Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0A018408.254ON68568531980.0
Kpol_543.358.254ON65868623820.0
NCAS0B049708.254ON66668322330.0
Smik_12.1428.254ON66367922000.0
YLR083C (EMP70)8.254ON66768421950.0
Suva_10.1678.254ON68468521880.0
NDAI0B023708.254ON72269821840.0
YDR107C (TMN2)8.254ON67268921550.0
Suva_2.2678.254ON67267921520.0
Smik_4.3538.254ON69068721540.0
Skud_12.1518.254ON66468421360.0
CAGL0B01683g8.254ON69168621300.0
KAFR0B026808.254ON66467421070.0
KNAG0G019908.254ON66767420850.0
ZYRO0C01848g8.254ON64768720780.0
Skud_4.3688.254ON67269320610.0
TBLA0E043708.254ON67667920530.0
TBLA0H014508.254ON67368419820.0
Kwal_56.235778.254ON68367719780.0
KLTH0G13882g8.254ON68769319730.0
SAKL0H17248g8.254ON66067619580.0
NCAS0B038908.254ON66368918830.0
TDEL0F038108.254ON65668718470.0
AGR097W8.254ON65368017750.0
NDAI0J014208.254ON61964617440.0
KLLA0F18931g8.254ON66545415290.0
Ecym_43178.254ON60545911841e-154
YER113C (TMN3)7.411ON7067313615e-35
Skud_5.2667.411ON7077133278e-31
NDAI0A015107.411ON6794972752e-24
NCAS0A145207.411ON6704972653e-23
Smik_5.2587.411ON7065202654e-23
KNAG0C034307.411ON6805102459e-21
Suva_5.2347.411ON7065132441e-20
TDEL0C027107.411ON6784992422e-20
ZYRO0B03784g7.411ON6584872323e-19
SAKL0F12914g7.411ON7075382281e-18
CAGL0G03487g7.411ON7045152243e-18
KLLA0E20835g7.411ON6764972137e-17
KAFR0K019507.411ON6645011993e-15
Kwal_27.107467.411ON6903811744e-12
KLTH0C06226g7.411ON6945371583e-10
TBLA0I003307.411ON7133101378e-08
Kpol_1045.287.411ON6815011252e-06
Ecym_71437.411ON6765291234e-06
TPHA0K007307.411ON7331521145e-05
AGL295C7.411ON6571511092e-04
TPHA0H013605.670ON68668800.52
KLLA0E12937gsingletonON20745751.0
KAFR0I010304.111ON186116705.0
TPHA0L004607.81ON110157716.9
Kpol_233.27.81ON116557708.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0A01840
         (685 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...  1236   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   922   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   864   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   852   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   850   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   847   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   845   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   834   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   833   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   834   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   827   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   825   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   816   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   807   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   805   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   798   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   795   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   768   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   766   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   764   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   758   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    729   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   716   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   688   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   676   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   593   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   460   e-154
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   143   5e-35
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   130   8e-31
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   110   2e-24
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   106   3e-23
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   106   4e-23
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...    99   9e-21
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...    99   1e-20
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...    98   2e-20
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...    94   3e-19
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...    92   1e-18
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...    91   3e-18
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...    87   7e-17
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...    81   3e-15
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    72   4e-12
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    65   3e-10
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    57   8e-08
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    53   2e-06
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    52   4e-06
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    49   5e-05
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    47   2e-04
TPHA0H01360 Chr8 (305160..307220) [2061 bp, 686 aa] {ON} Anc_5.6...    35   0.52 
KLLA0E12937g Chr5 (1145337..1145960) [624 bp, 207 aa] {ON} no si...    33   1.0  
KAFR0I01030 Chr9 (200672..201232) [561 bp, 186 aa] {ON} Anc_4.11...    32   5.0  
TPHA0L00460 Chr12 (75852..79157) [3306 bp, 1101 aa] {ON} Anc_7.8...    32   6.9  
Kpol_233.2 s233 (3798..7295) [3498 bp, 1165 aa] {ON} (3798..7295...    32   8.4  

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score = 1236 bits (3198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/685 (90%), Positives = 618/685 (90%)

Query: 1   MRCSYLLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESR 60
           MRCSYLLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESR
Sbjct: 1   MRCSYLLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESR 60

Query: 61  EKMLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSIT 120
           EKMLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSIT
Sbjct: 61  EKMLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSIT 120

Query: 121 IPGSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGL 180
           IPGSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGL
Sbjct: 121 IPGSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGL 180

Query: 181 GIPMDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISKLVHNVEFPYLA 240
           GIPMDA                                   REPKRISKLVHNVEFPYLA
Sbjct: 181 GIPMDAKTKDSGKKNSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRISKLVHNVEFPYLA 240

Query: 241 NHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGNKLFLDEKKDNEVTFSYSVNFI 300
           NHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGNKLFLDEKKDNEVTFSYSVNFI
Sbjct: 241 NHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGNKLFLDEKKDNEVTFSYSVNFI 300

Query: 301 ESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFNL 360
           ESETVWATRWDKYLHTYNPTIQWFSLVNFSII             KALKSDFARYEEFNL
Sbjct: 301 ESETVWATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFNL 360

Query: 361 DNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGS 420
           DNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGS
Sbjct: 361 DNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGS 420

Query: 421 LPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLF 480
           LPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLF
Sbjct: 421 LPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLF 480

Query: 481 VHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWY 540
           VHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWY
Sbjct: 481 VHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWY 540

Query: 541 LKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXIT 600
           LKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFG                   IT
Sbjct: 541 LKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLIT 600

Query: 601 YQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSC 660
           YQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSC
Sbjct: 601 YQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSC 660

Query: 661 IVTGAVGFISSMIFVRKIYSNVRVD 685
           IVTGAVGFISSMIFVRKIYSNVRVD
Sbjct: 661 IVTGAVGFISSMIFVRKIYSNVRVD 685

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/686 (65%), Positives = 527/686 (76%), Gaps = 31/686 (4%)

Query: 1   MRCSYLLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-S 59
           M+  + L++  ++  +AFYLPGVAP+TY +GDE+PLLVNHLTPSLN+Q KDD G  ++ +
Sbjct: 3   MKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGN 62

Query: 60  REKMLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSI 119
           +E  LYSFDYYFPKLHFCKPE + KQP+SLGSILFGDRIYNSPFSIKML+ +    LC +
Sbjct: 63  KEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKV 122

Query: 120 TIPGSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGG 179
           TIP  DAKFINKLIKNGFFQNWLIDGLPAARK++D  T ++FY  GFPLG V +++ VGG
Sbjct: 123 TIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGG 182

Query: 180 LGIPMDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISKLVHNVEFPYL 239
           L                                         RE K ++ +VHNVE P+L
Sbjct: 183 LA------------------------------SSKLNLENPAREAKNVNNMVHNVEIPFL 212

Query: 240 ANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGNKLFLDEKKDNEVTFSYSVNF 299
            NHY INVE HDRGEGNYRVVGVTVDP S+T     +K   L L E +DNEV FSYSV F
Sbjct: 213 FNHYDINVEYHDRGEGNYRVVGVTVDPKSSTGDICTKKSGGLILLETEDNEVQFSYSVRF 272

Query: 300 IESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFN 359
           I SETVWATRWDKYLH Y+PTIQWFSL+NFS++             +ALKSDFARYEEFN
Sbjct: 273 IPSETVWATRWDKYLHVYDPTIQWFSLINFSVVVILLSMVVIHSLMRALKSDFARYEEFN 332

Query: 360 LDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRG 419
           LD++F +DSGWKLGHGDVFRIP +SMLLSILVGSG QLFLM+  SIF AAIGI+SPSSRG
Sbjct: 333 LDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRG 392

Query: 420 SLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLL 479
           SLPSAMF  YALFGF GSY+SM VYKFF GPYWKANMILTP+LVPG + +SI+GLNFFLL
Sbjct: 393 SLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLL 452

Query: 480 FVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSW 539
           F  SSGTIP TAL+ ++V+WF+IS+PLS  GSL+ANK+ NWGEHPTKTN+IARQIPFQ W
Sbjct: 453 FSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPW 512

Query: 540 YLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXI 599
           YLKT+PA LIAG+FPFG+IAVELYFIY+SLWFNKIFYMFG                   I
Sbjct: 513 YLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTTLVTILI 572

Query: 600 TYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILS 659
           TY SL +ENW WQWRSF +GGVGC+ YIF+HSI+FTKFKLGGFTT++LY+GY+L++S L 
Sbjct: 573 TYYSLNLENWRWQWRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALC 632

Query: 660 CIVTGAVGFISSMIFVRKIYSNVRVD 685
            +VTGA+GFISSM+FV+KIYS+V+VD
Sbjct: 633 AVVTGAIGFISSMLFVKKIYSSVKVD 658

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  864 bits (2233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/683 (61%), Positives = 498/683 (72%), Gaps = 27/683 (3%)

Query: 6   LLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLY 65
           L     +S   AFYLPGVAP+TY+EGDE+PLLVNHLTPS+ +Q+ D  GK  +++E  LY
Sbjct: 8   LFFTFFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS-KNKEHFLY 66

Query: 66  SFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSD 125
           SFDYYF +LHFCKPE I KQP+SLGSI+FGDRIYNSPF +KML+ +  V LC  TIPG D
Sbjct: 67  SFDYYFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKD 126

Query: 126 AKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMD 185
           AKFINKLIKNGFFQNWLIDGLPAA ++YD  T +EFY  GF LGFVE  + + G      
Sbjct: 127 AKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDG------ 180

Query: 186 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISKLVHNVEFPYLANHYVI 245
                                               RE K + ++V N+E  Y  NHY I
Sbjct: 181 ----------------QAPATTKPKQTTNEGLELETREAKNV-QMVKNIEIAYFVNHYDI 223

Query: 246 NVEVHDRGEGNYRVVGVTVDPYS---TTDSANPEKGNKLFLDEKKDNEVTFSYSVNFIES 302
            VE HDRGEG YRVVGV V+P S   +T       G+ L L E  DN+V F+YSV F+ S
Sbjct: 224 QVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPS 283

Query: 303 ETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFNLDN 362
           ETVWATRWDKYLHTY+PTIQWFSLVNFSII             KALKSDFARY EFNL++
Sbjct: 284 ETVWATRWDKYLHTYDPTIQWFSLVNFSIIVLLLSSVVIHSLMKALKSDFARYNEFNLED 343

Query: 363 SFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLP 422
            F ED+GWKLGHGDVFRIP +SMLLS+LVGSG QLFLMI  SIF AA+G +SPSSRGSL 
Sbjct: 344 DFQEDAGWKLGHGDVFRIPHKSMLLSVLVGSGVQLFLMISCSIFFAALGFLSPSSRGSLA 403

Query: 423 SAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVH 482
           + MF  YALFGF GSY SM+VYKFFKGPYWK NM+LTP ++PGFI ++I+GLNFFL+F H
Sbjct: 404 TVMFILYALFGFVGSYTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAH 463

Query: 483 SSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLK 542
           SSG +P   L  ++++WF+ S+PL+F GSL+A+K+  W EHPTKTNQIARQIPFQ WYLK
Sbjct: 464 SSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLK 523

Query: 543 TIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYQ 602
           T PA +IAGIFPFG+IAVELYFIYTSLWFNKIFYMFG                   ITY 
Sbjct: 524 TWPATMIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYH 583

Query: 603 SLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIV 662
           SLC+ENW WQWR F +GGVGC++Y+F+HSILFTKFKLGGF T++LY+GY+ ++S+L C+V
Sbjct: 584 SLCLENWQWQWRGFIVGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVV 643

Query: 663 TGAVGFISSMIFVRKIYSNVRVD 685
           TGA+GF+SS+IFVRKIYS ++VD
Sbjct: 644 TGAIGFLSSLIFVRKIYSAIKVD 666

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/679 (61%), Positives = 489/679 (72%), Gaps = 33/679 (4%)

Query: 12  VSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREKMLYSFDYY 70
           VS   AFYLPGVAP+TY E DE+PLLVNHLTPS+ YQ KD+ G  V   +E  LYS+DYY
Sbjct: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72

Query: 71  FPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFIN 130
             + HFCKPEK+ KQP+SLGSI+FGDRIYNSPF +KML+ +  V LC  TIPG+DAKFIN
Sbjct: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132

Query: 131 KLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAXXXX 190
           KLIKNGFFQNWLIDGLPAAR + D  T T FY  GF LGFVE+ +       P  A    
Sbjct: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTN 192

Query: 191 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISKLVHNVEFPYLANHYVINVEVH 250
                                           + +    +V   E PY  NHY I +E H
Sbjct: 193 QGVEL---------------------------DTRDGHNMVQTYEHPYFTNHYDIRIEYH 225

Query: 251 DRGEGNYRVVGVTVDPYSTTDSANPE----KGNKLFLDEKKDNEVTFSYSVNFIESETVW 306
           DRGEGNYRVVGV V+P S   S +PE     G+ L LDE+ DNEV F+YSV F+ESET W
Sbjct: 226 DRGEGNYRVVGVIVNPVSIKRS-DPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSW 284

Query: 307 ATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFNLDNSFNE 366
           ATRWDKYLH Y+P+IQWFSL+NFS++             +ALKSDFARY E NLD+ F E
Sbjct: 285 ATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQE 344

Query: 367 DSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMF 426
           DSGWKL HGDVFR PS+S+ LSILVGSG QLF M+  SIF AA+G +SPSSRGSL + MF
Sbjct: 345 DSGWKLSHGDVFRAPSRSLTLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMF 404

Query: 427 TFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGT 486
             YALFGF GSY SM +YKFF GPYWKAN+ILTPLLVPG IL+ I+ LNFFL+FVHSSG 
Sbjct: 405 MLYALFGFVGSYTSMGIYKFFDGPYWKANLILTPLLVPGTILIIIIALNFFLMFVHSSGV 464

Query: 487 IPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPA 546
           IP + L  +V +WF+ S+PLSF GSL+A K+ +W EHPTKTNQIARQIPFQ WYLKT+PA
Sbjct: 465 IPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPA 524

Query: 547 ILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYQSLCM 606
            LIAG+FPFG+IAVELYFIYTSLWFNKIFYMFG                   ITY SLC+
Sbjct: 525 TLIAGVFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCL 584

Query: 607 ENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAV 666
           ENW WQWR F +GG GC+LY+FIHSILFTKFKLGGFTT++LY+GY+ ++S+L C+VTG++
Sbjct: 585 ENWKWQWRGFIVGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSI 644

Query: 667 GFISSMIFVRKIYSNVRVD 685
           GFISSM F+RKIYS+++VD
Sbjct: 645 GFISSMFFIRKIYSSIKVD 663

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/684 (60%), Positives = 489/684 (71%), Gaps = 31/684 (4%)

Query: 6   LLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREKML 64
           LL+   VS   AFYLPGVAP+TY E D +PLLVNHLTPS+NYQ KD+ G  V   +E  L
Sbjct: 11  LLLYFFVSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFL 70

Query: 65  YSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGS 124
           YS+DYY+ + HFC+PEK+ KQP+SLGS++FGDRIYNSPF + ML+ +    LC   IPG 
Sbjct: 71  YSYDYYYNRFHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPGD 130

Query: 125 DAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPM 184
           DAKFINKLIKNGFFQNWLIDGLPAAR++YD  T T FY  GF LGFV++ +       P 
Sbjct: 131 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTDIEATPK 190

Query: 185 DAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISKLVHNVEFPYLANHYV 244
            A                                    E +    +V   E PY ANH+ 
Sbjct: 191 GAETTDKDVEL---------------------------ETRNDRNMVKTYELPYFANHFD 223

Query: 245 INVEVHDRGEGNYRVVGVTVDPYSTTDSA---NPEKGNKLFLDEKKDNEVTFSYSVNFIE 301
           I +E HDRGEGNYRVVGV V+P S   S+       G+ L LDE  DNEV F+YSV F E
Sbjct: 224 IMIEYHDRGEGNYRVVGVIVEPVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNE 283

Query: 302 SETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFNLD 361
           S T WATRWDKYLH Y+P+IQWFSL+NFS++             +ALKSDFARY E NLD
Sbjct: 284 SATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLD 343

Query: 362 NSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSL 421
           + F EDSGWKL HGDVFR PSQS+ LSILVGSG QLFLM+  SIF AA+G +SPSSRGSL
Sbjct: 344 DDFQEDSGWKLNHGDVFRSPSQSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSL 403

Query: 422 PSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFV 481
            + MF  YALFGF GSY SM +YKFF GPYWKAN+ILTPLLVPG IL+ I+ LNFFL+FV
Sbjct: 404 ATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFV 463

Query: 482 HSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYL 541
           HSSG IP + L  +V +WF+ S+PLSF GSL+A KR +W EHPTKTNQIARQIPFQ WYL
Sbjct: 464 HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYL 523

Query: 542 KTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITY 601
           KTIPA LIAGIFPFG+IAVELYFIYTSLWFNKIFYMFG                   ITY
Sbjct: 524 KTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITY 583

Query: 602 QSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCI 661
            SLC+ENW WQWR F IGG GC+LY+FIHSILFTKFKLGGFTT++LY+GY+ ++S+L C+
Sbjct: 584 HSLCLENWKWQWRGFIIGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCL 643

Query: 662 VTGAVGFISSMIFVRKIYSNVRVD 685
           VTG++GFISSM+FVRKIYS+++VD
Sbjct: 644 VTGSIGFISSMLFVRKIYSSIKVD 667

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  847 bits (2188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/685 (60%), Positives = 495/685 (72%), Gaps = 12/685 (1%)

Query: 6   LLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREKML 64
            L+  +VS   AFYLPGVAP+TY E DE+PLLVNHLTPS+ YQ +D+ G  V   +E  L
Sbjct: 7   FLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFL 66

Query: 65  YSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGS 124
           YS+DYY+ K HFCKPE + KQP+SLGSI+FGDRIYNSPF + ML+ +  V LC   IPG 
Sbjct: 67  YSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGD 126

Query: 125 DAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPM 184
           DAKFINKLIKNGFFQNWLIDGLPAAR+++D  T T+FY  GF LGFVE+ + V       
Sbjct: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVV------- 179

Query: 185 DAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISK-LVHNVEFPYLANHY 243
           D+                                    + +   K +V   EFPY ANH+
Sbjct: 180 DSETEQVQVASGETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHF 239

Query: 244 VINVEVHDRGEGNYRVVGVTVDPYSTTDSA---NPEKGNKLFLDEKKDNEVTFSYSVNFI 300
            I +E HDRGEGNYRVVGV V+P S   S+       G+ L LDE  DNEV F+YSV F 
Sbjct: 240 DIKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFE 299

Query: 301 ESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFNL 360
           ES T WATRWDKYLH Y+P+IQWFSL+NFS++             +ALKSDFARY E NL
Sbjct: 300 ESPTSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNL 359

Query: 361 DNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGS 420
           D+ F EDSGWKL HGDVFR PSQS++LSILVGSG Q+FLM+  SIF AA+G +SPSSRGS
Sbjct: 360 DDDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGS 419

Query: 421 LPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLF 480
           L + MF  YALFGF GSY SM +YKFF GPYWKAN+I+TPLL+PG IL+ I+ LNFFL+F
Sbjct: 420 LATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMF 479

Query: 481 VHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWY 540
           VHSSG IP + L  +V +WF+ S+PLSF GSL+A K+ +W EHPTKTNQIARQIPFQ WY
Sbjct: 480 VHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWY 539

