Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0A018308.258ON42142122610.0
Kpol_543.368.258ON42742915170.0
KAFR0B027008.258ON42042214420.0
ZYRO0C01738g8.258ON41442214350.0
TDEL0F038508.258ON41942314100.0
NCAS0B049908.258ON42042414060.0
TBLA0H014608.258ON44244614060.0
Smik_12.1448.258ON43844013960.0
KLTH0G13772g8.258ON42042413940.0
Skud_12.1538.258ON43844013960.0
NDAI0B019608.258ON43944213870.0
Suva_10.1698.258ON43844013760.0
Kwal_56.238328.258ON41942313730.0
CAGL0L12166g8.258ON42142713730.0
YLR085C (ARP6)8.258ON43844213690.0
KNAG0G020108.258ON42442513290.0
SAKL0H17138g8.258ON41942413240.0
AGR091W8.258ON41041913091e-180
Ecym_43128.258ON41142513061e-179
KLLA0F19063g8.258ON41542413001e-178
NCAS0C037008.23ON3754212472e-22
TBLA0C004408.23ON3754212472e-22
TPHA0D002508.23ON3754212463e-22
TDEL0C004708.23ON3754212453e-22
CAGL0K12694g8.23ON3754212453e-22
Suva_6.188.23ON3754212453e-22
Smik_6.398.23ON3754212453e-22
YFL039C (ACT1)8.23ON3754212453e-22
KNAG0L002508.23ON3754212454e-22
KAFR0D009408.23ON3754212454e-22
NDAI0G030408.23ON3754212445e-22
SAKL0B00968g8.23ON3754212445e-22
ZYRO0F02772g8.23ON3754212445e-22
Ecym_15208.23ON3764222446e-22
ABR222W8.23ON3764212436e-22
KLTH0G18832g8.23ON3754212411e-21
Kpol_1058.158.23ON3754212411e-21
KLLA0D05357g8.23ON3754212383e-21
KLLA0E22925g2.117ON3804112271e-19
NDAI0G029003.161ON3913682209e-19
Skud_6.318.23ON3603742181e-18
NCAS0B071302.117ON3814202172e-18
SAKL0E11814g2.117ON3793672162e-18
NCAS0C035503.161ON3923682163e-18
Kwal_14.11098.23ON3603742143e-18
Ecym_63852.117ON3773672137e-18
AFR051W2.117ON4053732137e-18
KLTH0F06490g3.161ON3913692137e-18
Suva_4.2203.161ON3913672092e-17
ZYRO0B04928g3.161ON3913682073e-17
KNAG0K01130na 1ON3933702065e-17
Skud_4.2223.161ON3913672031e-16
Smik_4.2063.161ON3913672031e-16
YDL029W (ARP2)3.161ON3913672031e-16
ZYRO0G05676g2.117ON3813732022e-16
TBLA0F008703.161ON3913682022e-16
NDAI0B044602.117ON3813662022e-16
SAKL0C07370g3.161ON3913672012e-16
ADR316W3.161ON3913691986e-16
KLLA0C03850g3.161ON3913671977e-16
Kpol_1023.188.23ON3193321957e-16
Ecym_52373.161ON3913681978e-16
Kwal_33.141773.161ON3373081951e-15
TDEL0D046103.161ON3913671961e-15
CAGL0K01595g3.161ON3913671951e-15
TPHA0I013002.117ON3793621914e-15
KLTH0B05940g2.117ON3833711906e-15
KAFR0C01040na 1ON3373081886e-15
Kpol_479.253.161ON3913681897e-15
Suva_15.3262.117ON3843651817e-14
SAKL0D12804g1.514ON4564261829e-14
Smik_8.2102.117ON3843621791e-13
TDEL0F004701.514ON4613791801e-13
CAGL0F00517g1.514ON4543881792e-13
TPHA0A009203.161ON3913681782e-13
Skud_8.1902.117ON3843781782e-13
KNAG0H036502.117ON3873671773e-13
KAFR0F005902.117ON3863681773e-13
KAFR0D037001.514ON4493651756e-13
NCAS0A122701.514ON4544241721e-12
ZYRO0G01936g1.514ON4613331721e-12
TBLA0B010702.117ON3833691711e-12
AFR419C1.514ON4553321721e-12
KNAG0B001701.514ON4533281722e-12
YHR129C (ARP1)2.117ON3843651702e-12
Suva_12.1541.514ON4493311693e-12
KLLA0B13904g1.514ON4563921693e-12
TBLA0D036801.514ON4583681685e-12
Kwal_33.146422.117ON3833741675e-12
Smik_10.3551.514ON4493311667e-12
Skud_10.2891.514ON4493341667e-12
CAGL0H09042g2.117ON3873741659e-12
KLTH0C02508g1.514ON4513601651e-11
NDAI0A039701.514ON4623731641e-11
Ecym_31531.514ON4583941641e-11
Kwal_27.99581.514ON4453281642e-11
KNAG0I018602.248ON7531571642e-11
YJR065C (ARP3)1.514ON4493311632e-11
YNL059C (ARP5)2.248ON7551571623e-11
TDEL0B048102.117ON3733651594e-11
Suva_14.2812.248ON7551591614e-11
Skud_14.2722.248ON7551681615e-11
SAKL0E08602g2.248ON7471611607e-11
Kpol_1056.161.514ON4604001571e-10
TPHA0O010401.514ON4583991542e-10
TDEL0C041402.248ON7491621552e-10
NDAI0D010602.248ON7531591553e-10
TBLA0E038602.248ON7592621535e-10
Smik_14.2672.248ON7551571491e-09
TPHA0C031602.248ON7551301438e-09
Smik_10.1611.287ON4892171401e-08
Ecym_32852.248ON7461581411e-08
Kpol_1003.162.248ON7492211402e-08
ZYRO0A01584g2.248ON7481451392e-08
KLTH0G09482g2.248ON7452601374e-08
ADL253C2.248ON7511581365e-08
KLLA0F03421g2.248ON7472201365e-08
Kwal_23.48482.248ON7451351312e-07
YJL081C (ARP4)1.287ON4892171302e-07
CAGL0J10054g2.248ON7541591303e-07
KAFR0J011602.248ON7511571285e-07
Ecym_63301.287ON4803421276e-07
Suva_6.1541.287ON4892161268e-07
NDAI0G055801.287ON5152241259e-07
Kwal_14.23771.287ON4812191231e-06
KLTH0H09702g1.287ON4813371222e-06
NCAS0G030502.248ON7432361205e-06
Skud_10.1321.287ON4882211187e-06
CAGL0M03201g1.287ON4932291151e-05
Kpol_282.41.287ON5012321142e-05
KNAG0B019201.287ON5052381133e-05
AFR105C1.287ON4792181123e-05
KAFR0A015601.287ON4852181115e-05
KLLA0D02288g1.287ON5203131097e-05
TBLA0D053601.287ON5961681026e-04
NCAS0B060601.287ON4972221000.001
KLTH0C05324g7.448ON399214980.002
TPHA0I010301.287ON503238970.003
TDEL0D015501.287ON480216960.003
SAKL0D05874g1.287ON497117940.005
Kpol_520.117.448ON488271940.006
Kwal_27.105527.448ON351212900.012
SAKL0F13772g7.448ON422285890.021
ZYRO0G21428g1.287ON483107880.026
TDEL0C031207.448ON438319731.6
TPHA0D044807.310ON134088741.7
YDR416W (SYF1)5.519ON85957722.9
Smik_4.6875.519ON84857695.7
Smik_16.2787.448ON476264687.0
TBLA0H035308.523ON444112687.0
CAGL0K05335g7.448ON52987687.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0A01830
         (421 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   875   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   588   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   560   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   557   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   547   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   546   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   546   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   542   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   541   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   542   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   538   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   534   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   533   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   533   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   531   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   516   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   514   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   508   e-180
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   507   e-179
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   505   e-178
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   100   2e-22
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   100   2e-22
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...    99   3e-22
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...    99   3e-22
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...    99   3e-22
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...    99   3e-22
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...    99   3e-22
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...    99   3e-22
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...    99   4e-22
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...    99   4e-22
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...    99   5e-22
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...    99   5e-22
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...    99   5e-22
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    99   6e-22
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...    98   6e-22
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...    97   1e-21
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...    97   1e-21
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...    96   3e-21
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    92   1e-19
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    89   9e-19
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    89   1e-18
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    88   2e-18
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    88   2e-18
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    88   3e-18
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    87   3e-18
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    87   7e-18
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    87   7e-18
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    87   7e-18
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    85   2e-17
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    84   3e-17
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    84   5e-17
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    83   1e-16
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    83   1e-16
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    83   1e-16
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    82   2e-16
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    82   2e-16
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    82   2e-16
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    82   2e-16
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    81   6e-16
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    80   7e-16
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    80   7e-16
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    80   8e-16
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    80   1e-15
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    80   1e-15
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    80   1e-15
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    78   4e-15
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    78   6e-15
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    77   6e-15
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    77   7e-15
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    74   7e-14
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    75   9e-14
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    74   1e-13
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    74   1e-13
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    74   2e-13
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    73   2e-13
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    73   2e-13
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    73   3e-13
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    73   3e-13
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    72   6e-13
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    71   1e-12
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    71   1e-12
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    70   1e-12
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    71   1e-12
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    71   2e-12
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    70   2e-12
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    70   3e-12
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    70   3e-12
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    69   5e-12
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    69   5e-12
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    69   7e-12
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    69   7e-12
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    68   9e-12
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    68   1e-11
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     68   1e-11
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    68   1e-11
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    68   2e-11
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    68   2e-11
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    67   2e-11
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    67   3e-11
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    66   4e-11
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    67   4e-11
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    67   5e-11
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    66   7e-11
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    65   1e-10
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    64   2e-10
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    64   2e-10
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    64   3e-10
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    64   5e-10
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    62   1e-09
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    60   8e-09
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    59   1e-08
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    59   1e-08
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    59   2e-08
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    58   2e-08
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    57   4e-08
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    57   5e-08
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    57   5e-08
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    55   2e-07
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    55   2e-07
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    55   3e-07
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    54   5e-07
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    54   6e-07
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    53   8e-07
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    53   9e-07
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    52   1e-06
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    52   2e-06
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    51   5e-06
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    50   7e-06
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    49   1e-05
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    49   2e-05
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    48   3e-05
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    48   3e-05
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    47   5e-05
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    47   7e-05
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    44   6e-04
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    43   0.001
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    42   0.002
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    42   0.003
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    42   0.003
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    41   0.005
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    41   0.006
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    39   0.012
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    39   0.021
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    39   0.026
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    33   1.6  
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    33   1.7  
YDR416W Chr4 (1298432..1301011) [2580 bp, 859 aa] {ON}  SYF1Memb...    32   2.9  
Smik_4.687 Chr4 (1219205..1221751) [2547 bp, 848 aa] {ON} YDR416...    31   5.7  
Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034...    31   7.0  
TBLA0H03530 Chr8 complement(861391..862725) [1335 bp, 444 aa] {O...    31   7.0  
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    31   7.1  

