +D   D ++++++LEPTKYHYLS +
Sbjct: 304 WCRNRVHSTGLYSSNVKENNDGDTLVRGSYYEE--EDKDDDDDDDDDDLEPTKYHYLSEL 361

Query: 336 ISKA--NISPDTIFXXXXXXXXXXXXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRR 393
           I K   +I+  +IF                  +I  K++LE   S L+FYYKK  + +R 
Sbjct: 362 IFKLRDSINERSIFQDIKRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYKKLSEQERC 421

Query: 394 DIFEGILEQNKTAINKHVVEHSDKVLETLNTSVNE---DFEKETQLLKLEDILGLSG--- 447
           D F+  + ++     K   E  +K+LE  +++  E   D + E ++L++E+++  SG   
Sbjct: 422 DKFQEYVTKHYGEKIKLHHEELNKILEPSSSADAEAEADVDIEKEILQIENVILRSGDDH 481

Query: 448 -SLEKLANDP--KYYILGIKDKLECL 470
             +    + P  +YYI+G++ K   L
Sbjct: 482 VPVTAAVDTPGLEYYIIGLRAKHSAL 507

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score =  164 bits (414), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 138/489 (28%), Positives = 224/489 (45%), Gaps = 102/489 (20%)

Query: 2   KIRVWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDES--------PVFAF 53
           + ++WKE+ APNG KYYYN       W +P++          QKDE+        P+ AF
Sbjct: 5   RSKLWKEYTAPNGLKYYYNTKTQETTWTKPDT---------EQKDETADKEIEIKPLVAF 55

Query: 54  PLFNDWYLVISSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGF-IY 112
            L   W L+I S G K Y+N  E+    ++      +L+  ++K +L+LL+G+ RG+   
Sbjct: 56  ELLAGWALIIFSDGSKKYYNCNESQWSRKISHPECLKLIDLLNKDRLLLLIGIIRGYRCR 115

Query: 113 DEYLQVYEEIMENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYY 172
                +  EI E++DF++ ++         N A+ SE+        +L  T N ++  YY
Sbjct: 116 TNAKDLVNEIREDIDFIREDM---------NAAKTSEDMKSGSTVNNLENTKNALLG-YY 165

Query: 173 SSSDEEVDIREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNAS--- 229
           SS DEE   + D+                   + +  E D      N++E  D       
Sbjct: 166 SSDDEEEPAKRDE-------------------QAVVEEPD----ETNTLEVPDITQELGQ 202

Query: 230 --KEKYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNS 287
             K+ YF LF K++LN +STW  +S+ V  DP+FY I D+++RE+IFEEWC+      N 
Sbjct: 203 DIKDSYFALFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWCNAGSVESNE 262

Query: 288 ITSVDKDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIF 347
            +    DDQ                            EPTKYHYLS +++  ++ PDTI 
Sbjct: 263 ESGDPGDDQ---------------------------FEPTKYHYLSQLVANYDLKPDTIP 295

Query: 348 XXXXXXXXXXXXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAI 407
                            K  T+K +   F SK++ +YK      R+ +F+  +  ++  +
Sbjct: 296 EDIIKDKKLIKKYRI--KDYTTKSEQRQFLSKMLAWYKHMSLEDRKQMFQTYI--DRIPV 351

Query: 408 NKHVVEHSDKVLETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKL 467
            K+           +++   ED   E+QLL+LE+ LG+  S     ND +YY + ++ K 
Sbjct: 352 GKYT---------DIDSDAQEDV--ESQLLELENQLGIPTS----ENDLEYYCIDLRSKR 396

Query: 468 ECLKNYLRN 476
           + L + +RN
Sbjct: 397 DILLSTIRN 405

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  138 bits (347), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 147/259 (56%), Gaps = 24/259 (9%)

Query: 224 LDFNASKEKYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHS 283
           + +++   ++  LF++Y+LN +S+WS QS+ V  DP+FY + D+  R ++FE+WC+ K +
Sbjct: 81  VGYDSEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLA 140

Query: 284 HHNSITSVDKDDQTDSSGAHSSAE--DNLDDNVADQNEEEENLEPTKYHYLSHIISKANI 341
                           +G  SSA      ++   D ++E+E+LEP K+HYLSHI+SK+ I
Sbjct: 141 ---------------KAGGDSSASLTGEEEEEEDDDDDEDESLEPVKFHYLSHIVSKSTI 185