Query: 541 LKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXIT 600
           LKT+PA LIAGIFPFG+IAVELYFIYTSLWFNKIFYMFG                   IT
Sbjct: 540 LKTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMIT 599

Query: 601 YQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSC 660
           Y SLC+ENW WQWR FT+GGVGC+LY+FIHSILFTKFKLGGFTT++LY+GY+ ++S+L C
Sbjct: 600 YHSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCC 659

Query: 661 IVTGAVGFISSMIFVRKIYSNVRVD 685
           +VTG++GFISSM F+RKIYS+++VD
Sbjct: 660 LVTGSIGFISSMFFIRKIYSSIKVD 684

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/698 (59%), Positives = 500/698 (71%), Gaps = 54/698 (7%)

Query: 6   LLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVES-REKML 64
           LL A  +S   AFYLPGVAP+TY+  DE+PLLVNHLTPS+ +Q K++ GK ++S +E+ L
Sbjct: 61  LLFAFCLSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERFL 120

Query: 65  YSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGS 124
           YS+DYY+ + HFC+PE I KQP+SLGSI+FGDRIYNSPF I ML+ +  V LC  TIPG 
Sbjct: 121 YSYDYYYDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIPGK 180

Query: 125 DAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEI----------- 173
           DAKFINKLIKNGFFQNWLIDGLPAAR++YDS T TEFY  GF LGFV++           
Sbjct: 181 DAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQGTTTGDNAN 240

Query: 174 ---KKNVGGLGIPMDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISKL 230
              KK     G+ +D                                    R+ K + ++
Sbjct: 241 TVAKKPTTNEGLELDT-----------------------------------RDAKNV-QM 264

Query: 231 VHNVEFPYLANHYVINVEVHDRGEGNYRVVGVTVDPYS---TTDSANPEKGNKLFLDEKK 287
           + N E PY ANH+ I VE HDRGE NYRVVGV V+P S   +T       G  L L E +
Sbjct: 265 LKNFELPYFANHFDIQVEYHDRGENNYRVVGVIVNPVSIKRSTPGTCETSGAPLMLSEDQ 324

Query: 288 DNEVTFSYSVNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKA 347
           DN+V F+YSV FI SET+WATRWDKYLH Y+P IQWFSL+NFS++             KA
Sbjct: 325 DNDVYFTYSVKFIPSETIWATRWDKYLHIYDPAIQWFSLINFSVVVLLLSSVVIHSLLKA 384

Query: 348 LKSDFARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFL 407
           LKSDFARY E NLD+ F E++GWKLGHGDVFRIP +S+LLS+LVGSG QLFLMII SIF 
Sbjct: 385 LKSDFARYNELNLDDDFQEEAGWKLGHGDVFRIPHRSLLLSVLVGSGVQLFLMIICSIFF 444

Query: 408 AAIGIISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFI 467
           AA+G +SPSSRGSL + MF  YALFGF GSY SM VYKFF GPYWK NM+LTP+LVPG I
Sbjct: 445 AALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGVYKFFGGPYWKVNMLLTPILVPGLI 504

Query: 468 LVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKT 527
              I+ LN FLLFVHSSG IP   L  ++++WFV S+PL+  GSL+A+K+ NW EHPTKT
Sbjct: 505 FCGIVALNIFLLFVHSSGVIPAVTLFFMILLWFVFSIPLALAGSLIAHKKCNWDEHPTKT 564

Query: 528 NQIARQIPFQSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXX 587
           NQIARQIPFQ WYLKT PA LIAGIFPFG+IAVELYFIY+SLWFNKIFYMFG        
Sbjct: 565 NQIARQIPFQPWYLKTWPATLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFFL 624

Query: 588 XXXXXXXXXXXITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMIL 647
                      ITY SLC+ENW WQWR F IGGVGC++Y+FIHSILFTKFKLGGFTT++L
Sbjct: 625 LTLTTSLVTILITYHSLCLENWMWQWRGFIIGGVGCAIYVFIHSILFTKFKLGGFTTIVL 684

Query: 648 YIGYTLLLSILSCIVTGAVGFISSMIFVRKIYSNVRVD 685
           Y+GY+ ++S+L CIVTGA+GF+SSM F+RKIYS+++V+
Sbjct: 685 YVGYSTIISLLFCIVTGAIGFLSSMFFIRKIYSSIKVE 722

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  834 bits (2155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/689 (58%), Positives = 489/689 (70%), Gaps = 24/689 (3%)

Query: 2   RCSYLLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SR 60
           R  +LLI    +    F LPG++P+TY+ GDE+PLLVN LTPS+ +Q +D+ G  V   +
Sbjct: 3   RGVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDK 62

Query: 61  EKMLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSIT 120
           E  LYS+DYY  + HFC+PE + KQP+SLGS++FGDRIYNSPF + ML+ +  V LC  T
Sbjct: 63  EHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKST 122

Query: 121 IPGSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGL 180
           IPG DAKFIN LIK+GFFQNWL+DGLPAARK YDS T T +Y  GF LGF ++K+ V G 
Sbjct: 123 IPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGK 182

Query: 181 GIPMDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRIS-KLVHNVEFPYL 239
            +P                                      R PK +   LV  VE PY 
Sbjct: 183 AVP-------------------STMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYF 223

Query: 240 ANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDS---ANPEKGNKLFLDEKKDNEVTFSYS 296
            NH+ I VE HDRG  NYRVVGV V+P S   S   A    G  L LDE KDNEV F+YS
Sbjct: 224 VNHFDIEVEFHDRGNDNYRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYS 283

Query: 297 VNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYE 356
           V F+ S+TVWATRWDKYLH Y+P IQWFSL+NFS+I             +ALKSD ARY 
Sbjct: 284 VKFVASDTVWATRWDKYLHIYDPQIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYN 343

Query: 357 EFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPS 416
           E NLDN F+EDSGWKLGHGDVFR PS+SMLLSILVGSG QLFLM++ SIF AA+G++SP 
Sbjct: 344 ELNLDNEFHEDSGWKLGHGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPV 403

Query: 417 SRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNF 476
           SRGSLP+ MF  YALFGF GSY SM VYKFF+GPYWKANMILTP+L+PG I + I+ +NF
Sbjct: 404 SRGSLPTVMFVLYALFGFVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNF 463

Query: 477 FLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPF 536
           FLLF HSSG IP  +L  I+++WF++S+PLSF GS++A+K+ NW EHPTKTNQIARQIP+
Sbjct: 464 FLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPY 523

Query: 537 QSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXX 596
           Q WYL+T  A LIAGIF FG+IAVELYFIY+SLWFNKIFYMFG                 
Sbjct: 524 QPWYLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVT 583

Query: 597 XXITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLS 656
             ITY SLC+ENW WQWRSF IGG+GCS+Y FIHSILFTKFKLGG  T++LY+GY+L++S
Sbjct: 584 ILITYYSLCLENWLWQWRSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIIS 643

Query: 657 ILSCIVTGAVGFISSMIFVRKIYSNVRVD 685
            L C+VTGA+GF SSM F+RKIYS ++V+
Sbjct: 644 ALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/679 (59%), Positives = 487/679 (71%), Gaps = 24/679 (3%)

Query: 12  VSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVES-REKMLYSFDYY 70
           ++   AF LPGV+P+TY   DE+PLLVN LTPS+ +Q KD+ GK V S +E  LYS+DYY
Sbjct: 13  IALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYY 72

Query: 71  FPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFIN 130
             K HFCKPE + KQP+SLGS++FGDRIYNSPF +KML+ +  V LC  TIPG DAKFIN
Sbjct: 73  NDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFIN 132

Query: 131 KLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAXXXX 190
            LIKNGFFQNWL+DGLPAAR +YDS T T +Y  GF LGF ++K+ VGG  IP       
Sbjct: 133 TLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIP------- 185

Query: 191 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRIS-KLVHNVEFPYLANHYVINVEV 249
                                          R+PK I   LV  +E  +  NH+ I VE 
Sbjct: 186 ------------STMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEY 233

Query: 250 HDRGEGNYRVVGVTVDPYSTTDS---ANPEKGNKLFLDEKKDNEVTFSYSVNFIESETVW 306
           HDRG GNYRVVGVTV+P S   S   A    G  L L E KDN+V F+YSV FI S+TVW
Sbjct: 234 HDRGNGNYRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVW 293

Query: 307 ATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFNLDNSFNE 366
           ATRWDKYLH Y+P IQWFSL+NFSII             +A++SDFARY E NLDN F+E
Sbjct: 294 ATRWDKYLHVYDPQIQWFSLINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHE 353

Query: 367 DSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMF 426
           D+GWKLGHGDVFRIP +SM+LS+LVGSG QLFLMII SIF AA+G++SP+SRGSLP+ MF
Sbjct: 354 DAGWKLGHGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMF 413

Query: 427 TFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGT 486
             YALFGF GSY SM VYKFF GPYWKAN+I+TP+L+PG I + I+ +NFFLLF HSSG 
Sbjct: 414 VLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGV 473

Query: 487 IPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPA 546
           IP   L  I+ +WF +S+PLSF GS +A+KR  W EHPTKTNQIARQ P Q WYL+TI A
Sbjct: 474 IPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQA 533

Query: 547 ILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYQSLCM 606
            LIAGIF FG+IAVELYFIY+SLWFNKIFYMFG                   ITY SLC+
Sbjct: 534 TLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCL 593

Query: 607 ENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAV 666
           ENW+WQWRSF IGG+GCS+Y+FIH+ILFTKFKLGGF T++LY+GY+ ++S L C+VTGA+
Sbjct: 594 ENWSWQWRSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAI 653

Query: 667 GFISSMIFVRKIYSNVRVD 685
           GF SSMIF+RKIYS ++V+
Sbjct: 654 GFFSSMIFIRKIYSRIKVE 672

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/687 (58%), Positives = 496/687 (72%), Gaps = 26/687 (3%)

Query: 5   YLLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVES-REKM 63
           +LL+   +    AF LPG++P+TY++ DE+PLLVN LTPS+ +Q +D+ GK + S +E  
Sbjct: 24  WLLLFFYIGLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHY 83

Query: 64  LYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPG 123
           LYS+DYY  + HFC+PE + +QP+SLGSI+FGDRIYNSPF ++ML+ +  V LC  TIPG
Sbjct: 84  LYSYDYYNERFHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPG 143

Query: 124 SDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIP 183
            DAKFINKLIK+GFFQNWL+DGLPAARK++DS T T +Y  GF LG   +K  + G  IP
Sbjct: 144 KDAKFINKLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTIDGKVIP 203

Query: 184 MDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRIS-KLVHNVEFPYLANH 242
                                                 REPK I   LV  VE PY  NH
Sbjct: 204 -------------------STMEELDSETSNTGAALDAREPKNIKPNLVKTVELPYFVNH 244

Query: 243 YVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGNK----LFLDEKKDNEVTFSYSVN 298
           + I VE HDRG+ NYRVVGVTV+P S  + ++P+  +K    L LDE+ DNE+ F+YSV 
Sbjct: 245 FDIEVEFHDRGDDNYRVVGVTVNPMSI-ERSSPDSCSKATKPLILDEEGDNEIYFTYSVK 303

Query: 299 FIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEF 358
           F+ S+TVWATRWDKYLH Y+P IQWFSL+NFS+I             +AL SD +RY E 
Sbjct: 304 FVASDTVWATRWDKYLHIYDPQIQWFSLINFSVIIVLLSSVVMHSLLRALNSDLSRYNEL 363

Query: 359 NLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSR 418
           NLDN F+EDSGWKLGHGDVFR P++SMLLS+LVGSG QLFLMII SIFLAA+G++SP SR
Sbjct: 364 NLDNEFHEDSGWKLGHGDVFRTPTKSMLLSVLVGSGVQLFLMIICSIFLAALGLVSPVSR 423

Query: 419 GSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFL 478
           GSLP+ MF FYALFGF GSY SM VYKFF GPYWKAN+ILTP+L+PG I V I+ +NFFL
Sbjct: 424 GSLPTVMFVFYALFGFVGSYTSMGVYKFFHGPYWKANLILTPILLPGGIFVLIVAMNFFL 483

Query: 479 LFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQS 538
           LF HSSG IP + L  I+ +WF +S+PLSF GS++A+K  NW EHPTKTNQIARQ+P+Q 
Sbjct: 484 LFAHSSGVIPASTLFFIIFLWFAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQP 543

Query: 539 WYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXX 598
           WYL+TI A LIAGIF FG+IAVELYFIY+SLWFNKIFYMFG                   
Sbjct: 544 WYLRTIQATLIAGIFCFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVL 603

Query: 599 ITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSIL 658
           ITY SLC+ENW WQWRSF IGG+GCS+Y+FIHSILFTKFKLGGF T++LY GY+ ++S L
Sbjct: 604 ITYHSLCLENWQWQWRSFIIGGLGCSVYMFIHSILFTKFKLGGFITIVLYFGYSFIISAL 663

Query: 659 SCIVTGAVGFISSMIFVRKIYSNVRVD 685
            C+VTGA+GF S M+F+RKIYS V+++
Sbjct: 664 CCVVTGAIGFFSCMLFIRKIYSAVKIE 690

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  827 bits (2136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/684 (59%), Positives = 485/684 (70%), Gaps = 30/684 (4%)

Query: 6   LLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREKML 64
           LL+   VS   AFYLPGVAP+TY E DE+PLLVNHLTPS+ YQ +D+ G  V   +E  L
Sbjct: 7   LLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFL 66

Query: 65  YSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGS 124
           YS+DYY+ + HFC+P+ + KQP+SLGS++FGDRIYNSPF + ML+ +  V LC+ TIPG+
Sbjct: 67  YSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGN 126

Query: 125 DAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPM 184
           DAKFINKLIKNGFFQNWLIDGLPAAR++YD  T T FY  GF LG VE+ +       P 
Sbjct: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPK 186

Query: 185 DAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISKLVHNVEFPYLANHYV 244
            A                                           +V   E PY ANH+ 
Sbjct: 187 QAETTNEGLELGTRAEDY--------------------------SIVETFEHPYFANHFD 220

Query: 245 INVEVHDRGEGNYRVVGVTVDPYSTTDSAN---PEKGNKLFLDEKKDNEVTFSYSVNFIE 301
           I +E HDRG G+YRVVGV V+P S   S         + L LDE++DNEV+F+YSV F E
Sbjct: 221 IMIEYHDRGGGDYRVVGVIVNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKE 280

Query: 302 SETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFNLD 361
           S T WATRWDKYLH Y+P+IQWFSL+NFS++             +ALKSDFARY E NL+
Sbjct: 281 SATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLE 340

Query: 362 NSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSL 421
           + F EDSGWKL HGDVFR PS S+LLSILVGSG QLFLM+  SIF AA+G +SPSSRGSL
Sbjct: 341 DDFQEDSGWKLNHGDVFRPPSHSLLLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSL 400

Query: 422 PSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFV 481
            + MF  YALFGF GSY SM +YKFF GPYWKAN++LTPLLVPG IL+ I+ LNFFL+ V
Sbjct: 401 ATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVV 460

Query: 482 HSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYL 541
           HSSG IP   L  +V +WF+ S+PLSF GSL+A K+  W EHPTKTNQIARQIPFQ WYL
Sbjct: 461 HSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYL 520

Query: 542 KTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITY 601
           KTIPA LIAGIFPFG+IAVELYFIYTSLWFNKIFYMFG                   ITY
Sbjct: 521 KTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITY 580

Query: 602 QSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCI 661
            SLC+ENW WQWR F +GGVGC+LY+FIHSILFTKFKLGGF T++LY+GY+ ++S+L C+
Sbjct: 581 HSLCLENWKWQWRGFIVGGVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCL 640

Query: 662 VTGAVGFISSMIFVRKIYSNVRVD 685
           VTG++GFISSM F+R+IYS+++VD
Sbjct: 641 VTGSIGFISSMFFLRRIYSSIKVD 664

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/686 (58%), Positives = 494/686 (72%), Gaps = 6/686 (0%)

Query: 6   LLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREKML 64
           L+++  V+    FYLPG AP TY +GD +PLLVNHLTPSLN+Q  DD G +++  + +ML
Sbjct: 6   LVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARML 65

Query: 65  YSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGS 124
           Y +DYY  KLHFC+PEKI KQP+SLGS++FG++IYNSPF++KML+    V+LCS TIPG 
Sbjct: 66  YPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGK 125

Query: 125 DAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPM 184
           DAKFINKLIKNGF QNWLIDGLPAARK++DS T+TEFY  GF LGFVE+++ VGG  +  
Sbjct: 126 DAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSE 185

Query: 185 DAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRI-SKLVHNVEFPYLANHY 243
                                                RE K +   +V NVE P  ANH+
Sbjct: 186 SEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHF 245

Query: 244 VINVEVHDRGEGNYRVVGVTVDPYS----TTDSANPEKGNKLFLDEKKDNEVTFSYSVNF 299
            I VE HDRG G++RVVGV V+P S     + S      +KL LDE KDNEV F+YSV F
Sbjct: 246 DIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKF 305

Query: 300 IESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFN 359
             S+T WATRWDKYLH Y+P IQWFSL+NFS+I             +ALKSD +RY EFN
Sbjct: 306 TPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFN 365

Query: 360 LDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRG 419
           L + F EDSGWKL HGDVFR P  SMLLS+LVGSG QLFLMI  SI L+A+GI+SPSSRG
Sbjct: 366 LGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSRG 425

Query: 420 SLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLL 479
           SLP+AMF FYA+FGF GSY SM +YKFFKGPYWKANMILTP+L+PG I ++++ +N  L 
Sbjct: 426 SLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLY 485

Query: 480 FVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSW 539
           FV SS  IP+  L+ +V +W + S+PL+F GSL++ K+ NW EHPTKTN+I RQIPFQ W
Sbjct: 486 FVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPW 545

Query: 540 YLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXI 599
           +LKT+PA LI G+  FG+IAVELYFIY+SLWFNKIFYMFG                   I
Sbjct: 546 FLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVII 605

Query: 600 TYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILS 659
           TY++LC ENW WQWRSF IGG+GCS+YIFIHSILFT+FKLGGF T++LY+GY+ L+S L+
Sbjct: 606 TYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLT 665

Query: 660 CIVTGAVGFISSMIFVRKIYSNVRVD 685
           CIVTGA+GFI SM FVR+I+++++VD
Sbjct: 666 CIVTGAIGFICSMFFVRRIFASIKVD 691

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/674 (60%), Positives = 492/674 (72%), Gaps = 29/674 (4%)

Query: 16  NAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVES-REKMLYSFDYYFPKL 74
            AFYLPGVAP+TY+EGDE+PLLVNHL+PS+ +Q K+D GK V S + K LYS+DYY+ + 
Sbjct: 16  RAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDRF 75

Query: 75  HFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIK 134
           HFC+PEKI KQP+SLGSI+FGDRIYNSPF + ML+ +    LC  TIPG+DAKFINKLIK
Sbjct: 76  HFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIK 135

Query: 135 NGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAXXXXXXXX 194
           NGFFQNWLIDGLPAA + +D+ T T+FY  GF LG V++ + V                 
Sbjct: 136 NGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVD---------------- 179

Query: 195 XXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISKLVHNVEFPYLANHYVINVEVHDRGE 254
                                      R+ K + K + NVE  Y  NHY I +E HDRG 
Sbjct: 180 --------ETEARTKVAAANQGAELDARDAKNV-KTIKNVELVYFVNHYDIRIEYHDRGN 230