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  875 bits (2261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/421 (100%), Positives = 421/421 (100%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNCS 180
           EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNCS
Sbjct: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNCS 180

Query: 181 WIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFISPV 240
           WIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFISPV
Sbjct: 181 WIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFISPV 240

Query: 241 SYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEGFFH 300
           SYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEGFFH
Sbjct: 241 SYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEGFFH 300

Query: 301 PEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQT 360
           PEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQT
Sbjct: 301 PEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQT 360

Query: 361 EWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQNW 420
           EWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQNW
Sbjct: 361 EWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQNW 420

Query: 421 L 421
           L
Sbjct: 421 L 421

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/429 (64%), Positives = 346/429 (80%), Gaps = 10/429 (2%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M + P++IDNGSYE+KFGYS+ + P  ALNALAKDKY  +YLSNQ+NNIKDISSV+I+RP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           H+LGQLVSWELE  +WDYCF+N D+F  F + E   +HLV++ET MTLPELS N DQV+F
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYL--------DGSKENNYQDFNLV 172
           EEY F+SL+K+P A F+PF+   DN  + + GK    +          + +N Y DFNLV
Sbjct: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKM-ICGKGDDVMGDLISNMDSQNIKNPYSDFNLV 179

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKE 232
           IDSG+NC+WIIP+IKGVPYYKAVKKM+MGGRFLNGL KETISYRHYDVTDE++LVNNIKE
Sbjct: 180 IDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKE 239

Query: 233 NCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELF 292
            C+F+SP SY++SFK K    V+YVLPDFQTSF+GYV+D K +S LPE+SQ I L DELF
Sbjct: 240 KCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELF 299

Query: 293 SVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYT 352
           SVPE  FHPEMA +LKPGI+ETILESL I+PE++R L+VNNIVC GGNFN+PNFGSR+ T
Sbjct: 300 SVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLAT 359

Query: 353 ELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTK 412
           ELQ+Q+ T+WVC++ IP+ + ELQ WK+M  F +N  ++YK  R++++EY EHG +WTTK
Sbjct: 360 ELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNT-DIYKKARISREEYYEHGTDWTTK 418

Query: 413 QRFGYQNWL 421
           +RFGYQNW+
Sbjct: 419 KRFGYQNWI 427

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/422 (59%), Positives = 328/422 (77%), Gaps = 3/422 (0%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M E P++IDNGSY +KFG ++ E P+ ALNA+A DKY+  YLSNQI +IKDISSVSIKRP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           H LGQL SWE++  IWDYC YN D+F GF + +    HL+ +ET MTLPEL +N DQV+F
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNCS 180
           EEY F SL K+P A ++PF++N  +  I     ++ +++      Y+DF LV+DSG+NC+
Sbjct: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNCT 180

Query: 181 WIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFISPV 240
           WIIP+IKG+PYYKAVKK+D+GGRFLNGLLKET+S+RHY+V DE++LVNNIKE C+F+SP 
Sbjct: 181 WIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVSPA 240

Query: 241 SYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHST-LPEHSQSIILEDELFSVPEGFF 299
           SY +SFK K +T  EYVLPDFQTSF+GYVR   +    LPE SQSI L+DELF+VPE FF
Sbjct: 241 SYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETFF 300

Query: 300 HPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQ 359
           HPE++ +LKPG++ETILESL ++PE +R LMV+NI+C GGNFN+P+F SR+  ELQ+Q+ 
Sbjct: 301 HPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLP 360

Query: 360 TEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQN 419
           T+W C ++I K N+EL  WKAM SF     ++YK TRVT++EY EHG +W TK RFGYQN
Sbjct: 361 TDWKCRITISKGNSELSGWKAMSSFAST--DIYKATRVTREEYYEHGIDWCTKHRFGYQN 418

Query: 420 WL 421
           W+
Sbjct: 419 WV 420

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/422 (62%), Positives = 325/422 (77%), Gaps = 9/422 (2%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M   P+++DNGSYEIKFG  + ETP  A NALA+DK+ +YYLSNQI  IKDISSV  +RP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           H+ GQL SWELE  IWDYCF+N D+F GF++ +    HLV++ET MT+PELS+N DQVVF
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKE-NNYQDFNLVIDSGYNC 179
           EEY F S++K+P A F PF +      I +SGK     +   E + Y+ F LVID G+NC
Sbjct: 121 EEYEFASMFKSPIAGFAPFGRPS----IAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNC 176

Query: 180 SWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFISP 239
           +W++P+IKG+PYYKAVKK+D+GGRFLNGLLKET+S+RHY+V DE++LVNNIKENC+F+SP
Sbjct: 177 TWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSP 236

Query: 240 VSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEGFF 299
           VSY ESFK K  T VEYVLPDFQTSF+GYV+D KK   LP+ SQ++ L+DELFSVPE FF
Sbjct: 237 VSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKK--PLPQDSQTVELKDELFSVPETFF 294

Query: 300 HPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQ 359
           HPE+  +LKPGIIETILESL ILPE LR LM+ NIVCTGGNFN+PNF +R+ TELQ+Q+ 
Sbjct: 295 HPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLP 354

Query: 360 TEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQN 419
           T+W C V +P    EL  W +M SFT  N  LY   RVT++EY EHG +W T+ RFGYQN
Sbjct: 355 TDWTCTVHLPSGPKELYGWSSMASFT--NSPLYSDARVTREEYFEHGVDWCTRHRFGYQN 412

Query: 420 WL 421
           W+
Sbjct: 413 WM 414

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 329/423 (77%), Gaps = 6/423 (1%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M   PL++DNGSYE+KFGYS    PF ALNALA+DK+   YLSNQIN IKDISSVS KRP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           H+ GQL SWEL+  +WDYCF+N ++F GF++ +    HL+ +ET MTLPELS+N DQVVF
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYGFDSLYKAPAANFIPFIKNDDNS-FIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNC 179
           EEY FDSL KAP + F+PF K+ +N+  I   G S++    S+  +Y+ F +VIDSG+NC
Sbjct: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTSTSETKDYEPFQMVIDSGFNC 180

Query: 180 SWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFISP 239
           +W++P+IKGVP+YKAVKK+D+GGRF+NGLLKET+S+RHY+V DE++LVNNIKE C+F+SP
Sbjct: 181 TWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSP 240

Query: 240 VSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEGFF 299
           VSY +SF KK  T VEYVLPDFQT+F+GYV D K   +  + +Q++ L DELFSVPE FF
Sbjct: 241 VSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPS--KDAQTVTLRDELFSVPETFF 298

Query: 300 HPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQ 359
           HPE+A +LKPGIIETILESL ++PE LR LMV+NI+CTGGNFN+P+F  R+ TELQ+Q+ 
Sbjct: 299 HPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLP 358

Query: 360 TEWVCDVSIPKA-NAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQ 418
           T+W   + +P+  + EL  W +M +F   +  LYK  RV++QEY EHG EWTTK RFGYQ
Sbjct: 359 TDWSAKIYLPQPKSCELAGWCSMSAFASTD--LYKAARVSRQEYYEHGVEWTTKNRFGYQ 416

Query: 419 NWL 421
           NW+
Sbjct: 417 NWI 419

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/424 (60%), Positives = 324/424 (76%), Gaps = 7/424 (1%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M  +P+ IDNGSYEIKFG ++  +P+ A+NA A DKY T YLSNQI NIKDI+SV+ +RP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           H+LGQL SWELE  IWDY  +N D+F GF++N+    HL+ +ET MTLPELS+N DQVVF
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDG---SKENNYQDFNLVIDSGY 177
           EEY FDS YK+  A FI F  + +   I    +    LD     +E  Y D+ LVIDSG+
Sbjct: 121 EEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSGF 180

Query: 178 NCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFI 237
           NC+WIIP+IKGVPYYKAVKK+D+GGRFL+GLLKET+S+RHYDV DE++LVNNIKENC+F+
Sbjct: 181 NCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLFV 240

Query: 238 SPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEG 297
           SP SY +SFK K  T VEYVLP+FQT+F+G+VRD  K   LPE++Q+I L DELFSVPE 
Sbjct: 241 SPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRD--KTKPLPENTQTIKLYDELFSVPET 298

Query: 298 FFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQ 357
           FFHPE+A +LKPG++ETILESL ++PE LR L+V N+VCTGGNFN+P+F +R+ +ELQ+Q
Sbjct: 299 FFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQ 358

Query: 358 VQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGY 417
           + T+W+C  S+P    EL  WKAM  F     E Y+ TRVT++EY EHG +W TK RFGY
Sbjct: 359 LPTDWICRTSVPTKECELFGWKAMAQFAST--ESYRKTRVTREEYYEHGTDWLTKNRFGY 416

Query: 418 QNWL 421
           QNW+
Sbjct: 417 QNWI 420

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/446 (57%), Positives = 332/446 (74%), Gaps = 29/446 (6%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M + P++IDNGSYEIKFG SN   PF A+NA+AKDKY T YLSNQI  IKDISSV+ +RP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           ++LGQL SWELE  IWDYCFYN ++F GF++ + S+ HLV++ET ++LPE SRN D ++F
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKS--------------------KTYLDG 160
           EEY + S+YK+P A FIPF  +     I +SGK+                     TY+  
Sbjct: 121 EEYNYGSIYKSPVAGFIPF-ADLTKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYISS 179

Query: 161 -----SKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISY 215
                +K   Y+DF L+IDSG+NC+WIIP+IKG+PYYKA+KKMD+GGRFL GLLKET+S+
Sbjct: 180 EEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSF 239

Query: 216 RHYDVTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKH 275
           RHY+VTDE++LVNNIKE C+F++P SY ESFK K  T VEYVLPDF T+FMGY++D  K 
Sbjct: 240 RHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSK- 298

Query: 276 STLPEHSQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIV 335
           + LP+++Q I L+DELFSV E  FHPE++ +LKPGIIETI+ESL +LPE +R LMVNNIV
Sbjct: 299 TKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIV 358

Query: 336 CTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHT 395
           C GGNFN+PNF  R+ +ELQ+Q+ T+W   V IPK +AEL  WKAM  F++ +   Y+  
Sbjct: 359 CIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDS--YRKA 416