Query: 342 SPDTIFXXXXXXXXXXXXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILE 401
            P T+F                ++    K++   F S L+FYYKK    +R +IF+ +L+
Sbjct: 186 KPQTVFSDVKTENKLLFKNFNIDE-THPKQEQRQFVSSLLFYYKKKSSKERVEIFKNLLD 244

Query: 402 QNKTAINKHVVEHSDKVLETLNTS--VNEDFEKETQLLKLEDILGLSGSLEKLANDPKYY 459
              T + KH + + D++ + L+     N+ +E E+QL+ +E  +G+  SL +L  D KYY
Sbjct: 245 ---TKV-KHEINNEDQLQQILDQENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYY 300

Query: 460 ILGIKDKLECLKNYLRNLT 478
           ++G++DK   +K +LR++ 
Sbjct: 301 VVGVRDKTILIKEFLRHMV 319

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score =  132 bits (331), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 75/254 (29%), Positives = 130/254 (51%), Gaps = 29/254 (11%)

Query: 227 NASKEKYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHS-HH 285
           +  K + + LFE+ +L+ +S W  +S  +  D  FY + D+  R+++FE+WC+RK +   
Sbjct: 94  DGKKAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADEG 153

Query: 286 NSITSVDKDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDT 345
           N++                            +  EE  L PT++HYL+HI+SK+ + PDT
Sbjct: 154 NAVLE------------------------DGEEAEEVELVPTRFHYLAHIVSKSTVRPDT 189

Query: 346 IFXXXXXXXXXXXXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKT 405
           ++                +  I  K++   F + L+FYYKK D + R ++F  +L  ++ 
Sbjct: 190 VYSDVRREHKELFDQLEVD--ILDKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRA 247

Query: 406 AINKHVVEHSDKVLETL--NTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGI 463
           AI    +E+  ++ E L  +    + +  ET L  +E  +GL G+L KL ++ KYY+LG+
Sbjct: 248 AITAAFLENDAQLRELLEYDELPQDSYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGV 307

Query: 464 KDKLECLKNYLRNL 477
           KDKL  +K  LR +
Sbjct: 308 KDKLVVMKEVLREM 321

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 23/45 (51%)

Query: 5  VWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESP 49
          VWK   + +G+ YYYN       WD+P+++   +   +G +   P
Sbjct: 2  VWKRAKSEDGKAYYYNTETNETTWDKPDAVEPSDGEERGDERARP 46

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score = 97.4 bits (241), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 86/144 (59%), Gaps = 10/144 (6%)

Query: 4   RVWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVI 63
           ++W+E+ APNG+KYYYN+      W +P    E      G   E   FAF LF+ WYL+I
Sbjct: 5   KLWREYKAPNGRKYYYNVKTKETTWTKP---VEEEKPEPGDNKEVK-FAFELFDGWYLLI 60

Query: 64  SSLGKKFYFNAVENISVLELH----DELNTQLLQSIDKQKLILLVGVARGFIYDEY--LQ 117
              G K ++++V   S LE       E N ++++ +DK+K+ILL+G+ RGF  D Y    
Sbjct: 61  RGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHIKG 120

Query: 118 VYEEIMENLDFVKNEISNEYKELQ 141
           VY++I ++++F+K EI N+  EL+
Sbjct: 121 VYDDIAQDINFLKQEILNDAMELE 144

 Score = 90.1 bits (222), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 118/244 (48%), Gaps = 36/244 (14%)

Query: 230 KEKYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSIT 289
           K++ F LFE + L+ +STWS QS+ + +  D++L+ D++ RE++FE+WC+ K +      
Sbjct: 187 KDRLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVAQLPEDE 246

Query: 290 SVDKDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKAN--ISPDTIF 347
           S                             E+++ EPTKYHYLS I+ +    I+ DT+ 
Sbjct: 247 S---------------------------EAEDDDYEPTKYHYLSEIMYQLRDEINADTVA 279

Query: 348 XXXXXXXXXXXXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAI 407
                            +FI  +R+L +  S+L+FYYK+F   +RR +F   + Q    +
Sbjct: 280 DDILRGHRPLFKQYHIKQFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQRYGLL 339

Query: 408 NKHVVEHSDKVLETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKL 467
               V++ D        S++ + + ET++L+ E      G+        +YY++G+++K 
Sbjct: 340 PGEDVDNDDA------GSLSGE-QMETRILQWERDRQTEGNSSWDPTALEYYVVGLREKY 392