Query: 255 GNYRVVGVTVDPYSTTDSA---NPEKGNKLFLDEKKDNEVTFSYSVNFIESETVWATRWD 311
           G+YRVVGV V+P S   S+       G  L L E +DN+V F+YSV F+ SET WATRWD
Sbjct: 231 GDYRVVGVIVNPVSIQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWD 290

Query: 312 KYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFNLDNSFNEDSGWK 371
           KYLH Y+PTIQWFSLVNFS+I             KALK+DFARY EFNLD+ F ED+GWK
Sbjct: 291 KYLHVYDPTIQWFSLVNFSLIVLLLSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWK 350

Query: 372 LGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFTFYAL 431
           L HGDVFRIP +SMLLS+LVGSG QLF+MI ++IF AA+G +SPSSRG L + MF  YAL
Sbjct: 351 LCHGDVFRIPHKSMLLSVLVGSGVQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYAL 410

Query: 432 FGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTA 491
           FGF GSY SM VYKFF+GPYWKANM+LTP+LVPG I ++I+ +NFFL++VHSSG IP   
Sbjct: 411 FGFVGSYTSMGVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKT 470

Query: 492 LLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPAILIAG 551
           L  +V++WFV S+P +F GSL+ANK+ NW EHPTKT QIARQIPFQ WYLKTIPA  IAG
Sbjct: 471 LFFMVLLWFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAG 530

Query: 552 IFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYQSLCMENWNW 611
           IFPFG+IAVE+YFIYTSLW+NKIFYMFG                   ITY SLC+ENWNW
Sbjct: 531 IFPFGSIAVEIYFIYTSLWYNKIFYMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNW 590

Query: 612 QWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAVGFISS 671
           QWRSF +GGVGC++Y+FIHSILFTKFKLGGFTT++LY+GY+ ++S+L CIVTG++GF+SS
Sbjct: 591 QWRSFIVGGVGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSS 650

Query: 672 MIFVRKIYSNVRVD 685
           M FVRKI+S+++VD
Sbjct: 651 MFFVRKIFSSIKVD 664

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/674 (60%), Positives = 497/674 (73%), Gaps = 30/674 (4%)

Query: 16  NAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREKMLYSFDYYFPKL 74
           NAFYLPGVAP+TY   DE+PLLVNHL+PS+ +Q + + G+ ++  + + LYS+DYY+ + 
Sbjct: 20  NAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYLYSYDYYYDRF 79

Query: 75  HFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIK 134
           HFC+PEKIVK+P+SLGSI+FGDRIYNSP+ IKML+ +  V LC+  IPG DA+FINKLIK
Sbjct: 80  HFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIK 139

Query: 135 NGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAXXXXXXXX 194
           NGFFQNWLIDGLPAAR ++D +T+++FY  GF LG VE+ + V                 
Sbjct: 140 NGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVA---------------- 183

Query: 195 XXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISKLVHNVEFPYLANHYVINVEVHDRGE 254
                                      R+ K + +++ NVE PY ANH+ I VE HDRGE
Sbjct: 184 ---------QAKTHPKEDDSGSAKLSTRDAKNV-QMLKNVELPYFANHHDITVEYHDRGE 233

Query: 255 GNYRVVGVTVDPYSTTDSA---NPEKGNKLFLDEKKDNEVTFSYSVNFIESETVWATRWD 311
           GN RVVGVTVDP S   S+       G+ L LDEK DNEV F+YSV F+ S+TVWATRWD
Sbjct: 234 GNLRVVGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWD 293

Query: 312 KYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFNLDNSFNEDSGWK 371
           KYLHTY+PTIQWFSLVNFSI+             KAL+SDFARY E NLDN F EDSGWK
Sbjct: 294 KYLHTYDPTIQWFSLVNFSIVVVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWK 353

Query: 372 LGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFTFYAL 431
           L HGDVFRIPS+SMLLSILVGSG QLFLMI  SIF AA+G +SPSSRGSL + MF  YAL
Sbjct: 354 LTHGDVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYAL 413

Query: 432 FGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTA 491
           FGF GSY SM VYKFF+GPYWKANMILTPLLVPG +L+SI+GLN FLL  HSSGTIP   
Sbjct: 414 FGFVGSYTSMGVYKFFRGPYWKANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKT 473

Query: 492 LLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPAILIAG 551
           L  IV++WFVIS+P +  GSL+A+K+ +W EHPTKTNQ+ARQ+PFQ WYLKT+ A  IAG
Sbjct: 474 LFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAG 533

Query: 552 IFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYQSLCMENWNW 611
           IFPFG+IAVELYFIYTSLW+NKIFYMFG                   ITY SL +ENW W
Sbjct: 534 IFPFGSIAVELYFIYTSLWYNKIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQW 593

Query: 612 QWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAVGFISS 671
           QWRSF +GGVGC++Y+F+HSILFTK KLGGF T++LY+GY+ ++S+L C+VTG++GF+SS
Sbjct: 594 QWRSFIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSS 653

Query: 672 MIFVRKIYSNVRVD 685
           M FVR+IYS+++V+
Sbjct: 654 MFFVRRIYSSIKVE 667

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/687 (59%), Positives = 493/687 (71%), Gaps = 49/687 (7%)

Query: 4   SYLLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREK 62
           S L +  L S   AFYLPGVAP+TY+  DE+ LLVNHLTPS+N+Q +D+ G  V+  +E 
Sbjct: 5   SLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEH 64

Query: 63  MLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIP 122
            LYS+DYY+ K HFCKPE +V+QP SLGS++FGDRI+NSPF + ML+ +  V LCS  IP
Sbjct: 65  YLYSYDYYYSKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIP 124

Query: 123 GSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGI 182
           G DAKF+NKLIKNGF QNWLIDGLPA R+I+DS T++ FY  GF LGFV++ +   G   
Sbjct: 125 GEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTE---GFSD 181

Query: 183 PMDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISKLVHNVEFPYLANH 242
             D                                     E K+I K    +E PYLANH
Sbjct: 182 SND-------------------------------------EEKKIMK---TLEVPYLANH 201

Query: 243 YVINVEVHDRGEGNYRVVGVTVDPYS----TTDSANPEKGNKLFLDEKKDNEVTFSYSVN 298
           Y IN+E HDRG  NYRVVGVTVDP S    ++DS     G+ L L E ++NEV F+YSV 
Sbjct: 202 YDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGS-LTLSETEENEVHFTYSVK 260

Query: 299 FIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEF 358
           FI+S+TVWATRWDKYLH Y+PTIQWFSL+N S+I             +ALK+D +RY EF
Sbjct: 261 FIKSDTVWATRWDKYLHVYDPTIQWFSLINCSVIVVALSSVVLHMLLRALKNDLSRYNEF 320

Query: 359 NLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSR 418
           NLDN F+EDSGWKL HGDVFRIP +S+LLSILVGSG QLFLMI  SI  AA+G +SPSSR
Sbjct: 321 NLDNEFHEDSGWKLSHGDVFRIPPRSLLLSILVGSGVQLFLMIACSIIFAALGFLSPSSR 380

Query: 419 GSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFL 478
           GSLP+ MF  YALFGF GSY SM++YKFFKGP WK N++LTP+LVPG I V+I+ LNFFL
Sbjct: 381 GSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFL 440

Query: 479 LFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQS 538
           +FV SSG IP   L  I+++WFV S+PLSF GSL+A+KR     HPTKTNQIARQIP Q 
Sbjct: 441 VFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQP 500

Query: 539 WYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXX 598
           WYLKTIP  LIAG+FPF +IAVELYFIYTSLWFNKIFYMFG                   
Sbjct: 501 WYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTFTTALVTIL 560

Query: 599 ITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSIL 658
            TY SLC+ENW WQWRSF IGG GC++Y+FIHSILFTKFKLGGFTT++LY+GY+ L+S+L
Sbjct: 561 TTYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVL 620

Query: 659 SCIVTGAVGFISSMIFVRKIYSNVRVD 685
            CIVTG++GFISSM F+RKIYS+V+VD
Sbjct: 621 CCIVTGSIGFISSMFFIRKIYSSVKVD 647

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/693 (56%), Positives = 483/693 (69%), Gaps = 38/693 (5%)

Query: 5   YLLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVES-REKM 63
           +L + + +    AF LPG++P+TY+  DE+PLLVN LTPS+ +Q +D+ G  + S +E  
Sbjct: 6   WLALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHF 65

Query: 64  LYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPG 123
           LYS+DYY  + HFC+PE + KQP+SLGS++FGDRIYNSPF ++ML+ +  V LC  TIPG
Sbjct: 66  LYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPG 125

Query: 124 SDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIP 183
            DA+FIN+LI +GFFQNWL+DGLPAAR +YDS T T +Y  GF LGF ++ + VG   +P
Sbjct: 126 RDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVP 185

Query: 184 -------MDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRIS-KLVHNVE 235
                  MDA                                   R PK I    V  VE
Sbjct: 186 NTMEEADMDASNAGATLHI--------------------------RSPKNIRPNPVKTVE 219

Query: 236 FPYLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSA---NPEKGNKLFLDEKKDNEVT 292
            PY  NH+ I VE H+RG  +YR+VGVTV+P S   S+          L L E +DNEV 
Sbjct: 220 LPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVY 279

Query: 293 FSYSVNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDF 352
           F+YSV F+ S TVWATRWDKYLH Y+P IQWFSL+ FS+I             +ALKSD 
Sbjct: 280 FTYSVKFVASATVWATRWDKYLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDL 339

Query: 353 ARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGI 412
            RY E NL+N F+ED+GWKL HGDVFR P +SMLLS+LVGSG QLFLMII SIF AA G+
Sbjct: 340 TRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGL 399

Query: 413 ISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSIL 472
           +SP SRGSL + MF  YALFGF GSY SM VYKFF GPYWKAN+I+TP+L+PG IL+ I+
Sbjct: 400 VSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAILLLIV 459

Query: 473 GLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIAR 532
            +N FLLF HSSG IP  +L  I+ +WFV+S+PLSF+GS+LA+KR +W EHPTKTNQIAR
Sbjct: 460 AMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIAR 519

Query: 533 QIPFQSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXX 592
           QIP Q WYL+T  A ++AGIF FG+IAVELYFIY+SLWFNKIFYMFG             
Sbjct: 520 QIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTT 579

Query: 593 XXXXXXITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYT 652
                 ITY SLC+ENW WQWRSF IGG+GCS+Y+FIHSILFTKFKLGGF T++LY+GY+
Sbjct: 580 SLITVLITYHSLCLENWLWQWRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYS 639

Query: 653 LLLSILSCIVTGAVGFISSMIFVRKIYSNVRVD 685
            ++S+L C+VTGA+GF SSMIF+RKIY  V+V+
Sbjct: 640 FIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/679 (58%), Positives = 485/679 (71%), Gaps = 22/679 (3%)

Query: 12  VSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVES-REKMLYSFDYY 70
           +S  N FYLPGVAP+TY+E D +PLLVNHLTPS+ ++ KD  G ++ S +E  LYS+DYY
Sbjct: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74

Query: 71  FPKLHFCKP--EKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKF 128
           + KLHFCKP   +I KQP+SLGSILFGDRIYNSPF +KML  EN  +LCS  IPG DAKF
Sbjct: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134

Query: 129 INKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAXX 188
           IN LIK+GF QNWLIDGLPAAR++YD  T + FY  GF LG VE+ + V           
Sbjct: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVD---------- 184

Query: 189 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISKLVHNVEFPYLANHYVINVE 248
                                             E +    LV +VE  Y ANH+ I++E
Sbjct: 185 -------EAPSHTTPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIE 237

Query: 249 VHDRGEGNYRVVGVTVDPYSTT-DSANPEKG-NKLFLDEKKDNEVTFSYSVNFIESETVW 306
            HDRG   YR+VGVTV+P S   DSA  +    KL L E  D +V F+YSV F +S+TVW
Sbjct: 238 YHDRGNNEYRIVGVTVNPISMKRDSAICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVW 297

Query: 307 ATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFNLDNSFNE 366
           ATRWDKYLH Y+PTIQWFSL+NF++I             KALK+DF RY EFNL++SF+E
Sbjct: 298 ATRWDKYLHIYDPTIQWFSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDE 357

Query: 367 DSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMF 426
           DSGWKL HGDVFRIP++SMLLSI VGSG QLF MI S + LAA+G +SPS+RGSLP+ MF
Sbjct: 358 DSGWKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMF 417

Query: 427 TFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGT 486
             YA+FGF GSY SM VY+FF GPYWKANMILTPL+VPG I + I+ +N FL+FVHSS  
Sbjct: 418 ILYAVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDV 477

Query: 487 IPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPA 546
           +P+  L L+V++W V+SLPLSF GSL++ KR  W +HPTKTN++ RQIPFQ WYLKT+PA
Sbjct: 478 VPIGTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPA 537

Query: 547 ILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYQSLCM 606
            LI GIFPFG+IAVELYFIY+SLWFNKIFYMFG                   +TY SLC+
Sbjct: 538 TLIGGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCL 597

Query: 607 ENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAV 666
           ENW WQWRSF IGG+GCS+YIFIHSILFT+FKLGGF T++LY+GY+ L++IL  +VTGA+
Sbjct: 598 ENWRWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAI 657

Query: 667 GFISSMIFVRKIYSNVRVD 685
           GFIS+M FV+KIYS+++V+
Sbjct: 658 GFISNMFFVKKIYSSIKVE 676

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/684 (53%), Positives = 484/684 (70%), Gaps = 28/684 (4%)

Query: 7   LIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVES-REKMLY 65
           LI+  + F NAFY+PG++ +TY+ GD + L VN LTPS+ ++  D+ G+ V + +E  LY
Sbjct: 11  LISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLY 70

Query: 66  SFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSD 125
           S+DYY+ K HFC+PEK+ ++ +SLGS+LFGDRIYNSPF + ML+P+  V LC  TIP  D
Sbjct: 71  SYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADD 130

Query: 126 AKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMD 185
           AKFINKLIKNGFF NWLIDGLP+ARKIYDS T + FY  GFPLG V ++   GG  + + 
Sbjct: 131 AKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIP 190

Query: 186 AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRI-SKLVHNVEFPYLANHYV 244
                                               RE K + + L+   E  Y ANH+ 
Sbjct: 191 GVSKLVNEAVKAYKK---------------------REAKNVPAGLITAEEVEYFANHFN 229

Query: 245 INVEVHDRGEGNYRVVGVTVDPYSTT----DSANPEKGNKLFLDEKKDNEVTFSYSVNFI 300
           I++E HDRG  NYRVVGVTVDP S      +S  P  GN+L L+E  +N+V F+YSV+FI
Sbjct: 230 IHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCTP-TGNQLHLNENAENQVLFTYSVDFI 288

Query: 301 ESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFNL 360
           +SET WATRWDKYLHTY+P+IQWFSL+NF+I+             +ALK D +RY + NL
Sbjct: 289 KSETAWATRWDKYLHTYDPSIQWFSLINFTIVVVLLSTIVIHALLRALKKDISRYTDLNL 348

Query: 361 DNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGS 420
           DNSF EDSGWKL HGDVFR+P ++M+LSI VGSG QLFLMI+  + +AA+G +SPS RG+
Sbjct: 349 DNSFTEDSGWKLTHGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGA 408

Query: 421 LPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLF 480
           LP+ MF  YA+FGF GSY SM VYKFF GPYWKANMILTPLLVPG +L+ I+ LNFFLL 
Sbjct: 409 LPTCMFVLYAIFGFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMLLLIIFLNFFLLG 468

Query: 481 VHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWY 540
           VHSSGTIP + ++L++ +W ++S+PLSFLGS +A K+ NW ++PT  N+I R+IP Q WY
Sbjct: 469 VHSSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWY 528

Query: 541 LKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXIT 600
           +++IP +L++GI PFGAIAVELYFIY+SLW+NKIFYMFG                   + 
Sbjct: 529 MRSIPVVLLSGIVPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVV 588

Query: 601 YQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSC 660
           Y SLC+ENW WQWRSF  GG+GC+ YIF++SI FT+FK  GF +++LY+GY+ L+ ++SC
Sbjct: 589 YHSLCLENWRWQWRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSC 648

Query: 661 IVTGAVGFISSMIFVRKIYSNVRV 684
           ++TGAV F+ +M FV++I+++++V
Sbjct: 649 LITGAVSFMCNMFFVKRIFTSIKV 672

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/677 (56%), Positives = 471/677 (69%), Gaps = 10/677 (1%)

Query: 12  VSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYF 71
            S    FYLPGVAP+TY+EGD +PLLVNHLTPS+ ++  DD GK    RE  LYS+DYY+
Sbjct: 14  ASRVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYY 73

Query: 72  PKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINK 131
            K HFCKPEK+ KQ +SLGSI+FGDRIYNSPF ++MLK +    LCS  IP +DAKFINK
Sbjct: 74  DKFHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINK 133

Query: 132 LIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAXXXXX 191
           LI NGFFQNWL+DGLPAARK  D  T +EFY  GF LGF++    VGG  + MD      
Sbjct: 134 LIANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFID----VGGAKLRMDGQGEED 189

Query: 192 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISKLVHNVEFPYLANHYVINVEVHD 251
                                          +PK   +LV  +E  Y ANH+ I V+ HD
Sbjct: 190 AHPKGATKPVAQDDYLDRPSKSKNEKRKKIVDPK---ELVKQLETAYFANHFNIEVQYHD 246

Query: 252 RGEGNYRVVGVTVDPYS-TTDSAN--PEKGNKLFLDEKKDNEVTFSYSVNFIESETVWAT 308
           RG G+YRVVGV V+P S   DS+N     G  L L E+++  V FSYSV F  S+TVWAT
Sbjct: 247 RGNGDYRVVGVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWAT 306

Query: 309 RWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFNLDNSFNEDS 368
           RWDKYLH Y+P IQW+SL+NFSI+             + L+ D +RY + NLD+ F E++
Sbjct: 307 RWDKYLHVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEET 366

Query: 369 GWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFTF 428
           GWKL HGDVFR P++S+LLS+LVGSG QLF+M   +I  A +G++SPSSRGSL + MF  
Sbjct: 367 GWKLVHGDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFIL 426

Query: 429 YALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGTIP 488
           YALFG  GSY SM+ YKFF G YWK NMILTP+LVPG +   +LGLNFFL+ V S+G IP
Sbjct: 427 YALFGSLGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIP 486

Query: 489 MTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPAIL 548
              +  IV++WFV S+PLS  GSL+A K+  W EHPTKT QI RQIPFQ WYLKT PA L
Sbjct: 487 FGTMCAIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAAL 546

Query: 549 IAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYQSLCMEN 608
           IAGIFPFG+IAVELYF+Y+SLWFNKIFYMFG                   +TY SLC+EN
Sbjct: 547 IAGIFPFGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLEN 606

Query: 609 WNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAVGF 668
           W WQWR F IGG GC+LY+F+H+ILFTKFKLGGF T++LY+GY+L++S+L+C++TGAVGF
Sbjct: 607 WKWQWRGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGF 666

Query: 669 ISSMIFVRKIYSNVRVD 685
           +SS+ FVR+IYS+++VD
Sbjct: 667 MSSLWFVRRIYSSIKVD 683

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/693 (55%), Positives = 485/693 (69%), Gaps = 14/693 (2%)

Query: 1   MRCSYLLIAAL-VSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVES 59
           M  + LL++ L  S  + FYLPGVAP+TY+EGD +PLLVNHLTP++ YQ  D+ G  +  
Sbjct: 1   MVSAILLLSILWASQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGD 60