Query: 396 RVTKQEYNEHGFEWTTKQRFGYQNWL 421
           R+T++EY EHG EW TK RFGYQNW+
Sbjct: 417 RITREEYMEHGVEWCTKHRFGYQNWI 442

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/440 (58%), Positives = 329/440 (74%), Gaps = 21/440 (4%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M  AP++IDNGSYEIKFG S  E PF ALNALAKDK+ T YLSN I NIKDISSV+ +RP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           H+LGQL  WELE  IWDYCF+N  +F GF++ E   +HLV +E+ MTLPELS++ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGK-----------------SKTYLDGSK- 162
           EEY FDSL+K+P A F+PF K+  +    +SGK                 S    D  K 
Sbjct: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180

Query: 163 ENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTD 222
           +++Y DF LVIDSG+NC+WIIP++KG+PYYKAVKK+D+GGRFL GLLKET+S+RHY++ D
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240

Query: 223 ESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKK-HSTLPEH 281
           E++LVNNIKE C+F+SPVSY +SFK K    +EYVLPDFQTSF+GYVR+ +K +S L E 
Sbjct: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300

Query: 282 SQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNF 341
           +Q+I L DELF++PE FFHPE+A + KPGI+E ILESL +LPE +R LMV NIVCTGGNF
Sbjct: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 342 NIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQE 401
           N+PNF  R+  ELQ+Q+ T+W C VS+P+++  L  W+ M  F+      Y++ RVT++E
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTAS--YRNARVTREE 418

Query: 402 YNEHGFEWTTKQRFGYQNWL 421
           Y EHG +W TK RFGYQNW+
Sbjct: 419 YYEHGSDWCTKHRFGYQNWI 438

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/424 (58%), Positives = 326/424 (76%), Gaps = 7/424 (1%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M EAP++IDNGSYEIKFG ++   PF ALN++AKDKY  Y+LSNQ+ +IKDISSV+  RP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           H+LGQLVSWELE +IWDYC +N D+F G+ ++     HL+ +E+ MTLPELS+N DQVVF
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDG---SKENNYQDFNLVIDSGY 177
           EEY +DSL+KAP   F+PF    D + I ++ +    +     S   +Y+D+ LVIDSG+
Sbjct: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGF 180

Query: 178 NCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFI 237
           NC+W++P+IKGVPYYKAVKK+D+GGRFLNG L+E +S+RHY+V DE++LVN+IKE C+F+
Sbjct: 181 NCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFM 240

Query: 238 SPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEG 297
           SP SY +SF+ +  T  EYVLPDF TSF GY+R  K   TLPE SQ+IIL+DELF+VPE 
Sbjct: 241 SPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLR--KPGQTLPEDSQTIILQDELFAVPET 298

Query: 298 FFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQ 357
           FFHPE+A++L PGIIE ILES+ +LPE+LR L+V N+V TGGNFNIPNF SR+ TELQ+Q
Sbjct: 299 FFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFASRLATELQRQ 358

Query: 358 VQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGY 417
             T+W C VS+P  +A L  WK M+ F+E   + Y+ +RV+++EY EHG +W T +RFGY
Sbjct: 359 CPTDWSCRVSVPTGDARLYGWKCMQKFSET--QAYRESRVSREEYYEHGVDWCTSKRFGY 416

Query: 418 QNWL 421
           Q WL
Sbjct: 417 QAWL 420

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/440 (57%), Positives = 329/440 (74%), Gaps = 21/440 (4%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M  +P++IDNGSYEIKF  S  E PF ALNALAKDK+ T YLSN I NIKDISS++ +RP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           H+LGQL  WELE  IWDYCF+N  +F+GF++ E   +HLV +E+ MTLPELS++ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSK------------TYLD---GSKEN- 164
           EEY FDSL+K+P A F+PF K+       +SGK +            T+     GS +N 
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180

Query: 165 --NYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTD 222
             +Y DF LVIDSG+NC+WIIP++KG+PYYKAVKK+D+GGRFL GLLKET+S+RHY++ D
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 223 ESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMK-KHSTLPEH 281
           E++LVNN+KE C+F+SPVSY +SFK K    +EYVLPDFQTSF+GYVR+ + ++S LPE 
Sbjct: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300

Query: 282 SQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNF 341
           +Q+I L DELF++PE FFHPE++ + KPGI+E ILESL +LPE +R LMV NIVCTGGNF
Sbjct: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 342 NIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQE 401
           N+PNF  R+  ELQ+Q+ T+W C VS+P  +  L  W+ M  F +   E Y+  RVT+ E
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKT--ESYRRARVTRDE 418

Query: 402 YNEHGFEWTTKQRFGYQNWL 421
           Y EHG +W TKQRFGYQNW+
Sbjct: 419 YYEHGPDWCTKQRFGYQNWI 438

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/442 (57%), Positives = 328/442 (74%), Gaps = 24/442 (5%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M   PL++DNGSYEIKFG SN E P+ ALN  A DKY + YLSNQ+  I+++S V+++RP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           H+LGQL SWELE  IWDYC YN D+F GFE+    + HL+++E  MTLPELS+N DQV+F
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 121 EEYGFDSLYKAPAANFIPF-IKNDDNSFI--RLSGK---------------SKTYLDGSK 162
           EEY FDSL+KAP A +IPF ++ DD   +   +SGK               S   L   K
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180

Query: 163 E---NNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD 219
           +   N+YQD+ LVIDSG+NC+WIIPMIKGVPYYKA+KK+D+GGRFL GLLKET+S+RHYD
Sbjct: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240

Query: 220 VTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLP 279
           + DE++LVNNIKE C+F+SP SY +SFK K  T VEY+LPD  +S++GY R+  K   LP
Sbjct: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRE-NKSKPLP 299

Query: 280 EHSQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGG 339
           E SQ + L DELFSVPE FFHPE++ +LKPGI+ETILESL ++PE LR L+V NIVCTGG
Sbjct: 300 EGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGG 359

Query: 340 NFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTK 399
           NFN+P+F +R+  ELQ+Q+ T+W C +S+PK   EL +WK+M  F   N + YK TR++K
Sbjct: 360 NFNLPHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFA--NTDSYKKTRISK 417

Query: 400 QEYNEHGFEWTTKQRFGYQNWL 421
           +EY EHG +W TK +FGYQNWL
Sbjct: 418 EEYYEHGPDWLTKHKFGYQNWL 439

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/440 (57%), Positives = 325/440 (73%), Gaps = 21/440 (4%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M   P++IDNGSYEIKFG S  + PF ALNALAKDK+ T YLSN I NIKDISSV+ +RP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           H+LGQL  WELE  IWDYC +N  +F GF++ E   +HLV +E+ MTLPELS++ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGK-----------------SKTYLDGSKE 163
           EEY FDSL+K+P A F+PF K+       +SGK                 SK  +D +  
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180

Query: 164 NN-YQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTD 222
           NN Y DF LVIDSG++C+WIIP++KG+PYYKAVKK+D+GGRFL GLLKET+S+RHY++ D
Sbjct: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 223 ESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDM-KKHSTLPEH 281
           E++LVNNIKE C+F+SP SY +SFK K    +EYVLPDFQTSF+GYVR   ++ S LP  
Sbjct: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300

Query: 282 SQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNF 341
           +QSI L DELF++PE FFHPE++ ++KPGI+E ILESL +LPE +R LM+ NIVCTGGNF
Sbjct: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360

Query: 342 NIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQE 401
           N+PNF  R+  ELQ+Q+ T+W C+VS+P+ +  L  W+ M  F +   E Y+  RVT++E
Sbjct: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKT--ESYQRARVTREE 418

Query: 402 YNEHGFEWTTKQRFGYQNWL 421
           Y EHG +W TK RFGYQNW+
Sbjct: 419 YYEHGPDWCTKHRFGYQNWI 438

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/423 (58%), Positives = 321/423 (75%), Gaps = 6/423 (1%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M E+PL+IDNGSYEIKFG  +++ P  ALN++AKDKY  Y+LSNQ+ +IKDISSV   RP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           H+LGQLVSWELE +IWDYC +N DDF G+ ++     HL+ +E+ MT+PELS+N DQVVF
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 121 EEYGFDSLYKAPAANFIPF--IKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYN 178
           EEY F++++KAP   F+PF   K   +  +          + +   NY DF LVIDSG+N
Sbjct: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFN 180

Query: 179 CSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFIS 238
           CSWI+P+IKGVPYYKAVKK+D+GGRFLNG L+E +S+RHY+V DE++LVN+IKENC+F+S
Sbjct: 181 CSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMS 240

Query: 239 PVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEGF 298
           P +Y ESF+ ++ T  EYVLPDF TSF GY+R  K    LP  SQ+I+L+DELF+VPE F
Sbjct: 241 PNAYFESFQSRSKTAKEYVLPDFNTSFQGYLR--KPGQVLPAESQTIVLQDELFAVPETF 298

Query: 299 FHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQV 358
           FHPE+A++L  GI+ETILES+ +LPE++R LMV NIV TGGNFNIPNF SR+ TELQ+Q 
Sbjct: 299 FHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQC 358

Query: 359 QTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQ 418
            T+W C VS+PK +A L  WK M+ F+E   E Y  +RVT+QEY EHG +W T +RFGYQ
Sbjct: 359 PTDWSCRVSLPKGDAGLYGWKCMQKFSET--EDYHESRVTRQEYYEHGVDWCTAKRFGYQ 416

Query: 419 NWL 421
            WL
Sbjct: 417 AWL 419

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/427 (59%), Positives = 322/427 (75%), Gaps = 15/427 (3%)

Query: 2   GEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRPH 61
            +  ++IDNGSY++KFG +++  P VALNALAKDKY   +LSNQ+ NIKDISSV  +RPH
Sbjct: 3   ADQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPH 62

Query: 62  QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVFE 121
           +LGQL SWELE  IWDYC YN D+F G +       H+VL+ET MTLPELS+NTDQV+FE
Sbjct: 63  ELGQLTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFE 121

Query: 122 EYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKS-------KTYLDGSKENNYQDFNLVID 174
           EY  DSLYKAP A +IPF   ++N    +SGKS       +  ++  KE  Y DF+LVID
Sbjct: 122 EYEVDSLYKAPTAAYIPFYTTNEN-IKTISGKSDHGELDIEEKIEAGKE--YNDFSLVID 178

Query: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENC 234
           SG+NC+W+IP++KGVPYYKAVKK+D+GGRFLNGLLKETIS+RHY+V DES+LVNNIKE C
Sbjct: 179 SGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQC 238

Query: 235 MFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSV 294
           +++ PVSY E+FK K   K+++VLPDFQTSF GYVRD K  + LP+++Q + L DE FSV
Sbjct: 239 LYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPK--TALPDNAQILTLTDERFSV 296