Query: 468 ECLK 471
             L+
Sbjct: 393 IGLR 396

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 98/247 (39%), Gaps = 58/247 (23%)

Query: 232 KYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSV 291
           ++F+L ++  ++ +S W  ++K + DDP FY I  +  RE +FE+WC  K          
Sbjct: 74  QFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCYGK---------- 123

Query: 292 DKDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFXXXX 351
                      HS  E+     +A             YH L+ +I   +I  +TI+    
Sbjct: 124 ----------LHSREEETTQPQLA---------LALPYHDLAEMICCFDIQSNTIYKDIR 164

Query: 352 XXXXXXXXXXXXNKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHV 411
                            SK + E F +KL+   K  D +  + +FE +LE+N        
Sbjct: 165 KANKKMVRQIDEK---ISKNEQEKFGTKLLGILKYHDDASCQGLFEQVLEENGV------ 215

Query: 412 VEHSDKVLETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIKDKLECLK 471
               D+V       VN  FE    L+ LE  +G++ +   ++ D +Y+         CL+
Sbjct: 216 ----DRV------DVNTSFETLADLVDLERRMGIT-TENSVSRDARYF---------CLR 255

Query: 472 NYLRNLT 478
           N  R   
Sbjct: 256 NASRRFA 262

>KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649
           YKL012W
          Length = 556

 Score = 37.4 bits (85), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 109/279 (39%), Gaps = 55/279 (19%)

Query: 6   WKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVISS 65
           WK    P G+ YYYN       W++P++  E +               P  NDW    + 
Sbjct: 4   WKAAKDPKGRIYYYNTVTKKSTWEKPKNFAEPDQ--------------PSANDWKTGKTK 49

Query: 66  LGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYEEIMEN 125
            GK +Y+N     S   L  E+  +  +     K                    E+I+EN
Sbjct: 50  DGKTYYYNVKTRESRWTLPPEMKQEEKEEARPNK------------------DSEKIVEN 91

Query: 126 LDFVKNEISNEYKELQVNVAQESEESAD-------KQDPGDLIATDNGIVNDYYSSSDEE 178
           L    ++  N+ K L  NVA   +E A+       K +  D   + N I+++  ++    
Sbjct: 92  LTSSNDKYKNDSKIL--NVASLPKEQAEPIFMQMLKDNQVDSTWSFNRIISELSTTDARY 149

Query: 179 VDIREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYFQL-F 237
             + +D   +  + E  L           RTE    +E+    ET  F  + +K      
Sbjct: 150 WCVDDDPVWKQQVFEKYLSN---------RTEDQLLKEH---SETNKFKQAFDKLLASNV 197

Query: 238 EKYQLNSFSTWSNQSKVVMDDPDF-YLITDNSLREDIFE 275
           +  +L  ++TWS+  K+++D+P + + + D  ++   FE
Sbjct: 198 QSGKLTEYTTWSSFKKIILDEPIYKHSVIDEGIKRKAFE 236

>Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar to
          Ashbya gossypii ADR159C
          Length = 575

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 33/78 (42%), Gaps = 13/78 (16%)

Query: 6  WKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVISS 65
          WKE I P G+ YYYN       W +P+ +            E  + A  L   W +  + 
Sbjct: 4  WKETIDPEGRVYYYN-SKGETTWHKPKEM------------EVVLDAILLKQGWKVASTE 50

Query: 66 LGKKFYFNAVENISVLEL 83
           GK +Y+N   N S  EL
Sbjct: 51 DGKVYYYNKNTNESTWEL 68

>Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012W
          (REAL)
          Length = 585

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 12/69 (17%)

Query: 6  WKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVISS 65
          WKE    NG+ YYYN       W++PE L     VSQ ++           N W    ++
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSIWEKPEEL-----VSQQEQ-------LLQENGWKAAKTA 51

Query: 66 LGKKFYFNA 74
           GK +Y+N 
Sbjct: 52 EGKIYYYNP 60

>TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa]
          {ON} Anc_2.649 YKL012W
          Length = 658

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 30/78 (38%), Gaps = 9/78 (11%)

Query: 6  WKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPV---------FAFPLF 56
          WK+   P G+ YYYNL      WD P+S    N     +K  S             F   
Sbjct: 5  WKQAKDPKGRVYYYNLKTKESRWDLPKSSTGTNKSISTEKQVSVKKNELKNKIDLEFLKL 64