Query: 60  REKMLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSI 119
           +E +LYS+DYY+PK HFC+PEK+ KQ +SLGSI+FGDRIYNSPF I+MLK +    LCS 
Sbjct: 61  KESLLYSYDYYYPKFHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSE 120

Query: 120 TIPGSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGG 179
           +IP  DAKFINKLI NGFFQNWL+DGLPAARK  D  T +EFY  GF LG+V     +GG
Sbjct: 121 SIPADDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYV----GIGG 176

Query: 180 LGIPMDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRIS---KLVHNVEF 236
             + M+                                    +  K++S   +LV  +E 
Sbjct: 177 SELRMNGQGGSQDGDDSGSHGSTKEVSESDYLDAPPAKRSLAKR-KQVSNTKELVKQLET 235

Query: 237 PYLANHYVINVEVHDRGEGNYRVVGVTVDPYS----TTDSANPEKGNKLFLDEKKDNEVT 292
           PY ANH+ I V+ HDRG GNYRVVGV V+PYS    + D+ + + G  L L E +  EV 
Sbjct: 236 PYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCD-KTGELLKLSETEATEVH 294

Query: 293 FSYSVNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDF 352
           FSYSV F  SETVWATRWDKYLH Y+P IQWFSL+NFS++               L  D 
Sbjct: 295 FSYSVKFTPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDL 354

Query: 353 ARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGI 412
           +RY + NLD+ F E++GWKL HGDVFR P +S++LS+LVGSGAQLFLM   +I  A +G+
Sbjct: 355 SRYNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGL 414

Query: 413 ISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSIL 472
           +SPSSRGSL + MF  YALFG +GSY SM+ YKFF GPYWK NM+LTP+LVPG +   +L
Sbjct: 415 LSPSSRGSLTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVML 474

Query: 473 GLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIAR 532
            LNFFL+ V S+G IP   + +IV++WF+ S+PLS  GSL+A K+  W EHPTKT QI R
Sbjct: 475 ALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPR 534

Query: 533 QIPFQSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXX 592
           QIPFQ WYLKT+PA LIAGIFPFG+IAVELYFIY+SLWFNKIFYMFG             
Sbjct: 535 QIPFQPWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTT 594

Query: 593 XXXXXXITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYT 652
                 +TY SLC+ENW WQWR F IGG GC+LY+FIH+ILFTKF+LGGFTT++LY+GY+
Sbjct: 595 SLITVLLTYYSLCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYS 654

Query: 653 LLLSILSCIVTGAVGFISSMIFVRKIYSNVRVD 685
           L++S+LSC++TG VGF+SS+ FVR+IYS+V+VD
Sbjct: 655 LVMSLLSCLITGTVGFLSSLWFVRRIYSSVKVD 687

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/676 (55%), Positives = 471/676 (69%), Gaps = 33/676 (4%)

Query: 15  CNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREKMLYSFDYYFPK 73
            +AFYLPGVAP+TY++GDE+PLLVNHLTPS  +Q  D  G  +   +E+ LYS+DYY+ K
Sbjct: 13  ASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDK 72

Query: 74  LHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLI 133
            HFC+PE ++KQP+SLGSI+FGDRIYNSPF + ML+ +  V LC   IP  DAKFINKLI
Sbjct: 73  FHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLI 132

Query: 134 KNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAXXXXXXX 193
           +NGFF NWL+DGLPAAR+++D  T++ FY  GF LGFV++   +                
Sbjct: 133 RNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTI---------------- 176

Query: 194 XXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISKLVHNVEFPYLANHYVINVEVHDRG 253
                                          +R +KL    E  Y  NH+ I +E HDRG
Sbjct: 177 -------EDPDTKKVSESDYIEIADADKELKERSAKLT---ELSYFINHFDIKIEYHDRG 226

Query: 254 EGNYRVVGVTVDPYS----TTDSANPEKGNKLFLDEKKDNEVTFSYSVNFIESETVWATR 309
           E NYRVVGV+V P S    ++DS + E G  L L E  DN V F+YSV+F+ S+T+WATR
Sbjct: 227 EDNYRVVGVSVIPASIKRDSSDSCDTE-GEPLVLSEDADNTVHFTYSVSFVPSQTLWATR 285

Query: 310 WDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFNLDNSFNEDSG 369
           WDKYLH Y+P IQWFSL++FS+I             +ALK+D +RY E NLD+ F E++G
Sbjct: 286 WDKYLHVYDPQIQWFSLISFSLIVILLSSVMVHSLFRALKNDLSRYNELNLDDEFQEETG 345

Query: 370 WKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFTFY 429
           WKL HGDVFR P ++MLLS+LVGSGAQLFLM   +I  A +G++SPSSRGSL + MF  Y
Sbjct: 346 WKLVHGDVFRTPERTMLLSVLVGSGAQLFLMAGFTILFALLGLLSPSSRGSLTTVMFILY 405

Query: 430 ALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGTIPM 489
           ALFG +GSY SM+VYKFF G  WK NMILTP+L+P  I +S+LGLN FL+FVHSSG IP 
Sbjct: 406 ALFGSFGSYTSMAVYKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPF 465

Query: 490 TALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPAILI 549
             +L IVV+WFV S+PLS  GS+++ K+S W + PT TNQIARQIPFQ WYLKT+PA LI
Sbjct: 466 GTMLAIVVLWFVFSIPLSVAGSIISRKKSQW-DRPTNTNQIARQIPFQPWYLKTVPASLI 524

Query: 550 AGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYQSLCMENW 609
           AG FPFG+I VELYFIY+SLWFNKIFYMFG                   +TY SLCMENW
Sbjct: 525 AGTFPFGSIVVELYFIYSSLWFNKIFYMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENW 584

Query: 610 NWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAVGFI 669
            WQWR F IGG GC+ Y+F+H+ILFTKFKLGG TT++LY+GY++++S L C++TGAVGF+
Sbjct: 585 KWQWRGFWIGGAGCAFYVFVHAILFTKFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFL 644

Query: 670 SSMIFVRKIYSNVRVD 685
           SS+ FVRKIY +++VD
Sbjct: 645 SSLWFVRKIYGSIKVD 660

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/689 (51%), Positives = 466/689 (67%), Gaps = 34/689 (4%)

Query: 4   SYLLIAAL--VSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESRE 61
           +Y++++ L  +S   AF LPG+ P TY +GD++PLLVNHLTPS+++  K++ GK + + +
Sbjct: 2   NYVILSLLFCLSVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAK 61

Query: 62  K-MLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSIT 120
           K +++S+DYY+ K HFC+P  I K   S+GSILFGDRIYNSPF + ML+ +  V LC   
Sbjct: 62  KYVVHSYDYYYEKFHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESI 121

Query: 121 IPGSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGL 180
           IPG DA+FINKLIKNG++QNW IDGLPAAR++YD  T + FY  GF LG VEI++  G  
Sbjct: 122 IPGKDAEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTTGDK 181

Query: 181 GIPMDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKR-ISKLVHNVEFPYL 239
            +P                                      R+ K  +  L+  VE PY 
Sbjct: 182 LLPDSVHDISDLAK---------------------------RDAKNLVQNLIKEVEVPYF 214

Query: 240 ANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPE---KGNKLFLDEKKDNEVTFSYS 296
            NH+ I +E H+RG GNYRVVG TV+P S    +  +    G  L L+E++DN V  +YS
Sbjct: 215 VNHFDIVIEYHERGNGNYRVVGATVNPVSIARKSAGDCTPTGKSLTLNEEEDNNVHSTYS 274

Query: 297 VNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYE 356
           V F+ S+T W TRWDKYLH Y+P IQWFSL+NFS+I             KALKSDFARY 
Sbjct: 275 VTFVPSKTSWVTRWDKYLHVYDPKIQWFSLINFSLIVILLSVILINSLLKALKSDFARYN 334

Query: 357 EFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPS 416
             NLD+   E+SGWKL HG VFRIP   M+LSILVGSG QLFL+I+ ++FLAAI I+SP 
Sbjct: 335 NINLDDDVKEESGWKLVHGYVFRIPKNPMILSILVGSGFQLFLVIVCTVFLAAIDILSPI 394

Query: 417 SRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNF 476
            RG+LP+AM   Y LFGF  SY+SM VYKFFKGPYWK NM+LTP+LVPG I+++ L LN 
Sbjct: 395 YRGALPTAMIILYILFGFISSYVSMGVYKFFKGPYWKVNMLLTPILVPGLIIITFLALNL 454

Query: 477 FLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPF 536
           FL+F  SS  +P   ++ ++++WF +S+PLS  GSL+A K+ +W EHPT TNQIA+ IP 
Sbjct: 455 FLMFSESSSVVPAKTIMTLILLWFAVSIPLSVAGSLMAQKKCHWDEHPTVTNQIAKVIPP 514

Query: 537 QSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXX 596
           Q WYLKTIPA LI G+F FG+I+V+LYFIYTSLWFN IFYM+G                 
Sbjct: 515 QKWYLKTIPASLIGGLFSFGSISVQLYFIYTSLWFNNIFYMYGFLLFSICLFTMTITLVT 574

Query: 597 XXITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLS 656
              TY SLC ENW WQWR F IGG+GCS+Y+ +HS+ F + KLGGFT ++LY+GY+ +++
Sbjct: 575 ILFTYHSLCQENWKWQWRGFFIGGLGCSIYVLLHSLFFIELKLGGFTNILLYMGYSSVVT 634

Query: 657 ILSCIVTGAVGFISSMIFVRKIYSNVRVD 685
            L  +VTG+VGF+SSM F+++I+S+V+VD
Sbjct: 635 ALIFLVTGSVGFLSSMFFIKRIFSSVKVD 663

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/687 (51%), Positives = 455/687 (66%), Gaps = 47/687 (6%)

Query: 8   IAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVES-REKMLYS 66
           ++ L +   A +LPG++P+ Y+   E+ L VNHLTPS ++Q KD  G  ++S +E  LYS
Sbjct: 8   LSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYS 67

Query: 67  FDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDA 126
           +DYY  KLHFCKPE +++Q +SLGS+LFGDR+YNSPF + ML+ ++ V LC   IPG DA
Sbjct: 68  YDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDA 127

Query: 127 KFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNV--GGLGIPM 184
            FINKLIKNGF  NWL+DGLPA   I +    +     GFPLG VEI + V  G +  P 
Sbjct: 128 AFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATP- 186

Query: 185 DAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRIS----KLVHNVEFPYLA 240
                                                RE   IS     +V N+E P+L 
Sbjct: 187 -------------------------------------REETGISAHGSNVVVNLELPHLN 209

Query: 241 NHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEK--GNKLFLDEKKDNEVTFSYSVN 298
           NHY I ++ H+   G YR+VGV V+P S   ++N  +  G ++ L E +DNEV ++YSV 
Sbjct: 210 NHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTSNSCEFTGEQISLSEDQDNEVLYTYSVR 269

Query: 299 FIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEF 358
           ++     WATRWD Y  +Y+ T+QWFSL++  I+             +ALKSDFARY E 
Sbjct: 270 YVRFSHTWATRWDNYRFSYDTTVQWFSLISCVIVVIGLSSVVLHMLLRALKSDFARYNEL 329

Query: 359 NLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSR 418
           NLD+ F+E+SGWKL HGDVFR+P++S+LLS+LVGSG QL L+ +  I +AAI   +  SR
Sbjct: 330 NLDDEFHEESGWKLSHGDVFRMPNKSLLLSVLVGSGVQLLLLAVGGIVIAAIAFNNAGSR 389

Query: 419 GSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFL 478
             LP+  F  YALFGF GSY SM VY+FFKGPY K NMILTP L+PG IL++I+ LNFFL
Sbjct: 390 EVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFL 449

Query: 479 LFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQS 538
           L  HSS  IP +AL  +V++W +IS+PLS  GSL A K  +W +HPTKTNQIARQIPFQ 
Sbjct: 450 LIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQP 509

Query: 539 WYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXX 598
           WYLKT+PA L+AGIFPF +IAVELYFIY SLWF++ FYMFG                   
Sbjct: 510 WYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFFYMFGFSMVSLFLLVLTTALVTVM 569

Query: 599 ITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSIL 658
           ITY SLC+ENW WQWRSF +GG+G ++YIFIHSI FT+FKL GFTT++LY+GY++L+SIL
Sbjct: 570 ITYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISIL 629

Query: 659 SCIVTGAVGFISSMIFVRKIYSNVRVD 685
            C+ TGAVGF SSM  VRKI+S+V+VD
Sbjct: 630 CCLTTGAVGFFSSMFLVRKIFSSVKVD 656

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/680 (51%), Positives = 456/680 (67%), Gaps = 39/680 (5%)

Query: 10  ALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDY 69
           A +     FYLPG AP+TY  GD +PLLVNH+TP++    +     +   +E+ LY++DY
Sbjct: 9   AWLGLAQGFYLPGSAPTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQ-RDKERYLYAYDY 67

Query: 70  YFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFI 129
           Y+P+LH C+P+KI K  +SLGSI+FGDR++NSPF +KML+ ++ V LC  T+P  DAKFI
Sbjct: 68  YYPRLHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFI 127

Query: 130 NKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAXXX 189
           N+LI++GFF NWL+DGLPA R+++D+ T+T FY  GF LG V           P +    
Sbjct: 128 NQLIRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIEL- 186

Query: 190 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREPKRISKLVHNV-EFPYLANHYVINVE 248
                                            + +R+ +   +V   PY  NH+ I V+
Sbjct: 187 ---------------------------------QTRRVLQPGESVVAVPYFINHFEITVD 213

Query: 249 VHDRGEGNYRVVGVTVDPYSTTDSANPE---KGNKLFLDEKKDNEVTFSYSVNFIESETV 305
            H R E   RVVGV+V P S  +    +    GN L L E  D +VTF+YSV F ES+  
Sbjct: 214 YHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVS 273

Query: 306 WATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSDFARYEEFNLDNSFN 365
           WATRW KYLH Y+P +QW+SL+NFS++             +ALK+D  RY +FNLDN F 
Sbjct: 274 WATRWGKYLHVYDPKVQWYSLINFSLVVLLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQ 333

Query: 366 EDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAM 425
           ED GWKL H DVFR PS+++LLS+ VGSG QLFLM   ++F+A +G +SPSSRGSL + M
Sbjct: 334 EDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIM 393

Query: 426 FTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSG 485
           F  YA+FG +GSY+SMS YK F G  WK NM+LTPLLVPG I  ++L +NFFL+ V SSG
Sbjct: 394 FVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSG 453

Query: 486 TIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIP 545
            +P   +L IVV+WFV+S+P+S +GSL A K++ W +HPTKT+QIA+QIP Q WYL+T P
Sbjct: 454 AMPFGTMLAIVVLWFVLSIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWP 513

Query: 546 AILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXITYQSLC 605
           A  IAG+FPFGAIAVELYFIYTS+WFN +FYMFG                   +TY SLC
Sbjct: 514 AAYIAGLFPFGAIAVELYFIYTSIWFNTMFYMFGFLFFTFLLLTLTTALVTILLTYYSLC 573

Query: 606 MENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGA 665
           MENW+WQWRSF IGG+GCS Y+FI+SILFTKF+LGGF T++LY+GY+LL+S L C+VTG 
Sbjct: 574 MENWSWQWRSFIIGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGT 633

Query: 666 VGFISSMIFVRKIYSNVRVD 685
           +GF+SS+ FVRKIYS+++VD
Sbjct: 634 IGFVSSLWFVRKIYSSIKVD 653

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/646 (52%), Positives = 432/646 (66%), Gaps = 32/646 (4%)

Query: 45  LNYQKKDDLGKKVESREK-MLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPF 103
           ++Y  K+  G+ + + +K  +YS+DYY+ KLHFCKPE + K   S+GS+LFGDR+YNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 104 SIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYD 163
            + MLK +   +LC+ TI G DAKFINKLIKNG++QNWLIDGLPAAR++YD+ T + FY 
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 164 VGFPLGFVEIKKNVGGLGIPMDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRE 223
            GF LG VEI++  G   +P  A                                   R+
Sbjct: 121 NGFELGLVEIRQTTGEKLLPNSADTFRDLHK---------------------------RD 153

Query: 224 PKRISK-LVHNVEFPYLANHYVINVEVHDRGEGNYRVVGVTVDPYS---TTDSANPEKGN 279
            K I + L+ ++E PY  NH+ I +E HDRG  NYRVVGVTV+P S   + D      G 
Sbjct: 154 AKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGK 213

Query: 280 KLFLDEKKDNEVTFSYSVNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXX 339
            L L E + N + F+YSV FI SET W TRWDKYLH Y+PTIQW S+VNFSI+       
Sbjct: 214 ALSLSESEVNYIHFTYSVEFIPSETAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCA 273

Query: 340 XXXXXXKALKSDFARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFL 399
                 +ALKSDF+RY E NLD +  ED+ WKLGHGDVFR P   MLLSILVGSG QLFL
Sbjct: 274 VARSLLQALKSDFSRYGELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFL 333

Query: 400 MIISSIFLAAIGIISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILT 459
           MII +IFL A+G+I+P SRG+LP+ MF  Y  F F  S++SM VYKFF G  W  N ILT
Sbjct: 334 MIICTIFLPAVGLITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILT 393

Query: 460 PLLVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSN 519
           P LVPG +L+ I+GLN FL+FVHSSG IP+     ++++WF I +PLS  GSL+A K  +
Sbjct: 394 PFLVPGLLLLVIIGLNIFLIFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCH 453

Query: 520 WGEHPTKTNQIARQIPFQSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFG 579
           W  HPTKTN +++ IP Q WYL+TIPA LI G+F FG+++VELYF+YTSLWFNKIFYM+G
Sbjct: 454 WDIHPTKTNTVSKVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYG 513

Query: 580 XXXXXXXXXXXXXXXXXXXITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKL 639
                               TY SL  ENW WQWRSF I G+GCS Y+F+HS+LFT+ KL
Sbjct: 514 FLFGSAILFTLTVSLVTVLFTYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKL 573

Query: 640 GGFTTMILYIGYTLLLSILSCIVTGAVGFISSMIFVRKIYSNVRVD 685
           GGFT  +LY+GY+ +++ L+ +VTGA+GF+SSM+FVR IYS V+VD
Sbjct: 574 GGFTNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSAVKVD 619

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/454 (61%), Positives = 343/454 (75%), Gaps = 3/454 (0%)

Query: 235 EFPYLANHYVINVEVHDRGEGNYRVVGVTVDPYS-TTDSAN--PEKGNKLFLDEKKDNEV 291
           E PY  NHY I +E HDRGE NYR+VGVTV+P S   DS +     G  L L E +DNEV
Sbjct: 212 EIPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIKRDSPDSCESTGKSLVLSETEDNEV 271

Query: 292 TFSYSVNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXKALKSD 351
            F+YSV FI+S+TVWATRWDKYLH Y+P IQWFSL+NFS I              ALK+D
Sbjct: 272 YFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLINFSTIVVLLSSVMLHSLYSALKND 331

Query: 352 FARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIG 411
            ARY E NLD  F E++GWKL HGDVFR P++++LLS+LVGSG QL LM+ ++I  A +G
Sbjct: 332 LARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLLSVLVGSGGQLALMLTTTILFACLG 391