Query: 295 PEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTEL 354
           PE FFHPE++  LKPGIIET+LES+++LPE LR LM +NIVC GGNFN+P F  R+ +EL
Sbjct: 297 PEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSEL 356

Query: 355 QKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQR 414
           Q+Q+ T+WVC   I   +  L  W AM  F   +   YK  RVTK++Y EHG +WTTK+R
Sbjct: 357 QRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDA--YKKARVTKEDYFEHGLDWTTKER 414

Query: 415 FGYQNWL 421
           FGYQNW+
Sbjct: 415 FGYQNWV 421

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/442 (56%), Positives = 322/442 (72%), Gaps = 25/442 (5%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M   P++IDNGSYEIKFG S  + PF ALNALAKDK+ T YLSN I NIKDISS++ +RP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           H+LGQL  WELE  IWDYC +N  +F GF++ E   +HLV +E+ MTLPELS++ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKS--------------------KTYLDG 160
           EEY FDSL+K+P A F+PF K+       +SGK                     K   D 
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDS 180

Query: 161 SKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDV 220
              ++Y DF LVIDSG+NC+WIIP++KG+PYYKAVKK+D+GGRFL GLLKET+S+RHY++
Sbjct: 181 G--SDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNM 238

Query: 221 TDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHST-LP 279
            DE++LVNNIKE C+F+SPVSY +SFK K    +EYVLPDFQTSF+GYVR+ +K +  LP
Sbjct: 239 MDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLP 298

Query: 280 EHSQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGG 339
           E +Q I L DELF++PE FFHPE++ + KPGI+E ILESL +LPE +R LMV NIVCTGG
Sbjct: 299 EDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGG 358

Query: 340 NFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTK 399
           NFN+PNF  R+  ELQ+Q+ T+W C VS+P+ +  L  W+ M  F + +   Y+  RVT+
Sbjct: 359 NFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDS--YRKARVTR 416

Query: 400 QEYNEHGFEWTTKQRFGYQNWL 421
           +EY EHG +W TK RFGYQNW+
Sbjct: 417 EEYYEHGPDWCTKHRFGYQNWI 438

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/425 (56%), Positives = 320/425 (75%), Gaps = 9/425 (2%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRPHQL 63
            P +IDNGSYEIKFG++N  TPF A N +AKDKY   YLSN +  I+DISS +I+RPH+L
Sbjct: 2   VPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHEL 61

Query: 64  GQLVSWELEHEIWDYCFYNGDDFKGFEVNEDS-ENHLVLTETPMTLPELSRNTDQVVFEE 122
           GQLVSWELE  IWDYC YN D+F GF + +++ E  L+LTET  TLPELS+N+DQVVFEE
Sbjct: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121

Query: 123 YGFDSLYKAPAANFIPFIKNDDNSFI-RLSGKSK---TYLDGSKENNYQDFNLVIDSGYN 178
           Y F +++K+PA+ F+PF     N  +  L GK     T    +    Y+DF LVIDSG+N
Sbjct: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRDFQLVIDSGFN 181

Query: 179 CSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFIS 238
           C+W++P+IKGVP+YKA+KKMD+GGRFLNGLLKET+S+RHY++ DE++L+NNIKE C+F+S
Sbjct: 182 CTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVS 241

Query: 239 PVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHS-QSIILEDELFSVPEG 297
           PVSY +SFK K    VEYVLPDFQTSF+GY+ D      +   S Q+I L DE F+VPE 
Sbjct: 242 PVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPET 301

Query: 298 FFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQ 357
           FFHPEMAN+LKPG++ETILE++ ++PE LR ++V+NIVC GGNF +P+  SR+ +ELQ+Q
Sbjct: 302 FFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQ 361

Query: 358 VQTEWVCDVSIP-KANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
           + T+W C V++P  ++ EL  W AM  F+    ++YK TRVT++EY EHG +W +K RF 
Sbjct: 362 LPTDWTCRVTVPSSSDCELAAWNAMAQFSST--DVYKTTRVTREEYLEHGTDWCSKHRFT 419

Query: 417 YQNWL 421
           YQNW+
Sbjct: 420 YQNWI 424

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/424 (58%), Positives = 319/424 (75%), Gaps = 8/424 (1%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M + P++IDNGSYE+KFG +   TPF ALNALA+DKY   +LSNQ++ +KDIS+V  +RP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           H+LGQL SWEL+  IWDYC YN D+F  +E+      HLVL+E  M++PELS+ TDQVVF
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEF-NWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119

Query: 121 EEYGFDSLYKAPAANFIPF-IKNDDNSFIRLSGKSKTYLDGSKENN-YQDFNLVIDSGYN 178
           EEY F S +K P A F+PF  +  +++ I     S    D + E N Y DF LVIDSG+N
Sbjct: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFN 179

Query: 179 CSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFIS 238
           C+W++P++KG+PYYKA+KK+D+GGRFLNG LKET+S+RHY+V DE++LVNNIKE C+F+S
Sbjct: 180 CTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMS 239

Query: 239 PVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEGF 298
           PVSY  SF+KK  T  EYVLPDFQTSF GYV+  K+   +PE SQ+I L DELFS+PE F
Sbjct: 240 PVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQK--IPEDSQTIKLYDELFSIPETF 297

Query: 299 FHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQV 358
           FHPE+A++LKPGI+ETILES+ +LPE++R LMV+N V TGGNFNI NF  R+ TELQ+Q 
Sbjct: 298 FHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQC 357

Query: 359 QTEWVCDVSIPKA-NAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGY 417
            T+W   VS+P A +  L  W +M+ F++     Y+ TRVT++EY EHG +W TKQRFGY
Sbjct: 358 PTDWDVCVSVPNASDTALFGWDSMRQFSQTTA--YQQTRVTREEYYEHGVDWCTKQRFGY 415

Query: 418 QNWL 421
           Q WL
Sbjct: 416 QKWL 419

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  508 bits (1309), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 234/419 (55%), Positives = 317/419 (75%), Gaps = 10/419 (2%)

Query: 3   EAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRPHQ 62
             PLL++NGSYEIKFG +N ETP+ A N L +D+Y  Y+LSNQ++ I+DIS   I+RP +
Sbjct: 2   RVPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSE 61

Query: 63  LGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVFEE 122
           LGQL+SWELE +IWDYC +N D+F G+E+ +  +  L+ +ET MT+PE+S+N DQVVFEE
Sbjct: 62  LGQLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEE 120

Query: 123 YGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNCSWI 182
           Y F S+ K P A F+PF +  D   +  +G+      G     Y +F LV+DSG+NC+W+
Sbjct: 121 YEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSG-----YNNFQLVVDSGFNCTWV 175

Query: 183 IPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFISPVSY 242
           +P+IKGVPYYKA KK+D+GGRFLNGLLKETIS+RHY+V DE++L+NNIKE C F+ PVSY
Sbjct: 176 MPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSY 235

Query: 243 IESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEGFFHPE 302
            +SF++K  T+VEY+LPDFQTS +GYVR  K+   +P+ SQ + LEDELF+VPE FFHPE
Sbjct: 236 FDSFQRKEETRVEYILPDFQTSLIGYVRQPKQ--AIPKTSQILRLEDELFTVPETFFHPE 293

Query: 303 MANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEW 362
           ++N+LKPG++ETILE + ++PE LR L+V+NIV  GGNFNI NF +R+ TELQ+Q  T+W
Sbjct: 294 ISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDW 353

Query: 363 VCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQNWL 421
              V  PK +A LQ WK+M+ F++ +   YK++RVT+ EY EHG +W TK RFGY+ W+
Sbjct: 354 KVRVHQPKLDAALQGWKSMRQFSQTDS--YKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  507 bits (1306), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 240/425 (56%), Positives = 324/425 (76%), Gaps = 18/425 (4%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           MG  P++IDNGSYEIKFG S+ ++P+ ALN LA+DKY  Y+LSNQ+  I+++S+  ++RP
Sbjct: 1   MG-VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRP 59

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
            +LGQLVSWELE  IWDYC +N D+F  +++ +  +  L+++ET M++PE+S++ DQVVF
Sbjct: 60  FELGQLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVF 118

Query: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDG----SKENNYQDFNLVIDSG 176
           EEY F SL K P A +IPF   D+ +  ++ G      DG     K+++Y DF LV+DSG
Sbjct: 119 EEYEFGSLMKCPVAQYIPF---DNMADYKVYGS-----DGLPVVRKKDDYNDFQLVVDSG 170

Query: 177 YNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMF 236
           +NC+W+IP+IKGVPYYKAVKK+D+GGRFL GLLKET+S+RHY++ DE++L NNIKE C F
Sbjct: 171 FNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCF 230

Query: 237 ISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPE 296
           + PVSY +SF+KKA T+++YVLPDFQTS +GYVR  K+   +PE SQ++ LEDELF++PE
Sbjct: 231 MPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQ--AIPEDSQTLNLEDELFTIPE 288

Query: 297 GFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQK 356
            FFHPE+AN+LKPG+IET+LES+ +LPE +R LMV+NI   GGNFNI NF SR+ TELQ+
Sbjct: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348

Query: 357 QVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
           Q  T+W   V +PK + ELQ WKAM  F+  N + YK  RVT+ EY EHG +W TK RFG
Sbjct: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFS--NTDSYKQGRVTRAEYLEHGVDWCTKYRFG 406

Query: 417 YQNWL 421
           Y+ W+
Sbjct: 407 YEQWI 411

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  505 bits (1300), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 240/424 (56%), Positives = 309/424 (72%), Gaps = 12/424 (2%)

Query: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60
           M E  L+IDNGSYEIKFG S  + P  ALN L KDKY  ++LSNQ   ++DIS   I+RP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKG--FEVNEDSENHLVLTETPMTLPELSRNTDQV 118
           H+LGQLVSWELE E+WDYCFYN DDF       N+  ++HLV++ET MT+PELS+N DQV
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120

Query: 119 VFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYN 178
           +FEEY F S++K P A +IPF +       +    + T  +  K ++Y+DF LVIDSG+N
Sbjct: 121 IFEEYDFKSMFKGPVAQYIPFYQG------QYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174

Query: 179 CSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFIS 238
           C+W +P+IKGVPYYKA+KK+D+GGRFL GLL+ETIS+RHY+V +E++LVNNIKE C F+ 
Sbjct: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVP 234

Query: 239 PVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEGF 298
           P SY  SF  K  TKVEYVLPDFQTSF+GYV+   K   L + +Q+++L DE+FSVPE F
Sbjct: 235 PESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEK-LTDDAQTLLLTDEVFSVPETF 293