Query: 57 NDWYLVISSLGKKFYFNA 74
          + W    +  G+ +Y+N 
Sbjct: 65 HGWRTAQTKEGRIYYYNV 82

>TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa]
          {ON} Anc_2.649 YKL012W
          Length = 570

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 12/70 (17%)

Query: 6  WKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVISS 65
          WKE +   G+ YYYN       W++P+ LF          +E  V    L + W    ++
Sbjct: 7  WKEALDDKGRTYYYNAKNGESRWEKPQELF---------TEEELVL---LKHGWKSSRTA 54

Query: 66 LGKKFYFNAV 75
           GK +Y+N++
Sbjct: 55 EGKIYYYNSI 64

>NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON}
          Anc_2.649
          Length = 604

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 6/80 (7%)

Query: 6  WKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVISS 65
          W+     NG+ YYYN+      WD P S+ EG+       D+S          W   +++
Sbjct: 11 WRSAKDANGRTYYYNINTKESRWDRPASM-EGST----NNDDSDKMLLEQIG-WKSNVTN 64

Query: 66 LGKKFYFNAVENISVLELHD 85
           GK +Y+N     S  +++D
Sbjct: 65 EGKVYYYNLKTGESRWDVND 84

>ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 570

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 33/81 (40%), Gaps = 12/81 (14%)

Query: 5  VWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVIS 64
          +WKE    +G+ YYYN       W++P  L     +   +            + W    +
Sbjct: 6  LWKEAKDTSGRIYYYNAKTGESKWEKPRELLSEQELILAK------------HGWKSSKT 53

Query: 65 SLGKKFYFNAVENISVLELHD 85
          S GK +Y+NA    S  EL D
Sbjct: 54 SDGKLYYYNAQTKTSRWELPD 74

>KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 564

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 7/55 (12%)

Query: 6  WKEFIAPNGQKYYYNLXXXXXXWDEPESLF-------EGNAVSQGQKDESPVFAF 53
          WKE     G+ YYYN       WD+P  LF       E +    G+ DE  V+ +
Sbjct: 4  WKEANDAEGRVYYYNADSGETTWDKPRELFTQLELKLEKHGWKTGKTDEGQVYYY 58

>TDEL0B05940 Chr2 (1050753..1050830,1050892..1052037) [1224 bp, 407
           aa] {ON} Anc_1.412 YCL008C
          Length = 407

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 64/133 (48%), Gaps = 19/133 (14%)

Query: 54  PLFNDWYLVISSLGKKF---YFNAVENISV----LELHDELNTQLLQSIDKQKLILLVGV 106
           PL     L+ S LG K    +  A+EN+      L LHD  + Q  Q+I+ +KL +   +
Sbjct: 224 PLTYSANLLDSELGAKHDLRHKKALENLQRTLNELTLHDSHSVQ--QNIEARKLAIEAAI 281

Query: 107 ARGFIYDEY----LQVYEEIMENLDFVKNEISNEYK--ELQVNVAQESEE-SADKQDPGD 159
            +  +  +Y    LQ   + +EN   V   +S E +  ELQ    Q+ EE   +  DP  
Sbjct: 282 KQFELTLDYEKASLQRTFKAIENTTTV---LSRETQNIELQAEQVQKYEEIHGETPDPSS 338

Query: 160 LIATDNGIVNDYY 172
           L+AT+N ++N  Y
Sbjct: 339 LMATENAVLNQLY 351

>Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON}
          (4004..5596) [1593 nt, 531 aa]
          Length = 530

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 32/79 (40%), Gaps = 12/79 (15%)

Query: 5  VWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVIS 64
          +WKE    NG+ YYYN       W++P        V    K E  +      N W +  S
Sbjct: 4  IWKEAKDNNGRVYYYNSKTGESRWEKP--------VEAPSKQEQLLKK----NGWSIGKS 51

Query: 65 SLGKKFYFNAVENISVLEL 83
            GK +Y+N     S  EL
Sbjct: 52 KAGKIYYYNTKTGESSWEL 70

>Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012W
          (REAL)
          Length = 579

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 12/73 (16%)

Query: 3  IRVWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLV 62
          + +WKE    NG+ YYYN       W++P+ L     VS+ ++           N W   
Sbjct: 1  MSIWKEAKDANGRVYYYNSLTKKSTWEKPKEL-----VSEEEQ-------LLRENGWRAA 48