Query: 412 IISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSI 471
            +SPSSRGSL + MF  YA+FG +GS+ SM+ YKFF G  W+ N++LTPLLVPG IL  +
Sbjct: 392 FLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFFNGKAWRLNLVLTPLLVPGSILTVV 451

Query: 472 LGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIA 531
           LGLNFFL+FVHSSG IP   +L++V++WFVIS+PLS +GS++A K+ NW EHPTKTNQIA
Sbjct: 452 LGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLSAIGSVIAWKKCNWNEHPTKTNQIA 511

Query: 532 RQIPFQSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXX 591
           RQIPFQ WYLKTIP  L+AGIFPFG+IAVELYFIY+SLWFNKI+YMFG            
Sbjct: 512 RQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYSSLWFNKIYYMFGFLFFSFILLALT 571

Query: 592 XXXXXXXITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGY 651
                  +TY SLCMENW WQWRSF IGG GC+ Y+F HSILFTKF+LGG TT++LY+GY
Sbjct: 572 TSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYVFCHSILFTKFRLGGLTTIVLYLGY 631

Query: 652 TLLLSILSCIVTGAVGFISSMIFVRKIYSNVRVD 685
           ++L+S L C+VTGA+GF+SS+I VRKIYS V+VD
Sbjct: 632 SILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD 665

 Score =  213 bits (543), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 125/170 (73%), Gaps = 2/170 (1%)

Query: 6   LLIAALVS--FCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKM 63
           LL++ L+      AFYLPGVAP+TY+EGD+LPLLVNHLTPS  Y+  D        +E  
Sbjct: 9   LLVSTLIGSLLVEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHDTGDKEGF 68

Query: 64  LYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPG 123
           LYS+DYY+ K HFC+P ++ KQP+SLGSI+FGDRIYNSPF +++LK      LC   IPG
Sbjct: 69  LYSYDYYYKKFHFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPG 128

Query: 124 SDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEI 173
            DAKFINKLI NGFFQNW+IDGLPAARK+ D+ T+  FY  GF LG V++
Sbjct: 129 KDAKFINKLILNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDV 178

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  460 bits (1184), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 225/459 (49%), Positives = 312/459 (67%), Gaps = 13/459 (2%)

Query: 235 EFPYLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGNKLFLDEKK------- 287
           E  Y+ NH+ I +  +DRG+G YRVV     P S      P  G++L   + K       
Sbjct: 152 EQKYIYNHFDIYIHYNDRGKGEYRVVFAEAKPISL-----PRTGSELCSKDAKPVPIGSG 206

Query: 288 -DNEVTFSYSVNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXK 346
               +TF+YSV F +S+  W+TRWD+YLH Y+  IQ   L++FS++             +
Sbjct: 207 NHENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFSLVVLLLSSVLVHSLFR 266

Query: 347 ALKSDFARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIF 406
            LK D A Y EFNLD+ F +D  WK+ HG+VFR PS+++LLS+ VGSG+QLF M + ++ 
Sbjct: 267 VLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGSQLFFMALCTVL 326

Query: 407 LAAIGIISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGF 466
           L + G +SPS+RGSL + MF  YALFG  GSY SMS+YKFF G  WK N+ILTPLL+P F
Sbjct: 327 LGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLILTPLLIPVF 386

Query: 467 ILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTK 526
           + V+ + LNFFL++  SSG +P   ++ I+++WF++S+P+S +GSLL+ K + W EHP K
Sbjct: 387 LFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSWKLNRWDEHPAK 446

Query: 527 TNQIARQIPFQSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGXXXXXXX 586
           TNQIARQ+P Q WY+KT  A  +AG+FPFGA+AVELY+IY S+W   IF+M+G       
Sbjct: 447 TNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIWGEIIFFMYGFLFVAFI 506

Query: 587 XXXXXXXXXXXXITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMI 646
                       +TY SLCMENW WQWRSF IGGVGCS+Y+F+HS+ F KFK  GF +M+
Sbjct: 507 LLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFIKFKFPGFVSMV 566

Query: 647 LYIGYTLLLSILSCIVTGAVGFISSMIFVRKIYSNVRVD 685
           LY+GY+ ++SI+ C+VTG++GF++++ FVRKIYSN++VD
Sbjct: 567 LYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

 Score =  111 bits (278), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 79/142 (55%), Gaps = 23/142 (16%)

Query: 7   LIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYS 66
           L+ A VS+   FY PGV+P TY+ GDE+PLLVN+L+                     L++
Sbjct: 8   LLCAGVSY--GFYFPGVSPVTYHIGDEIPLLVNYLS------------------SDFLWN 47

Query: 67  FDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDA 126
            DYY   +  CKP  I +Q +SLGS++FGDR+YNSPF + MLK    VKLC  TI   D 
Sbjct: 48  IDYYSDSIGLCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---DT 104

Query: 127 KFINKLIKNGFFQNWLIDGLPA 148
              N      +  NWL+DGLP 
Sbjct: 105 ALWNTFFGYRYSYNWLVDGLPV 126

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  143 bits (361), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 168/731 (22%), Positives = 281/731 (38%), Gaps = 156/731 (21%)

Query: 23  VAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKI 82
           + P+ Y +GD L L+VN                KVES    L    Y +  L F  P  +
Sbjct: 52  ITPNFYRKGDPLELIVN----------------KVESD---LTQLPYAYYDLPFTCPPTM 92

Query: 83  VKQP--DSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQN 140
            K+P   SL  I+ GDR + S + +K  +      LC+        + ++KL++ G+   
Sbjct: 93  HKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLVREGYVVQ 152

Query: 141 WLIDG-LPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAXXXXXXXXXXXXX 199
           WLID  LPAA     +  H ++Y  GFPLGF+                            
Sbjct: 153 WLIDDELPAATTFISTTDHKKYYASGFPLGFI---------------------------- 184

Query: 200 XXXXXXXXXXXXXXXXXXXXXXREPKRISKLVHNVEFPYLANHYVINVEVHDRGEGNYRV 259
                                  +P      +HN        H ++ +  H        +
Sbjct: 185 -----------------------DPDTDKTYLHN--------HVMLVIRFHASDNDKNTI 213

Query: 260 VGVTVDPYSTTDSANPEKGNKLFLDE----KKDNEVT---FSYSVNFIES-ETVWATRWD 311
           VG  V P S +D   P         E    + +NE+T   F+YSV + E  E  W  RWD
Sbjct: 214 VGFEVYPRSVSDYHCPGASKNYEQYEIVIPEDENELTYLPFTYSVYWREEFEVDWNHRWD 273

Query: 312 KYLH----TYNPTIQ--WFSLVNFSIIXXXXXXXXXXXXXKALKSD---------FARYE 356
            +L+    +   +IQ  W SL N   I             + + +D             E
Sbjct: 274 YFLNAGELSDEQSIQFHWMSLANSVGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIE 333

Query: 357 EFNLDNSFNEDSGWKLGHGDVFRIPSQSM-----------LLSILVGSGAQLFLMIISSI 405
               ++  ++D   K G   V+ +    +           +L +LV  G Q    II S+
Sbjct: 334 GIETEDDLDDD---KYGKYSVYTVAKDWIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSL 390

Query: 406 FLAAIGIISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKAN---------- 455
            ++       + R S+ +    F+ L  F  S++   +    K    KAN          
Sbjct: 391 TISCSMNKLHNVRNSVLTMAILFFVLGAFMASFVGTRLSMVTKTKRTKANYLDDNRYLKD 450

Query: 456 --------MILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLS 507
                    IL    +PG ++VS   LN  +    S+  +P   ++  + I+F++ +PLS
Sbjct: 451 YKKFSPIFTILCGSSLPGIVMVSTFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLS 510

Query: 508 FLGSLLANK---RSNWGEHPTK--TNQIARQIPFQSWYLKTIP----AILIAGIFPFGAI 558
             G ++AN       W    TK  +N     +       K  P     I + GIFP   I
Sbjct: 511 LFGGIVANNIPLPQYWLSGITKDESNSDGNGLFVPKSRAKFNPLVYCGIYLCGIFPLLVI 570

Query: 559 AVELYFIYTSLWFNKI--FYMFGXXXXXXXXXXXXXXXXXXXITY--QSLCMENW----N 610
            VE+ ++Y SLW  K   +Y +G                    +Y     C E+     N
Sbjct: 571 YVEMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNN 630

Query: 611 WQWRSFTIGGVGCSLYIFIHSI--LFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAVGF 668
           W+W+ F +G  G  +Y+ ++S+  +F    + GF+++++ I Y+L+ +++  +  GA+ +
Sbjct: 631 WRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSY 689

Query: 669 ISSMIFVRKIY 679
           +++  F+ KIY
Sbjct: 690 LTASWFINKIY 700

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  130 bits (327), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 157/713 (22%), Positives = 272/713 (38%), Gaps = 138/713 (19%)

Query: 41  LTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKIVKQPD--SLGSILFGDRI 98
           +TP+  Y+K D L   V   E  L    Y +  L F  P  + K+P   SL  I+ GDR 
Sbjct: 53  ITPNF-YKKNDFLELIVNKVESDLTQLPYAYYDLPFTCPPTMHKKPLHLSLNEIIRGDRK 111

Query: 99  YNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQNWLIDG-LPAARKIYDSNT 157
           + S + ++  +      LC+        + ++KL++ G+   WLID  LPAA     +  
Sbjct: 112 WESDYKLRFGEDNACETLCARKTDKKGMQTLDKLVREGYVVQWLIDDELPAATTFISTTD 171

Query: 158 HTEFYDVGFPLGFVEIKKNVGGLGIPMDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 217
           H ++Y  GFPLGFV                                              
Sbjct: 172 HKKYYASGFPLGFV---------------------------------------------- 185

Query: 218 XXXXREPKRISKLVHNVEFPYLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTD------ 271
                +P      +HN        H ++ +  H  G+    VVG  V P S +D      
Sbjct: 186 -----DPDTDKTYLHN--------HVILVIRFHGGGDDKNTVVGFEVYPKSVSDYHCPGA 232

Query: 272 SANPEKGNKLFLDEKKD-NEVTFSYSVNFIES-ETVWATRWDKYLHT------YNPTIQW 323
           S N E+   +  +++ D   + F+YSV + E  E  W  RW+ +L+        +    W
Sbjct: 233 SKNYEQYEIVVPEDEHDLTYLPFTYSVYWREEFEVDWNHRWNYFLNAGELSDEQSAQFHW 292

Query: 324 FSLVNFSIIXXXXXXXXXXXXXKALKSD---------FARYEEFNLDNSFNEDSGWKLGH 374
            SL N   I             + +++D             E    ++S ++D   K G 
Sbjct: 293 MSLANSLGIVLSISFITFVIYIRVMRTDKKNTDSHKYLINTEGIEAEDSLDDD---KYGK 349

Query: 375 GDVFRIPSQSM-----------LLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPS 423
             V+ +    +           +L +LV  G Q    II S+ ++       + R S+ +
Sbjct: 350 NSVYMVTKDWIQNGKPDLFGLKVLIVLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLT 409

Query: 424 AMFTFYALFGFWGSYI-----------SMSVYKFFKGPYWKANMILTPLL-------VPG 465
                + L  F  S++           +++V        +K     +P+        +PG
Sbjct: 410 MAILCFVLGAFMASFVGTRLGIVTKRRNINVNYLDHNKSFKNCREFSPIFAVICGSSLPG 469

Query: 466 FILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANK-------RS 518
            +++    LN  +    S+  +P   ++  + I+FV+ +PLS  G ++AN         S
Sbjct: 470 MVMIGTFLLNSVVGAHDSTNALPFRTIVFFISIYFVVCIPLSLFGGIVANNIPLPKYWLS 529

Query: 519 NWGEHPTKTNQIARQIPFQSWYLKTI--PAILIAGIFPFGAIAVELYFIYTSLWFNKIFY 576
              +  T  N      P        +    + + GIFP   I VE+ ++Y SLW  K  +
Sbjct: 530 GITKDETDGNGSKLFKPKSRTRFNPLVHCGVYLCGIFPLLVIYVEMQYVYKSLWLEKTTF 589

Query: 577 MFGXXXXXXXXXXXXXXXXXXXITYQSLCME--------NWNWQWRSFTIGGVGCSLYIF 628
            F                    I    L M           NW+WR F +G  G  +Y+ 
Sbjct: 590 YFFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFDDKEVRNNWRWRCFEMGFSG-GVYME 648

Query: 629 IHSI--LFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAVGFISSMIFVRKIY 679
           ++S+  +F    + GF+++++ I Y+LL +IL  +  GA+  +++  F+ +IY
Sbjct: 649 LYSLYYIFVVLNIHGFSSILISICYSLLFNILCGLGLGALSCLTASWFINRIY 701

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  110 bits (275), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 121/497 (24%), Positives = 208/497 (41%), Gaps = 62/497 (12%)

Query: 238 YLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGN-----KLFLDEKKDNE-- 290
           YL  H ++ +  +      + +VG  V P S +D   P         ++ + E  D+   
Sbjct: 181 YLNTHVMLVIRYNTVDVNKHTIVGFEVYPKSVSDFHCPGASKNYEPYEIVIPENDDDLTF 240

Query: 291 VTFSYSVNFIESETV-WATRWDKYLHT----YNPTIQ--WFSLVNFSIIXXXXXXXXXXX 343
           + F+YSV + E   V W  RWD YL++     N T Q  W SL N + I           
Sbjct: 241 IPFTYSVYWREEYLVDWDHRWDLYLNSGELSENKTTQFHWISLANSAGIVFLMSFVVSVI 300

Query: 344 XXKALKS------DFARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQL 397
             ++ KS      D  + EE      +     W +      R P  ++L+ + V  G Q 
Sbjct: 301 LLRSFKSSRDISTDINKSEEHRNGLVYEVARNWIINE----RTPLANLLI-LFVSMGVQF 355

Query: 398 FLMIISSIFLA-AIGIISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKAN- 455
              ++ S+ ++ ++  +       L  A+  F  L  F  SYI   + +       K   
Sbjct: 356 LFTVLGSLTISCSLNKLHDIGDSVLTMAVLCF-VLGAFMSSYIGSVLLRLKNKATMKKQP 414

Query: 456 ---------MILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPL 506
                     IL    +PG +++  L LN  +    S+  +P   +++ + ++F++ +PL
Sbjct: 415 IKKGFHLFFAILCGSFLPGIVMIVTLLLNSIVWAHDSTHALPFKTVVMFITVYFIVCIPL 474

Query: 507 SFLGSLLANKRSNWGE------HPTK------TNQI--ARQIPFQSWYLKTIP---AILI 549
           S LG  +AN     G       H ++       N++   + I      LK+I     IL+
Sbjct: 475 SILGGYMANSSKTKGSLTDPKFHTSRPELELFANKLKPKKHIFLFGARLKSIKIALPILL 534

Query: 550 AGIFPFGAIAVELYFIYTSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXXITYQSLCM- 606
           +GIFPF  I VEL ++Y S+W  K   +Y +G                    TY  L M 
Sbjct: 535 SGIFPFVIIYVELQYVYKSVWLEKTAFYYFYGFLFANILLLCIVVGEIAIIGTYTMLHMA 594

Query: 607 --ENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLG--GFTTMILYIGYTLLLSILSCIV 662
              N +W+W SF +G   C+ Y+ ++S+ +  F L   GF+++ + + Y  L + L    
Sbjct: 595 DRNNTDWRWISFFMGS-SCAWYMELYSLYYVFFILNIRGFSSIFISVCYGALFNTLCGCA 653

Query: 663 TGAVGFISSMIFVRKIY 679
            G++  ++S  FV K+Y
Sbjct: 654 MGSIASLTSHFFVEKLY 670

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 72/153 (47%), Gaps = 22/153 (14%)

Query: 23  VAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKI 82
           + P+ Y +GDE+ L+VN                KVES    L    Y +  L F  P  +
Sbjct: 41  LQPNFYFQGDEVELIVN----------------KVESD---LTQLPYAYYDLPFTCPPTM 81

Query: 83  VKQPD--SLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQN 140
            K+P   SL  I+ GDR + S + +K  + +    LC+        K   KL+++G+   
Sbjct: 82  HKKPLHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVVQ 141

Query: 141 WLID-GLPAARKIYDSNTHTEFYDVGFPLGFVE 172
           WLID  LPAA     +    ++Y  GFPLGFV+
Sbjct: 142 WLIDEELPAATTFISTIDQKKYYASGFPLGFVD 174

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  106 bits (265), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 120/497 (24%), Positives = 204/497 (41%), Gaps = 69/497 (13%)

Query: 238 YLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGN-----KLFLDEKKDNE-- 290
           YL  H +I +  +      + + G  + P ST D   P         +L + E  D+   
Sbjct: 182 YLNTHVMIVIRYNTVDTNKHTIFGFELYPKSTVDFHCPGASKDYEQYELVVPENDDDLTF 241

Query: 291 VTFSYSVNFIESETV-WATRWDKYLHT------YNPTIQWFSLVN-FSIIXXXXXXXXXX 342
           + F+YSV + E   V W  RWD YL+        +    W SL N F I+          
Sbjct: 242 IPFTYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQFHWISLANSFGIVFLISSITAVI 301

Query: 343 XXXKALKSDFARYEEFNLDN-SFNEDSGWKLGHGDVFRIPSQSML---------LSILVG 392
                       Y  F +   SF++ S  +   G ++ +  + +L         L I V 
Sbjct: 302 L-----------YRTFKISRRSFSDISKEEDDKGSIYVVARKWLLNEQTPLANVLIIFVS 350

Query: 393 SGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYW 452
            G Q    ++ S+ ++       + R S+ +     +    F  S+    + K  +    
Sbjct: 351 MGVQFLFTVLGSLIISCSLKKLHNVRDSVLTMGLLCFVTGAFMASFTGAHLLKSREEMCS 410

Query: 453 KANM----------ILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVI 502
           ++ M          +L   L+P F+++  L LN  +    S+  +P   +L ++ ++FV+
Sbjct: 411 ESQMKPTRYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDSTHALPFGTVLFLISVYFVV 470

Query: 503 SLPLSFLGSLLANKRSNWGEHPTKTNQIA---------RQIPFQSWYLKTIP----AILI 549
            +PLS LG  +A K +N    P+ +  I          + I      L   P    AIL 
Sbjct: 471 CIPLSLLGGYIAVKSTN--SKPSFSFSIGNYSDRIFVYKTITMSPSVLINRPLSSLAILA 528

Query: 550 AGIFPFGAIAVELYFIYTSLWFNKI--FYMFGXXXXXXXXXXXXXXXXXXXITY---QSL 604
            G+FPF  I VEL ++Y SLW  K   +Y +G                    T+    S 
Sbjct: 529 GGLFPFIIIYVELQYVYKSLWLEKTTFYYFYGFLLANILLLCIVICEISIIGTFILLNSA 588

Query: 605 CMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLG--GFTTMILYIGYTLLLSILSCIV 662
              + NW+W SF IG   C+ Y+ ++S+ +  F L   GF+++ + + Y  L +I+    
Sbjct: 589 DKNSNNWRWTSFQIGA-SCAFYMEVYSLYYVFFILNIRGFSSIFISVCYGTLFNIMCGCA 647

Query: 663 TGAVGFISSMIFVRKIY 679
           TG++  ++S  FV+KIY
Sbjct: 648 TGSIACLTSHWFVQKIY 664

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 70/151 (46%), Gaps = 22/151 (14%)