Query: 299 FHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQV 358
           FHPE+A +LKPGI+ETILE + + PE +R L+V NIVCTGGNFNIPNF  R+ TELQ+Q 
Sbjct: 294 FHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQC 353

Query: 359 QTEWVCDVSIPK-ANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGY 417
             +W C V  P+  +  L  W++MK F   N + ++  RVT++EY EHG +W TK RFGY
Sbjct: 354 PIDWSCKVHSPQEKDKSLHGWESMKDFA--NSDQFRSARVTREEYLEHGLDWCTKNRFGY 411

Query: 418 QNWL 421
           Q WL
Sbjct: 412 QQWL 415

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 99.8 bits (247), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 96/421 (22%), Positives = 172/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR L   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSSIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP + ++   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 99.8 bits (247), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 96/421 (22%), Positives = 172/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR L   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSSIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP + ++   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMEVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 99.4 bits (246), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 96/421 (22%), Positives = 172/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR L   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSSIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP + ++   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score = 99.0 bits (245), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 96/421 (22%), Positives = 171/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR L   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSSIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score = 99.0 bits (245), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 96/421 (22%), Positives = 171/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR L   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSSIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 99.0 bits (245), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 96/421 (22%), Positives = 171/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR L   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSSIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 99.0 bits (245), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 96/421 (22%), Positives = 171/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR L   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSSIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score = 99.0 bits (245), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 96/421 (22%), Positives = 171/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR L   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSSIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 99.0 bits (245), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 96/421 (22%), Positives = 171/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR L   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSSIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 99.0 bits (245), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 96/421 (22%), Positives = 171/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR L   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSSIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 98.6 bits (244), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 96/421 (22%), Positives = 172/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR L   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTASQSSSIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV +GG+   P    
Sbjct: 252 NERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGSTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score = 98.6 bits (244), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 95/421 (22%), Positives = 171/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQILFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR +   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSAIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score = 98.6 bits (244), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 95/421 (22%), Positives = 172/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR L   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSSVEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP + ++   G+ +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 98.6 bits (244), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 93/422 (22%), Positives = 170/422 (40%), Gaps = 80/422 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 7   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDCYVGDEAQSKRGI- 65

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 66  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 117

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 118 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 153

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR +   L + +S R Y    T E  +V +I
Sbjct: 154 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDI 213

Query: 231 KENCMFISPVSYIESFKKKALTKV---EYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIIL 287
           KE   +++ + Y +  +  A +      Y LPD                      Q I +
Sbjct: 214 KEKLCYVA-LDYDQEMQTAAQSSAIEKSYELPD---------------------GQVITI 251

Query: 288 EDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFG 347
            +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV +GG    P   
Sbjct: 252 GNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIA 311

Query: 348 SRIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNE 404
            R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E
Sbjct: 312 ERMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDE 365

Query: 405 HG 406
            G
Sbjct: 366 SG 367

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score = 98.2 bits (243), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 95/421 (22%), Positives = 171/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 7   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 65

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 66  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 117

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 118 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 153

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR +   L + +S R Y    T E  +V +I
Sbjct: 154 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDI 213

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 214 KE--------------------KLCYVALDFEQEMQTAAQSSAIEKSYELPD-GQVITIG 252

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 253 NERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 312

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 313 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 366

Query: 406 G 406
           G
Sbjct: 367 G 367

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 97.4 bits (241), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 94/421 (22%), Positives = 170/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQILFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G      + ++D+ GR +   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSAIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 97.4 bits (241), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 95/421 (22%), Positives = 170/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G      + ++D+ GR L   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSSIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 94/421 (22%), Positives = 172/421 (40%), Gaps = 78/421 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKNNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQILFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD--VTDESMLVNNI 230
           +DSG   + ++P+  G     A+ ++D+ GR +   L + ++ R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTASQSSAVEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  FHP + ++   GI +T   S+      +R  +  NIV +GG    P    
Sbjct: 252 NERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 311

Query: 349 RIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELYKHTRVTKQEYNEH 405
           R+  E+     +     +  P    +   W     + S T      ++   ++KQEY+E 
Sbjct: 312 RMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----FQQMWISKQEYDES 365

Query: 406 G 406
           G
Sbjct: 366 G 366

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 93/411 (22%), Positives = 176/411 (42%), Gaps = 61/411 (14%)

Query: 5   PLLIDNGSYEIKFGYSNQETPFVALNALAK-DKYETY---------YLSNQINNIKDISS 54
           P+++DNGS  IK G+  ++ P    ++L    KY            ++ NQ   I+ +  
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL-- 69

Query: 55  VSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRN 114
           + ++ P + G +  W    ++W + F      KG +++   ++ +++TE P+   +    
Sbjct: 70  LKLRHPLEHGVVTDWNALEQLWGHVFE-----KGLQLSSLQDHPVLVTEAPLNPKKNREQ 124

Query: 115 TDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVID 174
             +++FE +   ++Y +  A             + L    +T               V+D
Sbjct: 125 MCELLFETFSVPAVYVSIQA------------VLSLYASGRTT------------GCVLD 160

Query: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENC 234
           SG  CS  +P+  G     A++++D+ GR ++ LL+  I       T  S+L ++ +E  
Sbjct: 161 SGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELLQVLIRKS----TGVSLLSSSEREIV 216

Query: 235 MFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSV 294
             I   +   +   K   K  Y +   QT F            LP+  Q I L++E F  
Sbjct: 217 RIIKEKACYIALDPKEEEK-NYTMHGKQTMF-----------RLPDGKQ-IELDNEKFRA 263

Query: 295 PEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTEL 354
           PE  F+P++       + E + ES+  +   LR+ + +NIV +GG   IP FG R+  EL
Sbjct: 264 PEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIVFSGGTTMIPGFGDRVLKEL 323

Query: 355 QKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEH 405
           +   + +    +  P    +   W  +     +    +K   VTK+E+ E+
Sbjct: 324 KLSCEPQTKIKIFAP-PERKYSTW--IGGSILSGLSTFKKIWVTKKEWEEN 371

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 89.4 bits (220), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 86/368 (23%), Positives = 154/368 (41%), Gaps = 65/368 (17%)

Query: 4   APLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI---------- 52
           +P+++D G+  +K G + +  P +   + + +        +N    ++DI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDVR 64

Query: 53  SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELS 112
           S + I  P + G + +W     +WDY F+N       ++N  S   ++LTE PM   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLNNTSGGKILLTEPPMNPLKNR 119

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               +V+FE+Y F  +Y A  A    + +        LS                   +V
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQG-------LSS-----------------GVV 155

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNI 230
           +DSG   + I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 231 KENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288
           KE   ++S  +       ++  T VE Y LPD +T  +G                     
Sbjct: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVG--------------------- 254

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
            E F  PE  F P + +V +PG+ E +  ++      +RS +   IV +GG+   P   S
Sbjct: 255 QERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAIVLSGGSSMYPGLPS 314

Query: 349 RIYTELQK 356
           R+  EL++
Sbjct: 315 RLEKELKQ 322

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 86/374 (22%), Positives = 151/374 (40%), Gaps = 68/374 (18%)

Query: 41  YLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-L 99
           Y+ ++  + + I  ++++ P + G + +W+   +IW + FYN       E+    E H +
Sbjct: 38  YVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPV 88

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE PM          Q++FE +   + Y +  A             + L    +T   
Sbjct: 89  LLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT-- 134

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD 219
                      +V+DSG   + ++P+  G     A+ ++D+ GR L   L + +S R Y 
Sbjct: 135 ----------GIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYS 184

Query: 220 --VTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKH 275
              T E  +V +IKE                    K+ YV  DF+       +   ++K 
Sbjct: 185 FSTTAEREIVRDIKE--------------------KLCYVALDFEQEMQTAAQSSSIEKS 224

Query: 276 STLPEHSQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIV 335
             LP+  Q I + +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV
Sbjct: 225 YELPD-GQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIV 283

Query: 336 CTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELY 392
            +GG    P    R+  E+     +     +  P    +   W     + S T      +
Sbjct: 284 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----F 337

Query: 393 KHTRVTKQEYNEHG 406
           +   ++KQEY+E G
Sbjct: 338 QQMWISKQEYDESG 351

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 96/420 (22%), Positives = 176/420 (41%), Gaps = 76/420 (18%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINN----------IKDIS 53
           P+++DNGS  IK G+S Q  P     N +   KYE   L+N I+N           K   
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKSRG 69

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSR 113
            + ++ P   G + +W+    +W + F   +D    ++N+  E+ L++TE P+  PE +R
Sbjct: 70  LLRLRHPMNRGIVENWDDMETLWSHTF---NDI--LKINDFDEHPLLITEAPLN-PEKNR 123

Query: 114 N-TDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
           +   +V FE++ F ++Y          I N     +  SG++                 V
Sbjct: 124 DKMCEVFFEKFDFAAVY----------IANPSTLSLYASGRTT--------------GCV 159

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD-----VTDESMLV 227
           +D G      +P+ +G     +++++D+GGR +   L+  I  R Y       + E  +V
Sbjct: 160 LDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQFQI--RKYTGISLYSSSEHEIV 217

Query: 228 NNIKENCMFISP-VSYIESFKKKALTKV--EYVLPDFQTSFMGYVRDMKKHSTLPEHSQS 284
            N+KE   ++S   ++ E        K+  ++ LPD                      + 
Sbjct: 218 KNVKEKACYVSTDFAHDEDMSNLNPEKIRCQFKLPD---------------------GKD 256

Query: 285 IILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIP 344
           +IL+   F  PE  F P++  +    + +   ES+  +   LR  + ++I+  GG+    
Sbjct: 257 LILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSIILNGGSTMFR 316

Query: 345 NFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNE 404
            FG R+  ELQ +   + +  +  P    +  +W      T      +K   +TK E+ E
Sbjct: 317 GFGDRLLKELQIRTGNKNLIKIIAP-PERKYTSWIGGSILT--GLSTFKQLWMTKAEWQE 373

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/367 (22%), Positives = 157/367 (42%), Gaps = 70/367 (19%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETY---------YLSNQINNIKDISS 54
           P+++DNGS  IK G+S +E P     + +   KY            ++ NQ   ++ +  
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL-- 68

Query: 55  VSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRN 114
           + ++ P + G + +W     IW++ F+     K  ++N   E+ ++ TE P+   +    
Sbjct: 69  LKLRYPLEHGIVKNWSDMELIWNHVFH-----KSLQLNNIEEHPVLATEAPLNPLKNREA 123

Query: 115 TDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVID 174
             +++FE +   ++Y +  A             + L    +T               V+D
Sbjct: 124 MCEMLFETFNVPAVYVSIQA------------VLSLYASGRTT------------GCVLD 159