Query: 63 ISSLGKKFYFNAV 75
           +  GK +Y+N  
Sbjct: 49 KTKEGKVYYYNPA 61

>Suva_13.338 Chr13 complement(553692..554105) [414 bp, 138 aa] {ON}
           YMR159C (REAL)
          Length = 138

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%)

Query: 371 RDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHVVEHSDKVLETLNTSVNEDF 430
           R L++     +   +  D++ R      + + N  A+  + + H D +L+TL     E  
Sbjct: 8   RTLQTGVMDELLIARLLDRNNRETHLSELFQDNSGAVGGNTIHHDDALLKTLTVLQQELK 67

Query: 431 EKETQLLKLEDILGL 445
            KE ++ KL++++GL
Sbjct: 68  SKEQEIRKLKEVIGL 82

>Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012W
          (REAL)
          Length = 583

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 12/70 (17%)

Query: 6  WKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVISS 65
          WKE    NG+ YYYN       W++P  L     VS+ ++           N W    ++
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSTWEKPTQL-----VSKQEQ-------LLQENGWRAAKTA 51

Query: 66 LGKKFYFNAV 75
           GK +Y+N  
Sbjct: 52 EGKVYYYNTT 61

>YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1
          snRNP protein involved in splicing, interacts with the
          branchpoint-binding protein during the formation of the
          second commitment complex
          Length = 583

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 32/73 (43%), Gaps = 12/73 (16%)

Query: 3  IRVWKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLV 62
          + +WKE    +G+ YYYN       W++P+ L     +SQ +            N W   
Sbjct: 1  MSIWKEAKDASGRIYYYNTLTKKSTWEKPKEL-----ISQEE-------LLLRENGWKAA 48

Query: 63 ISSLGKKFYFNAV 75
           ++ GK +Y+N  
Sbjct: 49 KTADGKVYYYNPT 61

>TPHA0J01350 Chr10 complement(316134..316796) [663 bp, 220 aa] {ON}
           Anc_5.663 YOR062C
          Length = 220

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 7/111 (6%)

Query: 220 SVETLDFNASKEKYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCS 279
           S E +D+N +  KYF +   Y+ N ++          DDP  Y I    L   +F +W  
Sbjct: 36  SPENIDYNLTYAKYFNVLNTYKSNIYNEKIRLPSCSSDDPLDYTIYLKRLINCVFRKWSM 95

Query: 280 RKHSHHNSITSVDKDDQTDSS-----GAHSSAED--NLDDNVADQNEEEEN 323
           +  +  + +  +D + + DS      G   +  D   +D N+A    E  N
Sbjct: 96  KLFNRKDKVDPLDINWKKDSDITVLYGPDLALSDFKYIDINIAPNKSESPN 146

>Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W
          (PRP40) - U1 snRNP protein [contig 244] FULL
          Length = 562

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%)

Query: 6  WKEFIAPNGQKYYYNLXXXXXXWDEPESLF 35
          W E   P G+ YYYN       WD+P  L+
Sbjct: 4  WNEAHDPEGRVYYYNSESGETTWDKPRELY 33

>CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012w PRP40 splicing factor
          Length = 590

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 29/68 (42%), Gaps = 12/68 (17%)

Query: 6  WKEFIAPNGQKYYYNLXXXXXXWDEPESLFEGNAVSQGQKDESPVFAFPLFNDWYLVISS 65
          WK+    NG+ YYYN       WD+P  + +   + Q  +D            W +  + 
Sbjct: 5  WKKATDSNGKVYYYNTVTKESRWDKP--VEDTTDLKQKLRDAG----------WNVAKTK 52

Query: 66 LGKKFYFN 73
           GK +Y+N
Sbjct: 53 EGKVYYYN 60

>Skud_11.39 Chr11 complement(75575..77815) [2241 bp, 746 aa] {ON}
           YKL187C (REAL)
          Length = 746

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 273 IFEEWCSRKHSHHNSITSVDKDDQ--TDSSGAHSSAEDNLDDNVAD 316
           I+  W +R+   + S  +++K+ +  T   GA  SA DNLDD  AD
Sbjct: 644 IYTWWRNRRTGRYASAAALNKNGEKYTYGDGAAISAGDNLDDESAD 689

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,884,151
Number of extensions: 2739923
Number of successful extensions: 17899
Number of sequences better than 10.0: 593
Number of HSP's gapped: 18403
Number of HSP's successfully gapped: 653
Length of query: 478
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 365
Effective length of database: 40,524,141
Effective search space: 14791311465
Effective search space used: 14791311465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)