Query: 25  PSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKIVK 84
           P+ Y++GD + L+VN                KVES    L    Y +  L F  P  + K
Sbjct: 44  PNYYSKGDPVELIVN----------------KVESD---LTQLPYAYYDLPFTCPPTMHK 84

Query: 85  QPD--SLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQNWL 142
           +P   SL  I+ GDR + S + +   + +    LC+        K   +L+KNG+   WL
Sbjct: 85  KPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVVQWL 144

Query: 143 IDG-LPAARKIYDSNTHTEFYDVGFPLGFVE 172
           ID  LPA      +  H ++Y  GFPLGFV+
Sbjct: 145 IDDELPAVTTFISTTDHKKYYASGFPLGFVD 175

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  106 bits (265), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 117/520 (22%), Positives = 211/520 (40%), Gaps = 78/520 (15%)

Query: 238 YLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGNKLFLDE----KKDNEVT- 292
           YL NH ++ +  H    G   +VG  V P S +D   P         E    + +NE+T 
Sbjct: 192 YLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHCPGASKTYEQYEITIPEDENELTY 251

Query: 293 --FSYSVNFIES-ETVWATRWDKYLHT------YNPTIQWFSLVNFSIIXXXXXXXXXXX 343
             F+YSV + E  E  W  RWD +L++       +    W S  N  II           
Sbjct: 252 LPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQFHWMSFANSVIIVLSISLITLII 311

Query: 344 XXKALKSD---------FARYEEFNLDNSFNEDS-----------GW-KLGHGDVFRIPS 382
               + +D             E    ++  N D             W + G  D+F +  
Sbjct: 312 YIGVMHTDKNNPHSNKFMINIEGIGAEDVLNNDKYSKNSVYMVAKDWIQNGKPDLFSLKG 371

Query: 383 QSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFTFYALFGFWGSYIS-- 440
               L +LV  G Q    +I S+ ++       + R S+ +     + +  F  S++   
Sbjct: 372 ----LIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVLTMAILCFVIGAFMASFVGTR 427

Query: 441 ---MSVYKFFKGPYWKAN-------------MILTPLLVPGFILVSILGLNFFLLFVHSS 484
              +S  + F   Y+  N              I+    +PG I++S   LN  +    S+
Sbjct: 428 LSIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGSSLPGMIMISTFLLNSIVWAHDST 487

Query: 485 GTIPMTALLLIVVIWFVISLPLSFLGSLLANK---RSNW------GEHPTKTNQIARQIP 535
             +P   ++  + ++F++ +PLS  G ++AN       W       E  +K N++     
Sbjct: 488 NALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQYWLSGITIDESDSKNNKLFLPKS 547

Query: 536 FQSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKI--FYMFGXXXXXXXXXXXXXX 593
              +       I + G+FP   I VE+ ++Y SLW  K   +Y +G              
Sbjct: 548 PNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVLTM 607

Query: 594 XXXXXITY--QSLCMENW----NWQWRSFTIGGVGCSLYIFIHSI--LFTKFKLGGFTTM 645
                 +Y     C E+     NW+W+ F +G  G  +Y+ ++S+  +F    + GF+++
Sbjct: 608 EISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSI 666

Query: 646 ILYIGYTLLLSILSCIVTGAVGFISSMIFVRKIYSNVRVD 685
           ++ I Y+LL +I+  +  GA+ ++++  F+ KIY +V+V+
Sbjct: 667 LISICYSLLFNIMCGLGLGALSYLTASWFINKIY-HVKVN 705

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 69/153 (45%), Gaps = 22/153 (14%)

Query: 23  VAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKI 82
           + P+ Y  GD L L+VN                KVES    L    Y +  L F  P  +
Sbjct: 52  ITPNFYKNGDPLELIVN----------------KVESD---LTQLPYAYYDLPFTCPPTM 92

Query: 83  VKQP--DSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQN 140
            K P   SL  I+ GDR + S + +   +      LC+        + ++KLI+ G+   
Sbjct: 93  HKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQTLDKLIREGYVVQ 152

Query: 141 WLIDG-LPAARKIYDSNTHTEFYDVGFPLGFVE 172
           WLID  LPAA     +  H ++Y  GFPLGF++
Sbjct: 153 WLIDDELPAATTFISTTDHKKYYASGFPLGFMD 185

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score = 99.0 bits (245), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 108/510 (21%), Positives = 216/510 (42%), Gaps = 72/510 (14%)

Query: 238 YLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGNKLFLDE-------KKDNE 290
           Y+ NH ++ +  H   + N+ +VG  + P S +D   P         E        +D  
Sbjct: 173 YVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPGASKDYDQYEVVVPEIANEDTF 232

Query: 291 VTFSYSVNFIES-ETVWATRWDKYLHT------YNPTIQWFSLVNFSIIXXXXXXXXXXX 343
           + F+YSV + E  +  W  R++ +  +       +    W SL N + I           
Sbjct: 233 IPFTYSVYWREEFDVEWKDRYNLFFDSGELSGSVSRKFHWISLANSASIAFLMTFIVSLI 292

Query: 344 XXK--ALKSDFARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMI 401
             K   + +     +E    + F     W          P    L   +V  G      +
Sbjct: 293 FIKITGIPNRLETKKESPKASIFVIARNWFYDDR-----PVMPHLFICIVSMGVHFLFTV 347

Query: 402 ISSIFLAAIGIISPSSRGSLPSAMFTFYALFGFWGSYISMSVYK------FFKGPYWK-- 453
           I S+ ++       + R S+ +    F+ L  F  S++  ++          +G      
Sbjct: 348 IGSLTISCSLNSLHTIRNSVLTMALLFFVLGAFMASFVGGTLLIENNKLIMRRGSLKNVF 407

Query: 454 ANMILTPL----LVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFL 509
           +N++L  +    L+PG ++++ + LN  +    S+  +P   ++ ++ I+F++ +PLS L
Sbjct: 408 SNILLFSVVCGSLLPGMVILTAIILNCIIWLHTSTNVLPFATIMKLLFIYFIVCIPLSVL 467

Query: 510 -GSLLANKRSNWGEH----------PTKTNQI-----------ARQIPFQ-SWYLK---- 542
            GS+ ANK S                T+ N+I            R++ ++  W LK    
Sbjct: 468 GGSIAANKDSEEYSRLRSDSIKRISRTRANKIMDEDQGTDVRTTRKLKYKVRWQLKKMML 527

Query: 543 ---TIPAILIAGIFPFGAIAVELYFIYTSLWFNKI--FYMFGXXXXXXXXXXXXXXXXXX 597
              T+ ++L +GIFPF  I VEL F+Y S+W+ K   +Y +G                  
Sbjct: 528 DTVTVVSLLASGIFPFIMIYVELQFVYKSVWYEKTTFYYYYGFLLANIILLCLVICDIAI 587

Query: 598 XITYQSLCMENWN----WQWRSFTIGGVGCSLYIFIHSI--LFTKFKLGGFTTMILYIGY 651
             +Y  + + + +    W+W++F +    C+ Y+  +SI  +F    +  F+++++ + Y
Sbjct: 588 ICSYLMMTVSSKDNSDSWKWKTFQLSS-SCAWYMEAYSIYYVFKVLNMRDFSSILISVCY 646

Query: 652 TLLLSILSCIVTGAVGFISSMIFVRKIYSN 681
           +LL + L  +  G++G+++S+ FV+++Y +
Sbjct: 647 SLLFNALCGLAMGSIGYLASLWFVKRVYRS 676

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 74/170 (43%), Gaps = 22/170 (12%)

Query: 6   LLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLY 65
           L +  L SF N      + P+ Y  GD + ++VN                K+ES    L 
Sbjct: 16  LFLRGLFSFVNTTNEGWLTPTIYRHGDPVEIIVN----------------KIESDATQL- 58

Query: 66  SFDYYFPKLHFCKPEKIVKQPD--SLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPG 123
            + YY   L F  P  + K+P   SL  ++ GDR + S + ++  K      LC+     
Sbjct: 59  PYGYY--DLPFTCPPTVDKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNP 116

Query: 124 SDAKFINKLIKNGFFQNWLIDG-LPAARKIYDSNTHTEFYDVGFPLGFVE 172
              + ++K IK  +   W ID  LPAA     +    ++Y  GFPLGFV+
Sbjct: 117 DGMRSLDKFIKQEYVVQWFIDKELPAATTFISTVDQKKYYGSGFPLGFVD 166

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score = 98.6 bits (244), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 112/513 (21%), Positives = 205/513 (39%), Gaps = 75/513 (14%)

Query: 238 YLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGNKLFLDE----KKDNEVT- 292
           YL NH ++ +  H        +VG  V P S +D   P         E    + +NE+T 
Sbjct: 192 YLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYHCPGASKNYEQYEIVVPEDENELTY 251

Query: 293 --FSYSVNFIES-ETVWATRWDKYLHT------YNPTIQWFSLVN-----FSIIXXXXXX 338
             F+YSV + E  E  W  RWD +L++       +    W S  N      SI       
Sbjct: 252 LPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSAQFHWMSFANSMGIVLSISFITAVI 311

Query: 339 XXXXXXXKALKSDFARY----EEFNLDNSFNEDSGWKLGHGDVFRIPSQSM--------- 385
                      +D  +Y    E   ++++ ++D   K G   V+ +    +         
Sbjct: 312 YIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDD---KYGKNSVYMVTKDWIQNGRPNMFG 368

Query: 386 --LLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFTFYALFGFWGSYISMSV 443
             +L +LV  G Q    +I S+ ++       + R S+ +     + L  F  S++   +
Sbjct: 369 LKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVITMAILCFVLGAFMASFVGTRL 428

Query: 444 YKFFKGPYWKANMI-----------LTPLL-------VPGFILVSILGLNFFLLFVHSSG 485
               K    + N +            +P+        +PG ++VS   LN  +    S+ 
Sbjct: 429 SIVTKRRSIEINYLDDSKNFNNCNKFSPVFAIICGSSLPGLVMVSTFLLNSIVWAHDSTN 488

Query: 486 TIPMTALLLIVVIWFVISLPLSFLGSLLANK---RSNWGEHPTKTNQIARQ----IPFQS 538
            +P   ++  + ++F++ +PLS  G  +AN      +W    TK           +P   
Sbjct: 489 ALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRHWLSGITKDETCGNSSRLFVPRSR 548

Query: 539 WYLKTI--PAILIAGIFPFGAIAVELYFIYTSLWFNKI--FYMFGXXXXXXXXXXXXXXX 594
                +    I + G+FPF  I VEL ++Y S+W  K   +Y +G               
Sbjct: 549 TKFNPLVYCGIYLCGLFPFLVIYVELQYVYKSVWLEKTTFYYFYGFLLLNIILLCVLTME 608

Query: 595 XXXXITYQ--SLCMENW----NWQWRSFTIGGVGCSLYIFIHSI--LFTKFKLGGFTTMI 646
                +Y     C E+     NW+W+ F +G  G  +Y+ ++S+  +F    + GF++ +
Sbjct: 609 ISIIGSYSLMRFCFEDKDVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSTL 667

Query: 647 LYIGYTLLLSILSCIVTGAVGFISSMIFVRKIY 679
           + I Y+LL +I+  +  G + ++++  F+ KIY
Sbjct: 668 ISICYSLLFNIMCGLGLGGLSYLTASWFINKIY 700

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 74/160 (46%), Gaps = 22/160 (13%)

Query: 16  NAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLH 75
           N +Y   + P+ Y +GD L L+VN                KVES    L    Y +  L 
Sbjct: 45  NTYYDGWITPNFYKKGDPLELIVN----------------KVESD---LTQLPYAYYDLP 85

Query: 76  FCKPEKIVKQPD--SLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLI 133
           F  P  + K+P   SL  I+ GDR + S + +   +      LC+        + ++KL+
Sbjct: 86  FTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDKLV 145

Query: 134 KNGFFQNWLIDG-LPAARKIYDSNTHTEFYDVGFPLGFVE 172
           + G+   WLID  LPAA     +  H ++Y  GFPLGFV+
Sbjct: 146 REGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFVD 185

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 115/499 (23%), Positives = 204/499 (40%), Gaps = 51/499 (10%)

Query: 233 NVEFPYLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANP--EKGNK---LFLDEKK 287
           + E  YL  H ++ +  +      + +VG  V P S +D   P   KG +   L + E +
Sbjct: 176 DTEKTYLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCPGASKGYEQYELIVPENE 235

Query: 288 DN--EVTFSYSVNFIESETV-WATRWDKYLHT------YNPTIQWFSLVNFSIIXXXXXX 338
           D    + F+YSV + E   V W+ RW+ +L++       +    W +L N   I      
Sbjct: 236 DELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFHWMTLGNSVGISFLLML 295

Query: 339 XXXXXXXKALKSDF-ARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQS-----MLLSILVG 392
                  + ++    A  EEF      NE++    G    +   + S      +L+I V 
Sbjct: 296 IVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWLAQTDSSSISFKILTIFVS 355

Query: 393 SGAQLFLMIISSI-FLAAIGIISPSSRGSLPSAMFTF----YALFGFWGSYISMSVYKFF 447
            G Q    II S+ F  ++  +       L  A F      Y    F G+++ +      
Sbjct: 356 IGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLWHLFVGTWLHIDHRTTN 415

Query: 448 KGPYWKANM--ILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLP 505
            G   +     IL    +PG +++S   LN+ +    SS  +P   ++L V I+FVI +P
Sbjct: 416 DGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPFRTIVLFVSIYFVICIP 475

Query: 506 LSFLGSLLANK--RSNWGEHPTKTNQIARQIPFQSWYLKTIP------------AILIAG 551
           LS LG  ++++  R      P  ++  AR I          P               I G
Sbjct: 476 LSLLGEEVSHRVHRKQAQNFPILSSLGARSIKPCRAPTTLAPRKISERLTFDFATFAICG 535

Query: 552 IFPFGAIAVELYFIYTSLWFNKI--FYMFGXXXXXXXXXXXXXXXXXXXITYQSLCMENW 609
             PF  I VEL +IY S+W  K   +Y++G                     Y  +     
Sbjct: 536 FLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIVVCEVSFLGCYVMMRKHKR 595

Query: 610 -----NWQWRSFTIGGVGCSLYIFIHSI--LFTKFKLGGFTTMILYIGYTLLLSILSCIV 662
                +W+W+ F + G  C+ Y+ ++S+  +F   K+ GF ++ + + Y+L+ +I+    
Sbjct: 596 VATFDSWRWKCFMM-GTSCAWYMELYSLYYIFHTLKMTGFPSIFISVSYSLIFNIMCGCG 654

Query: 663 TGAVGFISSMIFVRKIYSN 681
            G++G+++S   V +++  
Sbjct: 655 MGSLGYLTSCWLVNRVFCT 673

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 71/153 (46%), Gaps = 22/153 (14%)

Query: 23  VAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKI 82
           + P+ Y  GD + LLVN                KVES    L  F Y +  L F  P   
Sbjct: 41  LQPNVYRWGDHVELLVN----------------KVESD---LTQFPYGYYDLPFTCPPTE 81

Query: 83  VKQPD--SLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQN 140
            K+P   SL  I+ GDR + S + +K  +  +   LC+     +  +   +L++ G+   
Sbjct: 82  DKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVVQ 141

Query: 141 WLIDG-LPAARKIYDSNTHTEFYDVGFPLGFVE 172
           WLID  LPAA     +  H ++Y  GFPLGFV+
Sbjct: 142 WLIDQELPAATTFISTIDHKKYYVSGFPLGFVD 174

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 113/487 (23%), Positives = 203/487 (41%), Gaps = 61/487 (12%)

Query: 238 YLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGNKLFLDEKKD---NEVTF- 293
           +  NH ++ +  +        +VG    P S +D   P         E  D    E+ + 
Sbjct: 181 FFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDYHCPGASKDFKPFEITDPPLEEIVYI 240

Query: 294 --SYSVNFIE-SETVWATRWDKYLH------TYNPTIQWFSLVNFSIIXXXXXXXXXXXX 344
             +YSV + E +E  W+ RW  Y++      + + T  W +L N   I            
Sbjct: 241 PVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSSTFHWMALANSVGIVLFVTFIVIVNL 300

Query: 345 XKALKSDFARYEEFNLDNSFNEDSGWKLGHGDVFRIPS---------QSMLLSILVGSGA 395
                    R     L++  NEDS       D+F + +         Q   L + V  G 
Sbjct: 301 IMIF-----RNPNEQLESKENEDSS------DIFNVANNWLRARQGFQLNRLIVCVSMGI 349

Query: 396 QLFLMIISSIFLA-AIGIISPSSRGSLPSAMFTFYA---LFGFWGSYISM----SVYKFF 447
           Q+  MI+  + ++ ++  +       L  A   F A   +  F G+++ M    S Y F+
Sbjct: 350 QVMFMILGPLAISLSLTRLHNIKNSVLTIAALCFVAGAFMASFVGTWLKMDQNISAYTFY 409

Query: 448 KGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLS 507
              +     +L    +PG I+V  L LN  +    S+  +P   +++ V  +FV+ + +S
Sbjct: 410 NPVF----AVLCGSALPGSIMVLTLSLNCIIWIWDSTKALPFGTMVVFVSWYFVVCIVVS 465

Query: 508 FLGSLLANK--RSNWGEHPTKTNQIARQIPFQSWY----LKTIPAILIAGIFPFGAIAVE 561
            LG  +A +  RS   + P  T    R++  +S      L    A LI+G  PF  I VE
Sbjct: 466 LLGGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAISGKLVVFLAGLISGFLPFVIIYVE 525

Query: 562 LYFIYTSLWFNK--IFYMFG-----XXXXXXXXXXXXXXXXXXXITYQSLCMENWNWQWR 614
           L ++Y S+W  K  ++Y++                         +      + + NW+WR
Sbjct: 526 LEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEISLLGCLVLMKLNHKFINDQNWRWR 585

Query: 615 SFTIGGVGCSLYIFIHSILFTKF--KLGGFTTMILYIGYTLLLSILSCIVTGAVGFISSM 672
            F I   GCS Y+ I+S+ +  F   + G + + + + Y+ + ++L  + TG++G+++S 
Sbjct: 586 CFVI-STGCSWYMEIYSLYYIFFIIHMTGDSAVFISVCYSFIFNVLCGLATGSLGYLTSS 644

Query: 673 IFVRKIY 679
            FV+KI+
Sbjct: 645 WFVKKIH 651

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 69/155 (44%), Gaps = 22/155 (14%)

Query: 25  PSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKIVK 84
           P+ Y+ GD L L+VN                 VES E     F YY   L F  P    K
Sbjct: 43  PNVYSIGDPLELVVN----------------TVES-EITDIPFGYY--DLPFTCPPTPEK 83

Query: 85  QPD--SLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQNWL 142
           +P   SL  I+ GDR + S + + + +      LC+        +    LIK+G+   W+
Sbjct: 84  KPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLIKSGYMVQWM 143

Query: 143 IDG-LPAARKIYDSNTHTEFYDVGFPLGFVEIKKN 176
           ID  LPAA     +  + ++Y  GFPLG V+ + +
Sbjct: 144 IDDDLPAATTYISTTDNLKYYAPGFPLGSVDPRSS 178

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 120/538 (22%), Positives = 211/538 (39%), Gaps = 120/538 (22%)

Query: 238 YLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGNKLFLDEKKDNE------- 290
           YL NH ++ +  H      + +VG+ V P S +D   P  G     D  + N        
Sbjct: 196 YLNNHVMLVIRYHTVDINKFTIVGLEVYPKSVSDYHCP--GASKNFDHYEVNTEETETTY 253