Query: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESMLVNNI 230
            G  C   +P+  G     +++++D+ GR    FL  LL++T        + E  +V  I
Sbjct: 160 CGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLS-SSEREIVRII 218

Query: 231 KENCMFIS--PVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288
           KE   +++  P++  +++     + + + LPD      G V D+K               
Sbjct: 219 KEKACYVARDPLTEEQTYHLTPTSTI-FKLPD------GKVLDLK--------------- 256

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
           +E F  PE  F P++       I E   +S+  +   LR  +++NIV +GG    P FG 
Sbjct: 257 NEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSGGTTMFPGFGD 316

Query: 349 RIYTELQ 355
           R+ TEL+
Sbjct: 317 RLLTELR 323

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 86/368 (23%), Positives = 154/368 (41%), Gaps = 65/368 (17%)

Query: 4   APLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI---------- 52
           +P+++D G+  +K G + +  P +   + + +        +N    +KDI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64

Query: 53  SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELS 112
           S + I  P + G + +W     +WDY F     F+  ++   S   ++LTE PM   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPTTSNGKILLTEPPMNPTKNR 119

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               +V+FE+Y F  +Y A  A    + +        LS                   +V
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQG-------LSS-----------------GVV 155

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNI 230
           +DSG   + I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 231 KENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288
           KE   ++S  +       ++  T VE Y LPD +T  +G                     
Sbjct: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVG--------------------- 254

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
            E F  PE  F P + +V +PG+ E + +++      +RS +   IV +GG+   P   S
Sbjct: 255 QERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPS 314

Query: 349 RIYTELQK 356
           R+  EL++
Sbjct: 315 RLEKELKQ 322

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 83/374 (22%), Positives = 149/374 (39%), Gaps = 68/374 (18%)

Query: 41  YLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-L 99
           Y+ ++  + + I  ++++ P + G + +W+   +IW + FYN       E+    E H +
Sbjct: 38  YVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPV 88

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE PM          Q++FE +   + Y                  + +      Y  
Sbjct: 89  LLTEAPMNPKSNREKMTQILFETFNVPAFY------------------VSIQAVLSLYSS 130

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD 219
           G      +   +V+DSG   + ++P+  G      + ++D+ GR +   L + +S R Y 
Sbjct: 131 G------RTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYS 184

Query: 220 --VTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRD--MKKH 275
              T E  +V +IKE                    K+ YV  DF+       +   ++K 
Sbjct: 185 FSTTAEREIVRDIKE--------------------KLCYVALDFEQEMQTAAQSSAIEKS 224

Query: 276 STLPEHSQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIV 335
             LP+  Q I + +E F  PE  FHP +  +   GI +T   S+      +R  +  NIV
Sbjct: 225 YELPD-GQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIV 283

Query: 336 CTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNW---KAMKSFTENNEELY 392
            +GG    P    R+  E+     +     +  P    +   W     + S T      +
Sbjct: 284 MSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPER-KYSVWIGGSILASLTT-----F 337

Query: 393 KHTRVTKQEYNEHG 406
           +   ++KQEY+E G
Sbjct: 338 QQMWISKQEYDESG 351

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 86.7 bits (213), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 83/367 (22%), Positives = 152/367 (41%), Gaps = 70/367 (19%)

Query: 5   PLLIDNGSYEIKFGYSNQETP---------FVALNALAKDKYET-YYLSNQINNIKDISS 54
           P+++DNGS  IK G+S +E P          V  N +     E   ++ NQ   ++ +  
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL-- 66

Query: 55  VSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRN 114
           + ++ P + G + +W     IW Y F      K  ++    ++ +++TE P+        
Sbjct: 67  LKLRHPVEHGIVKNWSDMEHIWSYVFN-----KSLQLQNVEDHPILITEAPLNPRNNRER 121

Query: 115 TDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVID 174
             +++FE +   +LY +  A             + L    +T               V+D
Sbjct: 122 MCELLFESFNVPALYVSIQA------------VLSLYASGRTT------------GCVVD 157

Query: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESMLVNNI 230
            G  C   +P+  G     +++++D+ GR    FL  LL++T        + E  +V  I
Sbjct: 158 CGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLS-SSEREVVRII 216

Query: 231 KENCMFISPVSYIE--SFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288
           KE   +++   +IE  +F        ++ LPD +T                     I L 
Sbjct: 217 KEKACYVAKDPHIEEQNFSINP-NYTKFKLPDGKT---------------------IDLG 254

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
            E F  PE  F PE+       + +   +S+  +   LRSL+ +N++ +GG   +P FG 
Sbjct: 255 QEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLLSGGTSILPGFGD 314

Query: 349 RIYTELQ 355
           R+ +EL+
Sbjct: 315 RLLSELK 321

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 86.7 bits (213), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 84/373 (22%), Positives = 151/373 (40%), Gaps = 82/373 (21%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETY---------YLSNQINNIKDISS 54
           P+++DNGS  IK G+S +E P     + +   KY            ++ NQ   ++ +  
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL-- 94

Query: 55  VSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRN 114
           + ++ P Q G + +W    ++W Y F      K  ++    ++  ++TE P+   +    
Sbjct: 95  LKLRYPLQHGIVTNWADMEQVWGYVFN-----KSLQLQNVEDHPNLVTEAPLNPHKNREK 149

Query: 115 TDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVID 174
             +++FE +   +LY +  A             + L    +T               V+D
Sbjct: 150 MCELLFESFNVPALYVSVQA------------VLSLYASGRTT------------GCVVD 185

Query: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESMLVNNI 230
            G  C   +P+  G     +++++D+ GR    FL  LL++T        + E  +V  I
Sbjct: 186 CGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLS-SSEREIVRTI 244

Query: 231 KENCMFISPVSYIE--------SFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHS 282
           KE   F++    +E        SF K       + LPD +T                   
Sbjct: 245 KEKACFVTKDPKLEEQNFPMNPSFSK-------FKLPDGKT------------------- 278

Query: 283 QSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFN 342
             I L  E +  PE  F PE+       + +   +S+  +   LRSL+ +NI+ +GG   
Sbjct: 279 --IELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGTSM 336

Query: 343 IPNFGSRIYTELQ 355
           +P FG R+  EL+
Sbjct: 337 LPGFGDRLLKELK 349

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 86.7 bits (213), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 84/369 (22%), Positives = 149/369 (40%), Gaps = 65/369 (17%)

Query: 3   EAPLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI--------- 52
             P+++D G+  +K G + +  P +   + + +        +N +  +KDI         
Sbjct: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV 63

Query: 53  -SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPEL 111
            S + I  P + G + +W     +WDY FY+       ++   S   ++LTE PM     
Sbjct: 64  RSYLQISYPMENGVIKNWSDMELLWDYAFYDQ-----MKLPSTSGGKVMLTEPPMNPLRN 118

Query: 112 SRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNL 171
                +V+FE+Y F  +Y A  A    + +        LS                   +
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQG-------LSS-----------------GV 154

Query: 172 VIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESML--VNN 229
           V+DSG   + I+P+ + V      +++D+ GR +   L + +S R Y     +    V  
Sbjct: 155 VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQ 214

Query: 230 IKENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIIL 287
           IKE   ++S  +       ++  T VE Y LPD +   +G                    
Sbjct: 215 IKEKLSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG-------------------- 254

Query: 288 EDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFG 347
             E F  PE  F P + +V +PG+ E +  ++      +RS +   IV +GG+   P   
Sbjct: 255 -SERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLP 313

Query: 348 SRIYTELQK 356
           SR+  EL++
Sbjct: 314 SRLEKELKQ 322

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 85/367 (23%), Positives = 152/367 (41%), Gaps = 65/367 (17%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI----------S 53
           P+++D G+  +K G + +  P +   + + +        ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSR 113
            + I  P + G + +W     +WDY F     F+  ++   S   ++LTE PM   +   
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLQSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVI 173
              +V+FE+Y F  +Y A  A    + +        LS                   +V+
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQG-------LSS-----------------GVVV 156

Query: 174 DSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNIK 231
           DSG   + I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  IK
Sbjct: 157 DSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIK 216

Query: 232 ENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILED 289
           E   ++S  +       ++  T VE Y LPD +T  +G                      
Sbjct: 217 EKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVG---------------------Q 255

Query: 290 ELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSR 349
           E F  PE  F P + +V +PG+ E +  ++      +RS +   IV +GG+   P   SR
Sbjct: 256 ERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSR 315

Query: 350 IYTELQK 356
           +  EL++
Sbjct: 316 LEKELKQ 322

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 84/368 (22%), Positives = 150/368 (40%), Gaps = 65/368 (17%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNALAKDKY----ETYYLSNQINNI------KDIS 53
           +P+++D G+  +K G + +  P     ++         E   +S  + +I       D+ 
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEASDVR 64

Query: 54  S-VSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELS 112
           S + I  P + G + +W+    +WDY FYN   F        S   ++LTE PM   +  
Sbjct: 65  SYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFP-----STSGGKILLTEPPMNPLKNR 119

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               +V+FE+Y F  +Y A  A    + +   +                         +V
Sbjct: 120 ELMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS------------------------GVV 155

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESML--VNNI 230
           +DSG   + I+P+ + V      +++D+ GR +   L + +S R Y     +    V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQI 215

Query: 231 KENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288
           KE   ++S  ++      ++    VE Y LPD +   +G                     
Sbjct: 216 KEKLSYVSYDLNLDTKLARETTVLVENYELPDGRVIKVG--------------------- 254

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
            E F  PE  F P++ +V +PGI E +  ++      +RS +   IV +GG+   P   S
Sbjct: 255 QERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAIVLSGGSSMYPGLPS 314

Query: 349 RIYTELQK 356
           R+  EL++
Sbjct: 315 RLEKELKQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 86/370 (23%), Positives = 150/370 (40%), Gaps = 67/370 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETP---FVALNALAKDKYETYYLSNQINNIKDI-------- 52
           +P+++D G+  +K G + +  P   F ++      + E     +    IKDI        
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGEEASD 64

Query: 53  --SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPE 110
             S + I  P + G +  W     +WD+ F     F+  ++   S   ++LTE PM   +
Sbjct: 65  VRSYLQISYPMENGIIKHWTDMELLWDHAF-----FEKMKLPSTSGGKILLTEPPMNPLK 119

Query: 111 LSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFN 170
                 QV+FE+Y F  +Y A  A    + +        LS                   
Sbjct: 120 NREMMCQVMFEKYDFGGVYVAIQAVLALYAQG-------LSS-----------------G 155