Query: 291 VTFSYSVNFIESETV-WATRWDKYLHT------YNPTIQWFSLVNFSIIXXXXXXXXXXX 343
           + F+YS+ + E   V W  RW+ ++++       +    W SL N  +I           
Sbjct: 254 IPFTYSIYWREEFNVDWTNRWNFFINSGEISQEKSSQFHWISLANSVVIVTLMTLVVALI 313

Query: 344 XXKALKSDFARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIIS 403
             K++ +D    E  +   S    S W + H  +         L++    G Q    I+ 
Sbjct: 314 LAKSVSTD----ETVSTSTS-QVASQWVVQHSYLLN------HLNVFTAMGVQFLFTILG 362

Query: 404 SIFLAAIGIISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANM------- 456
           S+ ++     S +   ++ +++ T   +    G+Y S      F G    AN        
Sbjct: 363 SLIISC----SMNKLHNIRNSVLTMALMCFISGAYTSS-----FVGALLSANHNTTIKIS 413

Query: 457 ILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLA-- 514
           I     +PGF L  +L LN  +    S+  +P   ++L++ ++F++ +PLS LG + A  
Sbjct: 414 IACGSALPGFTLCVVLILNCIIWAKDSTHALPFGTIVLLITVYFIVCIPLSILGGVSATY 473

Query: 515 --------NKRS----------NWGEHPTKTNQIARQIPFQSWYLKTIPAIL-------- 548
                   + RS          ++ + P   N++   +P  S   K +P +L        
Sbjct: 474 TRRKCLSLDPRSIINRFFLLNIHYDDQPVVENKV--HLPRISGNSK-LPLMLRQPVLLTV 530

Query: 549 IAGIFPFGAIAVELYFIYTSLWFNKI--FYMFGXXXXXXXXXXXXXXXXXXXITYQSL-- 604
           I+GI PF  I VEL F+Y SLW  K   +Y++G                     Y +L  
Sbjct: 531 ISGIVPFIVIYVELLFVYKSLWLEKTTFYYLYGFLLANIVLLCVVVCEISIIGCYLTLIH 590

Query: 605 -------------------------------------CMENWNWQWRSFTIGGVGCSLYI 627
                                                 M  W  +W+SF IGG   + Y+
Sbjct: 591 VSPDEFIPIATPEQAMHSPMLKQVRVQAMNFVCAIGLAMTQW--RWKSFQIGG-SVAWYL 647

Query: 628 FIHSILF--TKFKLGGFTTMILYIGYTLLLSILSCIVTGAVGFISSMIFVRKIYSNVR 683
             +S+ +  T  K+  F++++L+  Y+ L + L     GA+G++S   FV +I++N +
Sbjct: 648 EAYSLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALGYLSCCWFVNRIHTNSK 705

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 77/159 (48%), Gaps = 24/159 (15%)

Query: 23  VAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKI 82
           + P+ Y E D + ++VN                K+ES    L  F Y + +L F  P   
Sbjct: 56  IRPNVYEENDPVEIIVN----------------KIESD---LTQFPYAYYELPFTCPPTN 96

Query: 83  VKQPD--SLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQN 140
           VK+P   SL  I+ GDR + S + +   K E+ ++LC         +  ++LIK G+   
Sbjct: 97  VKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVVQ 156

Query: 141 WLIDG-LPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVG 178
           WLID  LPAA     +  H ++Y  GFPLGF++  K+ G
Sbjct: 157 WLIDDELPAATTFISTKDHKKYYASGFPLGFMD--KDTG 193

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 119/515 (23%), Positives = 204/515 (39%), Gaps = 80/515 (15%)

Query: 238 YLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTD----SANPEKGNKLFLDEKKDNEVTF 293
           +L NH ++ +  H   E  + +VG  V P S +D     AN        +  +KD+E+TF
Sbjct: 191 FLNNHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYHCPGANKNHDKYEIIVPEKDDELTF 250

Query: 294 ---SYSVNFIES-ETVWATRWDKYLH------TYNPTIQWFSLVNFSIIXXXXXXXXXXX 343
              +YSV + E  E  W  RW+ +L+      +      W S +N   I           
Sbjct: 251 IPFTYSVYWREEFEVDWNHRWNYFLNNGELSNSKANQFHWMSFLNSVGIASMTTTIVSII 310

Query: 344 XXKALKSDFARYEEFNLDNSF---NEDSGWKLGHGDVF----------RIPSQSMLLSIL 390
             K            N   +    NED       G VF          +IP    L+  L
Sbjct: 311 LLKIFSKKERESRNINTSTNLGQDNEDDNDDKISGSVFVNAKTWITVGKIPYWKALIC-L 369

Query: 391 VGSGAQLFLMIISSIFLA-AIGIISPSSRGSLPSAMFTFY---ALFGFWGSYISMSVYKF 446
              G Q    I+ S+ ++ ++  +       L  ++  F    A+ G+ GS + +  Y+ 
Sbjct: 370 TSMGIQFSFTILGSLIISCSLSKLHNIRFTVLTMSLICFICGAAISGYIGSRLYIE-YQI 428

Query: 447 FKGPYWKANMILTPLL---------VPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVV 497
            KG Y +  +  T +          +PG ++V    LN  +L   S+  +P    + +V 
Sbjct: 429 LKG-YLRNEVNRTKVYKFSVVCGSSLPGLLMVISFSLNCIILAHDSTNALPFKTEVFLVS 487

Query: 498 IWFVISLPLSFLGSLLA------------------------NKRSNWGEHPTKTNQIARQ 533
           I+FV  +PLS LG +LA                          RS++ +  +   ++   
Sbjct: 488 IYFVTCIPLSLLGGVLALNCKVDSYNTLKRITSLRRNTISRKSRSDFTKKVSLYQRLVFD 547

Query: 534 IPFQSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKI--FYMFGXXXXXXXXXXXX 591
           I   S+   T    L  G F F  I VEL ++Y S+W  K   +Y +G            
Sbjct: 548 IKHDSF---TTFGALAGGFFSFIIIWVELQYVYKSVWLEKTSFYYYYGFLLANILILSIV 604

Query: 592 XXXXXXXITYQSLCMEN-----WNWQWRSFTIGGVGCSLYIFIHSILFTKFKLG--GFTT 644
                    Y  L  +N       W W+SF +G   C+ Y+ ++S+ +  F L   GF++
Sbjct: 605 TIEIAIIGCYVMLKAKNDRYLRHTWGWKSFLMGS-SCAWYMELYSLYYIFFVLNMQGFSS 663

Query: 645 MILYIGYTLLLSILSCIVTGAVGFISSMIFVRKIY 679
           + + + Y+LL + +     G++ +++S + V +IY
Sbjct: 664 IFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY 698

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 64/153 (41%), Gaps = 22/153 (14%)

Query: 23  VAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKI 82
           V P+ Y  GD + L+VN                KVES    L    Y +  L F  P   
Sbjct: 51  VNPNLYKIGDHVELIVN----------------KVESD---LTQLPYAYYDLPFICPPTK 91

Query: 83  VKQPD--SLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQN 140
            K+P   SL  I  GDR + S + +          LC+            +L++ G+   
Sbjct: 92  EKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQQGYVTQ 151

Query: 141 WLID-GLPAARKIYDSNTHTEFYDVGFPLGFVE 172
           WLID  LPAA     S  H ++Y  GFP+G+V+
Sbjct: 152 WLIDESLPAATTFISSTNHNKYYAAGFPVGYVD 184

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score = 86.7 bits (213), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 112/497 (22%), Positives = 204/497 (41%), Gaps = 80/497 (16%)

Query: 238 YLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGNKLFLDEKKD--NE----V 291
           Y+ NH +I +  H   +G   +VG  V P S +D   P   +K +   K D  NE    +
Sbjct: 197 YINNHVMIVIRYHTIDQGKNTIVGFEVYPKSVSDHHCP-GASKDYTPYKIDPTNEDIEFI 255

Query: 292 TFSYSVNFIESETV-WATRWDKYLH------TYNPTIQWFSLVNFSIIXXXXXXXXXXXX 344
           +F+Y+V + E   V W  RW+ +++      + +    W +  N  II            
Sbjct: 256 SFTYAVYWREDFKVDWKNRWNFFINGGELKESTSNQFHWITFAN-GIIVTSCLLLIVIAI 314

Query: 345 XKALKSDFARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISS 404
            K  ++D +   +   +        W      +F        L++LV  G       + +
Sbjct: 315 LKRQETDGSITTQLAAE--------WSKARVPLF------FQLNLLVSMGIHFLFTTLGT 360

Query: 405 IFLAAIGIISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWK---ANMILTPL 461
           + ++     S +    + S++ T        GS+ S  +    +G   +    N I+   
Sbjct: 361 LIISC----SLNHTHRIGSSVLTCAVFLFISGSFTSSFIGALLEGQMSQHKLVNSIIFGS 416

Query: 462 LVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANK----- 516
            +PG  LV +L LN+ L   +++ T+P   + L+   +F++ +P+S +G   A++     
Sbjct: 417 TLPGITLVIVLLLNYILKANNAANTLPHGTVALLFGAYFIVCVPISIIGGKCADRFLKVN 476

Query: 517 ----------RSNWGEHPTKTNQIARQ--IPFQSWYLKTIPAILIA-GIFPFGAIAVELY 563
                      +   +H T+   +  +  IPF    LK   AI +  G+ PF  I VEL 
Sbjct: 477 STNTLLNSFALAEVNKHDTRPLYVESKNSIPF---VLKNPIAITLTFGLIPFALIYVELL 533

Query: 564 FIYTSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXXITYQSLCMEN------WN----- 610
           F Y SLW  K  ++Y++G                     Y  L   N      W+     
Sbjct: 534 FAYKSLWLQKTTLYYLYGFLLSNIVIVCICICLLSIIGCYIHLNYGNDSLNFKWDNVIGR 593

Query: 611 -------WQWRSFTIGGVGCSLYIFIHSILFTKF--KLGGFTTMILYIGYTLLLSILSCI 661
                  W+W++F +GG   + Y+  +SIL+  F  +   F +  L++ Y+ L +IL   
Sbjct: 594 VLEACHSWRWKAFHMGG-AVAWYMEAYSILYLIFVARYRDFISSFLFVCYSTLFNILCWT 652

Query: 662 VTGAVGFISSMIFVRKI 678
             G++ ++SS+ F+ K+
Sbjct: 653 AFGSLSYLSSLWFIGKL 669

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 64/132 (48%), Gaps = 4/132 (3%)

Query: 41  LTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHF-CKPEKIVKQ-PDSLGSILFGDRI 98
           L+P+  Y+  D +   V   E  L  F Y +  LHF C P + +K  P +   IL+G++ 
Sbjct: 57  LSPNF-YEYGDKVDITVNKVESDLTHFSYGYYDLHFTCPPSQDMKPLPLTFSDILYGNKK 115

Query: 99  YNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQNWLI-DGLPAARKIYDSNT 157
           + S + +   K E+ V+LC     G   K   +LIK  +   WL  D LP A    ++  
Sbjct: 116 WQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYELIKQNYVVQWLADDDLPGATTYLNTKD 175

Query: 158 HTEFYDVGFPLG 169
             ++Y  GFPLG
Sbjct: 176 KKKYYSSGFPLG 187

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 106/501 (21%), Positives = 208/501 (41%), Gaps = 70/501 (13%)

Query: 233 NVEFPYLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTD------SANPEKGNKLFLDEK 286
           + E  YL NH ++ +  H   + ++ +VG+ V P S +D      S N E+   +  D++
Sbjct: 172 DTETAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGASRNYEQFELVANDDE 231

Query: 287 KDNEVTFSYSVNFIES-ETVWATRWDKYLHT------YNPTIQWFSLVNFSIIXXXXXXX 339
           +   + F+YSV + E  +  W  R+  + ++           +W  L N S +       
Sbjct: 232 EVTYIPFTYSVYWREEFDVEWKDRYSFFSNSGELSKEITDKFRWILLANSSGLALFISMI 291

Query: 340 XXXXXXKALKSDFARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSM---------LLSIL 390
                 +  K +             NE+S  +   G +  I  + +          L +L
Sbjct: 292 VSVIFLRISKKNK------------NENSAIESKKGSMDVIARKWLRNDRTIHFNFLIVL 339

Query: 391 VGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGP 450
           V  G      ++ S+ ++       + R S+ + +  F+ L GF  S++   +       
Sbjct: 340 VSFGVHFAFTLLGSLAISCSLQKFDNIRNSVLTLVLLFFVLGGFMASFVGTCLIMQKNKT 399

Query: 451 YWKANMI---LTPL-------LVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWF 500
            +K ++     +PL       L+P  I++  + LN  +    SS  +P+  +L ++ I+F
Sbjct: 400 MYKGSLKRLHYSPLFAMCCGSLLPAVIMIITIFLNNIVWAHGSSRALPLKTILFLISIYF 459

Query: 501 VISLPLSFLG----SLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPAIL-------- 548
           ++ +PLS LG    S +  KR+          ++A      S   +TI +I         
Sbjct: 460 IVCIPLSLLGGSYASDICQKRTLRAFSSPAQQKLAVT---NSNLARTIKSIFDDPFSGLL 516

Query: 549 --IAGIFPFGAIAVELYFIYTSLWFNKI------FYMFGXXXXXXXXXXXXXXXXXXXIT 600
             I G+FPF  I VEL  +Y  +W  K       +++F                    + 
Sbjct: 517 ASIGGLFPFFIIYVELQHVYKFVWLEKASFYYLRWFLFANIIILCIVVVEIAIISAYIMM 576

Query: 601 YQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLG--GFTTMILYIGYTLLLSIL 658
           + S      +W+WRSF I    C+ Y+ ++S+ +  + L   GF++++L +  + L + L
Sbjct: 577 HSSRSSLENSWRWRSFQISS-SCAWYMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGL 635

Query: 659 SCIVTGAVGFISSMIFVRKIY 679
                G++G++++  FV ++Y
Sbjct: 636 CGCALGSIGYLATCWFVGRVY 656

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 69/139 (49%), Gaps = 6/139 (4%)

Query: 38  VNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKIVKQP--DSLGSILFG 95
            N LTP++ Y+K DD+   V   E  L    Y +  L F  P    ++P   SL  IL G
Sbjct: 34  ANRLTPNI-YRKGDDVELIVNKIESDLTKLPYGYYDLPFICPPTNQRKPLHMSLTEILRG 92

Query: 96  DRIYNSPFSIKMLKPENNVKLCSI-TIPGSDAKFINKLIKNGFFQNWLIDG-LPAARKIY 153
           DR + S +S+   K  +   LC+  T P    K IN L+K  +   W ID  LPA+    
Sbjct: 93  DRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAIN-LVKKDYIVQWSIDNDLPASTTFI 151

Query: 154 DSNTHTEFYDVGFPLGFVE 172
            ++ + ++Y  GF LGFV+
Sbjct: 152 STSENRKYYIPGFSLGFVD 170

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 89/381 (23%), Positives = 159/381 (41%), Gaps = 63/381 (16%)

Query: 239 LANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANP--EKGNKLFLDEKKDNEVT---F 293
           L NH ++ V         + ++G  V P S +D+  P   K  + +    +++E+T   F
Sbjct: 181 LYNHLMLVVRYQTVDVNKHTIIGFEVYPKSVSDAHCPGANKDYQPYEINTEESEITYIPF 240

Query: 294 SYSVNFIESETV-WATRWDKYLHTYNPT-------IQWFSLVNFSIIXXXXXXXXXXXXX 345
           +YS+ + E   + W+ RW+ ++H    +         W SL N +I+             
Sbjct: 241 TYSIYWREESNIDWSHRWNFFIHDDTSSHSKRQSLFHWISLANSAIVVVLMSLF------ 294

Query: 346 KALKSDFARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQ-LFLMIISS 404
             + + F + +        N+D+        V         L+++   G Q LF ++ S 
Sbjct: 295 --IATIFVKIK--------NDDTVSSSAASWVSESTQLLSCLNLVTSMGVQFLFGVVGSL 344

Query: 405 IFLAAIGIISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKG-PYWK-ANMILTPLL 462
           + L ++  +       L SA+ +F A     G+Y S  +       P       +++   
Sbjct: 345 VVLCSLNKLHNIQSWVLSSALCSFVA-----GAYSSSLLGSLLASGPRVSLGTSVISGSA 399

Query: 463 VPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGE 522
           +PG +L ++L LN  +    SS  IP   +++ V  +F+IS PLS LG   A K  N   
Sbjct: 400 LPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKN-AA 458

Query: 523 HPTKTNQIARQIPFQ-----SWYLKTIPA-----------------ILIAGIFPFGAIAV 560
                N I++  PF      S+  ++ PA                  ++AGI PF  I V
Sbjct: 459 KLAPANAISKS-PFSFLLTLSYDTRSWPATALGKPFPIALSNPILLTILAGIAPFVVICV 517

Query: 561 ELYFIYTSLWFN--KIFYMFG 579
           EL+++Y S+W      +Y++G
Sbjct: 518 ELFYVYKSMWLQTTNFYYLYG 538

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 77/165 (46%), Gaps = 22/165 (13%)

Query: 11  LVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYY 70
           +  F  ++    + P+ Y +GD++ +++N                KV S E   + + YY
Sbjct: 28  VTRFSQSYDFGWIKPNVYKKGDKVDVIIN----------------KVVS-ETARFPYGYY 70

Query: 71  FPKLHFCKPEKIVKQPD--SLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKF 128
              L F  P    K+P   SL  I+ GDR + S +++   +  + ++LC         K 
Sbjct: 71  --DLQFVCPPSDKKKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQ 128

Query: 129 INKLIKNGFFQNWLI-DGLPAARKIYDSNTHTEFYDVGFPLGFVE 172
            + LI+ G+  +WLI D LPAA     + +  +FY  GFPLG V+
Sbjct: 129 ADALIRQGYVAHWLIDDDLPAATTFAKTKSGKKFYTAGFPLGEVD 173

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 610 NWQWRSFTIGG-VGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAVGF 668
           +W+W+SF  GG V   L ++    L     L   ++++L++ YT L + +     GA+G+
Sbjct: 614 SWRWKSFVAGGSVAWYLELYSLYYLIFVLHLRDLSSILLFVCYTALFNFMCWCAFGALGY 673

Query: 669 ISSMIFVRKIYSNVR 683
           +S + F+  I S+ +
Sbjct: 674 LSCLWFLSHISSSSK 688

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 118/537 (21%), Positives = 200/537 (37%), Gaps = 113/537 (21%)

Query: 227 ISKLVHNVEFPYLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANP--EKGNKLFLD 284
           + ++ H  +  +L NH ++ +         Y +VG  V P S +D   P   K  + ++ 
Sbjct: 173 LGRVDHETDKTHLHNHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGASKSFEPYVI 232

Query: 285 EKKDNEVT---FSYSVNFIESETV-WATRWDKYLH--TYNPT-----IQWFSLVNFSIIX 333
             ++ EVT   F+YSV + E   + W+ RW+ +    +  P        W SL N +I+ 
Sbjct: 233 NTEETEVTYIPFTYSVYWREESNIDWSHRWNLFFDGGSMLPNGNVSFFYWISLANSAIVV 292

Query: 334 XXXXXXXXXXXXKALKSDFARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGS 393
                       K    DF     F            +     V+ +      L++    
Sbjct: 293 ALMTLFIALIFLKIRADDFVGTLAF------------EWASQPVYYLTQ----LNLAASM 336

Query: 394 GAQ-LFLMIISSIFLAAIGIISPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFK-GPY 451
           G Q LF +I SS    ++  +       L +A   F       G+Y S  V      GP 
Sbjct: 337 GIQFLFSIIGSSTISCSLCKVHNIRSWELSTAAICFVL-----GAYTSSLVGSLLAPGP- 390

Query: 452 WKANM---ILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSF 508
            K N+   +L    +P   LV +   N  +    SS  +P   LL ++  +FVI LPLSF
Sbjct: 391 -KMNLGTSVLCGCTLPALALVVVAVFNSVVWIKDSSAALPFGTLLALLTSYFVICLPLSF 449

Query: 509 LGSLLANKRSNWGEHPTKTNQIARQIPFQ--------------SWYLKTIPAIL------ 548
           LG   A K  +   +     Q   ++PF               +   K IPAIL      
Sbjct: 450 LGGFSARKLRSAPANGLNYEQ--SKVPFSFLLSIEYHEYNLLPAGQEKEIPAILSNPFLL 507

Query: 549 --IAGIFPFGAIAVELYFIYTSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXXITY--- 601
             + G  PF     EL F+Y SLW  K  ++ ++G                   + Y   
Sbjct: 508 TIVTGFPPFVVTCTELLFVYRSLWLQKTNLYSLYGFLLVNFIFLCITVCEVSLVVCYVLM 567

Query: 602 --------------------QSLC-------------MENWNWQWR-SFT-------IGG 620
                                S+C             M +   +W+ SF+       + G
Sbjct: 568 IYTQPGSTDRQASNEGPDIRWSICRSPMTIVKSLKNYMASTARRWKASFSSWRWKAFMAG 627

Query: 621 VGCSLYIFIHSILFTKF--KLGGFTTMILYIGYTLLLSILSCIVTGAVGFISSMIFV 675
              + Y  ++S+ +  F   L  F++++L++ YT L +++     GA+G+++ + F+
Sbjct: 628 ASVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGALGYLTCLWFL 684

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 74/157 (47%), Gaps = 22/157 (14%)

Query: 23  VAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKI 82
           + P+ Y  GD++ L VN                KVES    + +  Y +  L F  P   
Sbjct: 44  IKPNVYKRGDKVDLTVN----------------KVESE---ITNLPYGYYDLRFVCPPSE 84

Query: 83  VKQPD--SLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQN 140
            K+P   SL  ++ GDR + S ++++    ++  +LC         +  ++LI+  +  +
Sbjct: 85  TKKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVH 144

Query: 141 WLIDG-LPAARKIYDSNTHTEFYDVGFPLGFVEIKKN 176
           WLIDG LPAA     + +  +FY  GFPLG V+ + +
Sbjct: 145 WLIDGDLPAATTFASTRSGKKFYTAGFPLGRVDHETD 181

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 125/310 (40%), Gaps = 33/310 (10%)

Query: 238 YLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGNKLFLDEKKDNE------- 290
           YL  H +  V  H      + +VG+ V P S  D   P         E K  E       
Sbjct: 203 YLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPGASKDFIPLEVKVPENNDDPTY 262

Query: 291 VTFSYSVNFIES-ETVWATRWDKY------LHTYNPTIQWFSLVNFSIIXXXXXXXXXXX 343
           + FSYSV + E  +  W  RWD +      L   + +  W+SL+N + I           
Sbjct: 263 LPFSYSVYWREEFDLPWNQRWDLFKTADELLREKDLSFHWYSLINSNSITVGVITFL--- 319

Query: 344 XXKALKSDFARYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIIS 403
               L     R     L N   +     +      R P+   + +I + SG Q F ++IS
Sbjct: 320 ---CLVISMNRMRI--LYNKSWKKRQLSITTTTTTRYPN---IFTICITSGIQFFFLLIS 371

Query: 404 SIFLAAIGIISPSSRGSLPSAMFTFYALFG-----FWGSYISMS-VYKFFKGPYWKANMI 457
           S+ +          + ++  A+F  +  FG     F G+ I  + +   F   Y+  N I
Sbjct: 372 SVLITFQISKFHQIKDTIIVALF--FIAFGIIVSVFIGTLIQRTFILTNFPDKYYLTNPI 429

Query: 458 LTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKR 517
           L    +P FIL+S+  +N  +     +   P    +     +F++S+PLS +  +L+ + 
Sbjct: 430 LFGSTLPAFILLSMFIINSIIYLSEKNHAFPFKLSMYFFTSYFILSIPLSIISGVLSTRF 489

Query: 518 SNWGEHPTKT 527
            ++ ++P+++
Sbjct: 490 ISFPKYPSRS 499

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 62/153 (40%), Gaps = 19/153 (12%)

Query: 23  VAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKI 82
           + P+ Y  GD++ +  N   P       DD      S+  + Y +D     L F  P   
Sbjct: 60  IKPNLYKVGDKVQITTNKALP-------DD---PAVSQPALCY-YD-----LPFVCPPSD 103

Query: 83  VKQP--DSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQN 140
            K+P  +SL  +  GD +  S + ++  K E    LCS        +    LIKN +   
Sbjct: 104 TKRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIVQ 163

Query: 141 WLIDG-LPAARKIYDSNTHTEFYDVGFPLGFVE 172
           W +D  LP       +  + + Y  GF LG+ +
Sbjct: 164 WYVDNDLPVGTTYISNKVNKKQYLPGFSLGYFD 196

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 102/501 (20%), Positives = 190/501 (37%), Gaps = 67/501 (13%)

Query: 238 YLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANPEKGN-----KLFLDEKKDNE-- 290
           YL NH ++ +  +   +  + +VG  V   S +D   P         +L + E  D+   
Sbjct: 189 YLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCPGASKNYEEYELVIPENDDDLTF 248

Query: 291 VTFSYSVNFIES-ETVWATRW---DKYLHTYNPTIQWFSLVNFSIIXXXXXXXXXXXXXK 346
           + F+YSV + E  +  W +RW   D  +   +P      L+N S++              
Sbjct: 249 IPFTYSVYWREEFDIDWTSRWNLFDNDIEEEDP-----KLINKSMLSNIMQPTRTGLFLL 303

Query: 347 AL---KSDFARYEEFNLDNSFNEDSG-----WKLGHGDVFRIPSQSMLLSILVGSGAQLF 398
            L        +  E    N F  ++      W   +    +    + +L++++  G Q  
Sbjct: 304 PLIIFSIIIVKVVENGEKNKFTTEAQLASKCWIESNNINLKSSFSASILTLVISMGVQSI 363

Query: 399 LMIISSIFLA-AIGIISPSSRGSLPSAMFTFYA---LFGFWGSYISMSVYKFFKGPYWKA 454
             +I  I L  +I  +   S   L +    F        F G+++ M++       Y   
Sbjct: 364 FSLIGIIILKLSIYKLHDISNIVLLNIFIWFIEGILASSFLGTWLRMNILNKKSINYNPK 423

Query: 455 NMILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLA 514
             IL   L+P  +++ +  ++  +  + SS   P   L +++  +++I +P S +G  LA
Sbjct: 424 FSILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTLTMMISFFYIICVPFSIIGGGLA 483

Query: 515 NK-RSNWGEH------PTKTNQIARQIPFQSWY---------LKTIPAILIAGIFPFGAI 558
            K R ++ E         + N    +  F++ +         L T+   LI  I PF  I
Sbjct: 484 KKYRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSINKNKLGTLVYSLITAIVPFFII 543

Query: 559 AVELYFIYTSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXX-------ITYQSLCMENW-- 609
             ELY+I+T+ W N   ++                            I      +  W  
Sbjct: 544 KSELYWIFTNKWLNYTTFIKSFIFLIIKLFIIIITVSSTSLVGLFVNIMMTKKGISQWRD 603

Query: 610 ---NWQWRSFTIGGVGC------SLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSC 660
              + +W  F      C      SLY  I  I     ++ GF+  +L I YT+ L+++  
Sbjct: 604 DPISLRWSCFLNSFNICYLTGLYSLYYIIEVI-----RIHGFSMTVLTIFYTIALNVILG 658

Query: 661 IVTGAVGFISSMIFVRKIYSN 681
           I  GA+ +++    + K+Y N
Sbjct: 659 ISCGAIAYMTCYWLIIKLYKN 679

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 60/157 (38%), Gaps = 20/157 (12%)

Query: 23  VAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKI 82
           + P+ Y  GD + LLVN    +LN   K                  Y +  L F  P   
Sbjct: 47  LQPNVYKVGDNVDLLVNKAISTLNADLK-----------------PYIYHDLPFVCPPTS 89

Query: 83  VKQPDSL--GSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQN 140
           V++P  L   S+  GD +  S + +K         LC+     +       +IK  +   
Sbjct: 90  VRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQIL 149

Query: 141 WLIDG-LPAARKIYDSNTHTEFYDVGFPLGFVEIKKN 176
           W ID  LP +     + T  + Y  GFPLG  +  KN
Sbjct: 150 WSIDDELPISMPYISTITQRKKYIPGFPLGRFDKDKN 186

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 110/529 (20%), Positives = 199/529 (37%), Gaps = 118/529 (22%)

Query: 233 NVEFPYLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANP--EKGNKLFLDEKKDNE 290
             +  YL NH+++ +  +      Y +VG  V P S +D   P   K  + +     + +
Sbjct: 175 ETDVTYLHNHFMLVIRYNAVDINKYTIVGFEVYPKSVSDDHCPGSSKDYENYAVNPSEKD 234

Query: 291 VTF---SYSVNFIESETV-WATRWDKYLHTYNPTIQ---------------WFSLVNFSI 331
           V F   +YSV + E   V W  RW+ YL   +  +                  +L++ +I
Sbjct: 235 VVFIPITYSVYWREEFMVDWENRWNFYLSAGDLDVNKSLCFRGIKVTMVFIILTLMSLAI 294

Query: 332 IXXXXXXXXXXXXXKALKSDFARYEEFNL--DNSFNEDSGWKLGHGDVFRIPSQSMLLSI 389
           I              A+ S++ R     L   N+F       +G   +F  P+ ++LL  
Sbjct: 295 IVSRLGLGTGSMFITAVASEWVRRGAPCLLFLNTFVS-----MGIQVIFAAPA-TLLLIC 348

Query: 390 LVGSGAQL--FLMIISS------IFLAAIGIISPSSRGSLPSAMFTFYALFGFWGSYISM 441
            +G    +  FL+ I++      IF++A G I  S       A    Y++   +GS +  
Sbjct: 349 SMGKLHNISNFLVCIAALCYMTGIFMSAFGGILLSGNLLDNKAQIRKYSV--LYGSAL-- 404

Query: 442 SVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFV 501
                                 P   +  ++  N     +     +P   + L++ ++F+
Sbjct: 405 ----------------------PALTVAVLVLANSIAWIIERGKEMPFRDITLLLALYFM 442

Query: 502 ISLPLSFLGSL---------------LANKRSNWGEHPTK-------------TNQIA-R 532
           +SLPLS LG                 L+ K +     P+K             T   A  
Sbjct: 443 VSLPLSLLGGTSASYKLKDQHFQLYSLSTKYTGTPVSPSKPTFWFNFEYDTRGTPACAHE 502

Query: 533 QIPFQSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFN--KIFYMFGXXXXXXXXXXX 590
           QIP   W  K      I GI PF AI +++ FI+  LW +   +F ++            
Sbjct: 503 QIPM--WLSKPFLITSIIGIIPFLAIYLQMEFIWKPLWTHSKSLFQIYVSLIIGMILQSI 560

Query: 591 XXXXXXXXITY--------QSLCMENW-----------NWQWRSFTIGGVGCSLYIFIHS 631
                   I Y           C ++            +W+W++F +GG   + Y   +S
Sbjct: 561 LVMEICILIMYVHMHHGDDSECCFDDTCVTGRISNAVSSWRWKAFYMGGAA-AWYWEAYS 619

Query: 632 ILFTKF--KLGGFTTMILYIGYTLLLSILSCIVTGAVGFISSMIFVRKI 678
           + +  F  +L  F +++LY+ Y  LL++      G++G+++   F+ K+
Sbjct: 620 LYYMIFILRLRNFGSILLYLSYGTLLNVFYFYSFGSIGYLACCWFLNKL 668

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 68/158 (43%), Gaps = 22/158 (13%)

Query: 23  VAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHF-CKPEK 81
           V P  Y +G+E+ +L+N +           +GK  E       S+ YY   L F C P K
Sbjct: 40  VRPRIYQDGEEVEMLLNQV-----------VGKPGE------LSYGYY--DLQFTCTPTK 80

Query: 82  IVKQ-PDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQN 140
             +    SL  +  GDR + S + +   +      LC      S     + LI+  +   
Sbjct: 81  SRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIEADSLIRQNYTVQ 140

Query: 141 WLIDGLPAARKIYDS-NTHTEFYDVGFPLGFVEIKKNV 177
            LID +  A K Y S   +  +Y  GFPLGFV+ + +V
Sbjct: 141 LLIDEIMPASKTYVSMRDNKRYYVPGFPLGFVDPETDV 178

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 66/152 (43%), Gaps = 13/152 (8%)

Query: 23  VAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKI 82
           V P+TY  GD + ++VN +      Q+KD LG   +S E + Y    Y    + C P   
Sbjct: 46  VHPNTYTFGDPVEVIVNKMV-----QEKDMLG---DSNEGVSYK---YHDLPYICPPTNT 94

Query: 83  VKQ-PDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQNW 141
            K   +SL  +  GD    S + +K     +   LC      +  +   ++I   +  NW
Sbjct: 95  KKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVNW 154

Query: 142 LIDG-LPAARKIYDSNTHTEFYDVGFPLGFVE 172
            ID  LPAA     S T  + Y  GF LG+ +
Sbjct: 155 FIDDYLPAATTYISSVTRKKKYFEGFSLGWKD 186

 Score = 38.9 bits (89), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 65/139 (46%), Gaps = 5/139 (3%)

Query: 383 QSMLLSILVGSGAQLFLMIISSIFLAA----IGIISPSSRGSLPSAMFTFYALFGFWGSY 438
           +++LL+ILV  G Q   + +  I + +    +  IS      +   +     +  F G++
Sbjct: 355 KNILLNILVSMGCQALFIFMPVIVIQSSLWSLHNISNYVMLQIICWISASLLVGSFVGTW 414

Query: 439 ISMSVYKFFKGPYWKANM-ILTPLLVPGFILVSILGLNFFLLFVHSSGTIPMTALLLIVV 497
           + M +++    P +   M I+   ++PG  L  +   N    F+  + + P   L  ++ 
Sbjct: 415 LRMYMFQKKMTPNYDPKMSIVCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFRKLSWLIF 474

Query: 498 IWFVISLPLSFLGSLLANK 516
           ++F+ S+P+S +G  LA K
Sbjct: 475 VYFIFSIPMSLIGGSLAVK 493

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 8/86 (9%)

Query: 238 YLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDSANP--EKGNKLF-LDEKKDNE---- 290
           Y+ NH ++ +  +   +  + +VG  V P S  D   P   +G+  + L + ++N+    
Sbjct: 193 YINNHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQCPGARRGHGHYELKDLENNDEFSL 252

Query: 291 VTFSYSVNFIES-ETVWATRWDKYLH 315
           + FSYSV + E  E  W TRW  ++ 
Sbjct: 253 IPFSYSVYWREEFEYDWRTRWSLFVR 278

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 62/151 (41%), Gaps = 22/151 (14%)

Query: 25  PSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLHFCKPEKIVK 84
           PS Y  G+ + LLV+++     +  ++  G               Y+  L  C P    +
Sbjct: 39  PSAYTRGERVQLLVDNI-----WTDREVWG---------------YYETLFTCPPPAEAR 78

Query: 85  QP-DSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNGFFQNWLI 143
               SLG +   +  + S + + +        LC   +     + + ++I++G    W +
Sbjct: 79  AIYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWTL 138

Query: 144 DGLPAARKIYDSNTHTEFYDVGFPLGFVEIK 174
           DGLPAA   Y     +  Y+ GF LG V+ +
Sbjct: 139 DGLPAA-TTYPDRQSSYRYEAGFKLGEVDAE 168

>TPHA0H01360 Chr8 (305160..307220) [2061 bp, 686 aa] {ON} Anc_5.670
           YKR078W
          Length = 686

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 94  FGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKNG-FFQNWLIDGLPAARKI 152
           F D   N    I +L PE+N  L  +   G + K +N+ IKNG  FQN LI  +      
Sbjct: 87  FSDNTNNRHL-IDVLAPEDNNLLSGLQDEGKN-KDVNEAIKNGALFQNALISPIKVDESE 144

Query: 153 YDSNTHTE 160
           ++ N+H E
Sbjct: 145 FEGNSHKE 152

>KLLA0E12937g Chr5 (1145337..1145960) [624 bp, 207 aa] {ON} no
           similarity
          Length = 207

 Score = 33.5 bits (75), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 28/45 (62%)

Query: 465 GFILVSILGLNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFL 509
           G ++  + G +FFLL  HS  TI +  L+L + + FV+ L LS++
Sbjct: 32  GHLMARLWGSSFFLLRKHSRNTILIGRLILFIPLKFVMGLSLSWI 76

>KAFR0I01030 Chr9 (200672..201232) [561 bp, 186 aa] {ON} Anc_4.111
           YBL006C
          Length = 186

 Score = 31.6 bits (70), Expect = 5.0,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 49/116 (42%), Gaps = 13/116 (11%)

Query: 53  LGKKVESREKMLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPEN 112
           LG KV+  E    ++D     L    P+K   Q +SL SI F    + S      L  E+
Sbjct: 66  LGGKVDLTEASNANYDLSHTLLGGYVPKK---QLESLSSIDFAHYFHKS------LDCED 116

Query: 113 NVKLCSITIPGSDAKFINKL----IKNGFFQNWLIDGLPAARKIYDSNTHTEFYDV 164
            +K+  + I   +   INK+    + NG       DG P  + +     H++FY +
Sbjct: 117 ALKIYDLFISSYNGNRINKMGSTGLANGSLSRLSTDGKPLRKVLVCKKCHSKFYGI 172

>TPHA0L00460 Chr12 (75852..79157) [3306 bp, 1101 aa] {ON} Anc_7.81
           YOL051W
          Length = 1101

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 30  EGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLH-FCKPEKIVKQ 85
           E   +PL ++ LT +L+ Q+KD++ +K++  +++      Y P+++   K E  +K+
Sbjct: 455 EAARIPLRLSDLTNTLSPQEKDEIKRKLQLNQQLFAQVSNYAPQVYILTKSENFLKE 511

>Kpol_233.2 s233 (3798..7295) [3498 bp, 1165 aa] {ON} (3798..7295)
           [3498 nt, 1166 aa]
          Length = 1165

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 30  EGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLH-FCKPEKIVKQ 85
           E   +PL ++ LT +L+ Q+++++ +K++  +++      Y P+++ F K E  +K+
Sbjct: 547 EAARIPLRLSDLTNTLSVQEREEIKRKLQLNQQLFAQVSNYAPQVYIFTKSENFLKE 603

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.142    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,854,824
Number of extensions: 2949322
Number of successful extensions: 9372
Number of sequences better than 10.0: 61
Number of HSP's gapped: 9423
Number of HSP's successfully gapped: 118
Length of query: 685
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 569
Effective length of database: 40,180,143
Effective search space: 22862501367
Effective search space used: 22862501367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)