Query: 171 LVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESML--VN 228
           +V+DSG   + I+P+ + V      +++D+ GR +   L + +S R Y     +    V 
Sbjct: 156 VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVR 215

Query: 229 NIKENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSII 286
            IKE   ++S  + +     ++  T VE Y LPD +   +G                   
Sbjct: 216 QIKEKLSYVSYDLDFDTKLARETTTLVENYELPDGRIIKVG------------------- 256

Query: 287 LEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNF 346
              E F  PE  F P + +V +PG+ E +  ++      +RS +   IV +GG+   P  
Sbjct: 257 --QERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYKAIVLSGGSSMYPGL 314

Query: 347 GSRIYTELQK 356
            SR+  EL++
Sbjct: 315 PSRLEKELKQ 324

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 84/367 (22%), Positives = 151/367 (41%), Gaps = 65/367 (17%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI----------S 53
           P+++D G+  +K G + +  P +   + + +        ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASDVRS 65

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSR 113
            + I  P + G + +W     +WDY F     F+  ++   S   ++LTE PM   +   
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVI 173
              +V+FE+Y F  +Y A  A    + +        LS                   +V+
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQG-------LSS-----------------GVVV 156

Query: 174 DSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNIK 231
           DSG   + I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  IK
Sbjct: 157 DSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIK 216

Query: 232 ENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILED 289
           E   ++S  +       ++    VE Y LPD +T  +G                      
Sbjct: 217 EKLCYVSYDLDLDTKLARETTVLVESYELPDGRTIKVG---------------------Q 255

Query: 290 ELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSR 349
           E F  PE  F P + +V +PG+ E +  ++      +RS +   IV +GG+   P   SR
Sbjct: 256 ERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAIVLSGGSSMYPGLPSR 315

Query: 350 IYTELQK 356
           +  EL++
Sbjct: 316 LEKELKQ 322

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 84/367 (22%), Positives = 151/367 (41%), Gaps = 65/367 (17%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI----------S 53
           P+++D G+  +K G + +  P +   + + +        ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSR 113
            + I  P + G + +W     +WDY F     F+  ++   S   ++LTE PM   +   
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVI 173
              +V+FE+Y F  +Y A  A    + +        LS                   +V+
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQG-------LSS-----------------GVVV 156

Query: 174 DSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNIK 231
           DSG   + I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  IK
Sbjct: 157 DSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIK 216

Query: 232 ENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILED 289
           E   ++S  +       ++    VE Y LPD +T  +G                      
Sbjct: 217 EKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVG---------------------Q 255

Query: 290 ELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSR 349
           E F  PE  F P + +V +PG+ E +  ++      +RS +   IV +GG+   P   SR
Sbjct: 256 ERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSR 315

Query: 350 IYTELQK 356
           +  EL++
Sbjct: 316 LEKELKQ 322

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 84/367 (22%), Positives = 151/367 (41%), Gaps = 65/367 (17%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI----------S 53
           P+++D G+  +K G + +  P +   + + +        ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRS 65

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSR 113
            + I  P + G + +W     +WDY F     F+  ++   S   ++LTE PM   +   
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 114 NTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVI 173
              +V+FE+Y F  +Y A  A    + +        LS                   +V+
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQG-------LSS-----------------GVVV 156

Query: 174 DSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNIK 231
           DSG   + I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  IK
Sbjct: 157 DSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIK 216

Query: 232 ENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILED 289
           E   ++S  +       ++    VE Y LPD +T  +G                      
Sbjct: 217 EKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVG---------------------Q 255

Query: 290 ELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSR 349
           E F  PE  F P + +V +PG+ E +  ++      +RS +   IV +GG+   P   SR
Sbjct: 256 ERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSR 315

Query: 350 IYTELQK 356
           +  EL++
Sbjct: 316 LEKELKQ 322

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 91/373 (24%), Positives = 153/373 (41%), Gaps = 69/373 (18%)

Query: 5   PLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETY---------YLSNQINNIKDISSV 55
           P+++DNGS  +K GYS ++ P    +++       Y         ++ N     + I  +
Sbjct: 12  PVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI--L 69

Query: 56  SIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNT 115
            ++ P   G + +W     IWDY F +    K  +     E+ +++TE P+         
Sbjct: 70  QLRHPVDHGVVKNWNDMELIWDYMFKDKLKLKDVD-----EHPVLITEAPLNPVSNRDEM 124

Query: 116 DQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGK-SKTYLDGSKENNYQDFNLVID 174
             ++FE +G  +LY A  A    +           SGK S   LD               
Sbjct: 125 CDLLFESFGVQALYVANPAVLSLYA----------SGKISGCVLD-------------CG 161

Query: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETI---SYRHYDVTDESMLVNNIK 231
            GY+CS  +P+ +G     A+K++D+GGR L   L+  +   +      + E  LV  IK
Sbjct: 162 DGYSCS--VPVYQGYTLKSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMIK 219

Query: 232 ENCMFISPVSYIESFK---KKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288
           E   +++    IE  K   +     +++ LPD                      + I L 
Sbjct: 220 EKSCYVAVDLDIEEEKCNYEGDQVGLKFKLPD---------------------GKFITLS 258

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
            + F VPE  F P + +     I E I +S+  L   LR  M ++I+ +GG   +  FG+
Sbjct: 259 KDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGTTMLKGFGN 318

Query: 349 RIYTELQKQVQTE 361
           R+  EL K  Q +
Sbjct: 319 RLVQELDKLNQAQ 331

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/368 (23%), Positives = 150/368 (40%), Gaps = 65/368 (17%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINN-IKDI---------- 52
           +P+++D G+  +K G + +  P     ++             I+  +KDI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEASEVR 64

Query: 53  SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELS 112
           S + I  P + G + +W     +WDY F+N       ++   S   ++LTE PM   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLPTTSGGKVLLTEPPMNPVKNR 119

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               +V+FE Y F  +Y A  A    + +        LS                   +V
Sbjct: 120 ERMCEVMFERYDFGGVYVAIQAVLALYAQG-------LSS-----------------GVV 155

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNI 230
           +DSG   + I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQI 215

Query: 231 KENCMFIS-PVSYIESFKKKALTKV-EYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288
           KE   ++S  ++      ++  T V EY LPD +   +G                     
Sbjct: 216 KEKVCYVSYDLNLDTKLARETTTLVQEYELPDGRIIKVG--------------------- 254

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
            E F  PE  F P++ +V  PG+ E +  ++      +RS +   IV +GG+   P   S
Sbjct: 255 QERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPS 314

Query: 349 RIYTELQK 356
           R+  EL++
Sbjct: 315 RLERELKQ 322

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 88/366 (24%), Positives = 156/366 (42%), Gaps = 62/366 (16%)

Query: 5   PLLIDNGSYEIKFGYSNQETPF-VALNALAKDKYETYYLSNQINNI-KDISS-------- 54
           P++IDNGS  IK G+S Q+ P     N     KY+   ++ Q+ N+ K I +        
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 55  VSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRN 114
           + ++ P   G + +W+    +W + F +  + +  E     E+ L++TE P+T+ +    
Sbjct: 71  LRLQHPMNRGVVDNWDDMELLWWHIFNDTLNVQNIE-----EHPLLITEAPLTIEKQRHI 125

Query: 115 TDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVID 174
             + +FE +   SLY A            + S + L     T               V+D
Sbjct: 126 MCERLFETFNIPSLYVA------------NPSVLSLYASGNTT------------GCVVD 161

Query: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESMLVNNI 230
            G       P+ +G     +++KM++GGR     L   ++++     Y  ++E  +V  I
Sbjct: 162 CGDGYCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIRKSSGISLYS-SNEKEIVRTI 220

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDE 290
           KE   +IS     E F K             + S+     +M     LP+  + + L  E
Sbjct: 221 KEKVCYIS-----EDFNKS------------EESYYLRQDEMSCKFKLPD-GKELTLNKE 262

Query: 291 LFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRI 350
            F  PE  F+P++  +    +     ES+  +   LR  + +NI+ TGG+     FGSR+
Sbjct: 263 RFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSNILLTGGSTLFKGFGSRL 322

Query: 351 YTELQK 356
             +LQ+
Sbjct: 323 LGDLQE 328

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 82/367 (22%), Positives = 148/367 (40%), Gaps = 65/367 (17%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI----------S 53
           P+++D G+  +K G + +  P +   + + +        ++    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRS 65

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSR 113
            + I  P + G + +W     +WDY FY     +  ++   S   ++LTE PM       
Sbjct: 66  YLQISYPMENGIIKNWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 114 NTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVI 173
              +V+FE+Y F  +Y A  A    + +        LS                   +V+
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQG-------LSS-----------------GVVV 156

Query: 174 DSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESML--VNNIK 231
           DSG   + I+P+ + V      K++D+ GR +   L + +S R Y     +    V  IK
Sbjct: 157 DSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIK 216

Query: 232 ENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILED 289
           E   ++S  +       ++  T VE Y LPD +   +G                      
Sbjct: 217 EKLCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG---------------------S 255

Query: 290 ELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSR 349
           E F  PE  F P + +V +PG+ E +  ++      +R+ +   +V +GG+   P   SR
Sbjct: 256 ERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSR 315

Query: 350 IYTELQK 356
           +  EL++
Sbjct: 316 LEKELKQ 322

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 83/369 (22%), Positives = 147/369 (39%), Gaps = 65/369 (17%)

Query: 3   EAPLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI--------- 52
           + P+++D G+  +K G + +  P +   + + +        +N    +KDI         
Sbjct: 4   QKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQV 63

Query: 53  -SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPEL 111
            S + I  P + G +  W     +WDY FY     +  ++   S   ++LTE PM     
Sbjct: 64  RSYLQISYPMENGIIRDWADMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLRN 118

Query: 112 SRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNL 171
                +V+FE+Y F  +Y                  + +      Y  G          +
Sbjct: 119 REQMCEVMFEKYDFGGVY------------------VGIQAVLALYAQGLSSG------V 154

Query: 172 VIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNN 229
           V+DSG   + I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  
Sbjct: 155 VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQ 214

Query: 230 IKENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIIL 287
           IKE   ++S  +       ++  T VE Y LPD +   +G                    
Sbjct: 215 IKEKLCYVSYDLDLDTRLAQETTTLVEQYELPDGRVIKVG-------------------- 254

Query: 288 EDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFG 347
             E F  PE  F P + +V +PGI E +  ++      + S +   IV +GG+   P   
Sbjct: 255 -SERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAIVLSGGSSMYPGLP 313

Query: 348 SRIYTELQK 356
           SR+  EL++
Sbjct: 314 SRLEKELKQ 322

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 80.5 bits (197), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 84/367 (22%), Positives = 150/367 (40%), Gaps = 65/367 (17%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI----------S 53
           P+++D G+  +K G + +  P +   + + +         +    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSR 113
            + I  P + G + +W     +WDY F     F+  ++   S   ++LTE PM   +   
Sbjct: 66  YLQISYPMENGIIRNWADMELLWDYAF-----FEQMKLPTTSGGKVLLTEPPMNPIKNRE 120

Query: 114 NTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVI 173
              +V+FE+Y F   Y A  A    + +        LS                   +V+
Sbjct: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQG-------LSS-----------------GVVV 156

Query: 174 DSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNIK 231
           DSG   + I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  IK
Sbjct: 157 DSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIK 216

Query: 232 ENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILED 289
           E   ++S  +       ++  T VE Y LPD +   +G           PE         
Sbjct: 217 EKLCYVSYDLDLDTKLARETTTLVESYELPDGRVIKVG-----------PER-------- 257

Query: 290 ELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSR 349
             F  PE  F P + +V +PG+ E +  ++      +R+ +   IV +GG+   P   SR
Sbjct: 258 --FEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSR 315

Query: 350 IYTELQK 356
           +  EL++
Sbjct: 316 LEKELKQ 322

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 76/332 (22%), Positives = 137/332 (41%), Gaps = 69/332 (20%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETY---------YLSNQINNIKDIS 53
           A L+IDNGS   K G++  + P     ++  + +++           Y+ ++  + + I 
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI- 64

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENH-LVLTETPMTLPELS 112
            ++++ P + G + +W+   +IW + FYN       E+    E H ++LTE PM      
Sbjct: 65  -LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPMNPKSNR 116

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               Q++FE +   + Y +  A             + L    +T              +V
Sbjct: 117 EKMTQIMFETFNVPAFYVSIQA------------VLSLYSSGRTT------------GIV 152

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNI 230
           +DSG   + ++P+  G      + ++D+ GR L   L + +S R Y    T E  +V +I
Sbjct: 153 LDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDI 212

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVR--DMKKHSTLPEHSQSIILE 288
           KE                    K+ YV  DF+       +   ++K   LP+  Q I + 
Sbjct: 213 KE--------------------KLCYVALDFEQEMQTAAQSSSIEKSYELPD-GQVITIG 251

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLF 320
           +E F  PE  FHP +  +   GI +T   S+ 
Sbjct: 252 NERFRAPEALFHPSVLGLESSGIDQTTYNSIM 283

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 80.5 bits (197), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 84/368 (22%), Positives = 150/368 (40%), Gaps = 65/368 (17%)

Query: 4   APLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI---------- 52
            P+++D G+  +K G + +  P +   + + +        SN    +KDI          
Sbjct: 5   VPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVR 64

Query: 53  SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELS 112
           S + I  P + G + +W    ++WDY FY+       ++   + + ++LTE PM   +  
Sbjct: 65  SYLQISYPMENGIIKNWADMEQLWDYAFYDQ-----MKIPSTAGHKVLLTEPPMNPLKNR 119

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               +V+FE+Y F  +Y A  A    + +        LS                   +V
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQG-------LSS-----------------GVV 155

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNI 230
           +DSG   + I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQI 215

Query: 231 KENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288
           KE   ++S  +        +  T VE Y LPD +   +G                     
Sbjct: 216 KEKLCYVSYDLDLDTKLAHETTTLVETYELPDGRVIKVG--------------------- 254

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
            E F  PE  F P + +V + GI E +  ++      + S +   IV +GG+   P   S
Sbjct: 255 SERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAIVLSGGSSMYPGLPS 314

Query: 349 RIYTELQK 356
           R+  EL++
Sbjct: 315 RLEKELKQ 322

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 126/308 (40%), Gaps = 54/308 (17%)

Query: 53  SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELS 112
           S + I  P + G + +W     +WDY FY+       ++   S   ++LTE PM   +  
Sbjct: 11  SYLQISYPMENGVIKNWSDMELLWDYAFYDQ-----MQLPSTSGGKVMLTEPPMNPVKNR 65

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               +V+FE+Y F  +Y A  A    + +        LS                   +V
Sbjct: 66  EQMCEVMFEKYDFGGVYVAIQAVLALYAQG-------LSS-----------------GVV 101

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESML--VNNI 230
           +DSG   + I+P+ + V      +++D+ GR +   L + +S R Y     +    V  I
Sbjct: 102 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQI 161

Query: 231 KENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288
           KE   ++S  +       ++  T VE Y LPD +   +G                     
Sbjct: 162 KEKLSYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG--------------------- 200

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
            E F  PE  F P + +V +PG+ E +  ++      +RS +   IV +GG+   P   S
Sbjct: 201 SERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPS 260

Query: 349 RIYTELQK 356
           R+  EL++
Sbjct: 261 RLEKELKQ 268

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 83/367 (22%), Positives = 146/367 (39%), Gaps = 65/367 (17%)

Query: 5   PLLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETYYLSNQINNIKDI----------S 53
           P+++D G+  +K G + +  P     ++  +        +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDVRS 65

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSR 113
            + I  P + G + +W     +WDY F     F   ++   S   ++LTE PM   +   
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FDQMKLPTTSNGKILLTEPPMNPVKNRE 120

Query: 114 NTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVI 173
              +V+FE+Y F  +Y A  A    + +        LS                   +V+
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQG-------LSS-----------------GVVV 156

Query: 174 DSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESML--VNNIK 231
           DSG   + I+P+ + V      +++D+ GR +   L + +S R Y     +    V  IK
Sbjct: 157 DSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIK 216

Query: 232 ENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILED 289
           E   ++S  +       ++  T VE Y LPD +   +G                      
Sbjct: 217 EKVCYVSYDLDLDTKLARETTTLVENYELPDGRVIKVG---------------------Q 255

Query: 290 ELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSR 349
           E F  PE  F P + +V + G+ E +  ++      +RS +   IV +GG+   P   SR
Sbjct: 256 ERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAIVLSGGSSMYPGLPSR 315

Query: 350 IYTELQK 356
           +  EL++
Sbjct: 316 LEKELKQ 322

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/367 (23%), Positives = 146/367 (39%), Gaps = 65/367 (17%)

Query: 5   PLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINN-IKDI----------S 53
           P+++D G+  +K G + +  P     ++             IN  +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEASDVRS 65

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSR 113
            + I  P + G + +W     +WDY F+N       ++   S   ++LTE PM   +   
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MQLPTTSGGKILLTEPPMNPVKNRE 120

Query: 114 NTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVI 173
              +V+FE+Y F  +Y A  A    + +        LS                   +V+
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQG-------LSS-----------------GVVV 156

Query: 174 DSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESML--VNNIK 231
           DSG   + I+P+ + V      +++D+ GR +   L + +S R Y     +    V  IK
Sbjct: 157 DSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIK 216

Query: 232 ENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILED 289
           E   ++S  +       ++  T VE Y LPD +   +G                      
Sbjct: 217 EKLCYVSYDLDLDTKLARETTTLVENYELPDGRIIKVG---------------------Q 255

Query: 290 ELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSR 349
           E F  PE  F P + +V + GI E +  ++      +RS +   IV +GG+   P   SR
Sbjct: 256 ERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGLPSR 315

Query: 350 IYTELQK 356
           +  EL++
Sbjct: 316 LEKELKQ 322

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/362 (19%), Positives = 155/362 (42%), Gaps = 58/362 (16%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNI-------KDISSVS 56
           P++IDNG+  +K G+   + P     N +   K++   +    +N+       ++   + 
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFDKVMIGGLDDNMYIGNKAQENRGLLR 69

Query: 57  IKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTD 116
           ++ P + G++  W+    +W +   +  + +  E     E+ +++TE P+   +   +  
Sbjct: 70  LRHPMEHGEVKHWDEMEAVWKHTLLHDLNIQHIE-----EHPILITEAPLNSSKNREHMC 124

Query: 117 QVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSG 176
           +++FE +             IP I  ++ + + L    +T               VID G
Sbjct: 125 EILFESFN------------IPAIHVENPAVLALYSGGRTT------------GCVIDCG 160

Query: 177 YNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMF 236
                 +P+ +G     +++++D+GGR +     E + ++       S+  +N KE    
Sbjct: 161 EGYCSAVPIYEGFALTPSIRRIDIGGREIT----EQLQFQIRKSVGMSLFSSNEKE---- 212

Query: 237 ISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHST---LPEHSQSIILEDELFS 293
                 + + K++A     YV  D       Y+ D + +S+   LP+  +S+ + +  F 
Sbjct: 213 -----IVRTIKERAC----YVADDISKEEHKYILDSESNSSKFKLPD-GKSLSIGNVRFR 262

Query: 294 VPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTE 353
             E  F+P +       + E + ++L  +   LR ++  ++V  GG   +P FG+RI  E
Sbjct: 263 ATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGNRILKE 322

Query: 354 LQ 355
           LQ
Sbjct: 323 LQ 324

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 87/371 (23%), Positives = 152/371 (40%), Gaps = 72/371 (19%)

Query: 5   PLLIDNGSYEIKFGYSNQETPF--------------VALNALAKDKYETYYLSNQINNIK 50
           P+++DNGS  IK G+S +E P               V    LA D   +  + N+   ++
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASD---SQLIGNEAQKMR 67

Query: 51  DISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPE 110
            +  + +  P + G +  W    ++W + FYN       E     E+ +++TE P+  P 
Sbjct: 68  GL--LKLHYPLEHGVVQDWPGLEQLWTHVFYNSLKLANIE-----EHPMLITEAPLN-PM 119

Query: 111 LSRN-TDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDF 169
            +RN   +++FE +G  ++Y                  + +      Y  G      +  
Sbjct: 120 KNRNKMCEMLFETFGSPAVY------------------VSIQAVLALYAGG------RTT 155

Query: 170 NLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESM 225
             VID G  C   +P+  G     A++++D+ GR    FL  LL+++ S      + E  
Sbjct: 156 GCVIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKS-SGVTLSSSSERE 214

Query: 226 LVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSI 285
           +V  IKE   F++     E    +     E      +T F            LP+  + +
Sbjct: 215 IVRMIKEKACFVATDVGNEEQNYEGANSAE-----LETRF-----------KLPD-GKIL 257

Query: 286 ILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPN 345
            L  E F  PE  F P +       I E   +S+  +   LRS + ++IV +GG+     
Sbjct: 258 TLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGSTMFSG 317

Query: 346 FGSRIYTELQK 356
           FG R+ +E++K
Sbjct: 318 FGDRLLSEIRK 328

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 74/308 (24%), Positives = 128/308 (41%), Gaps = 54/308 (17%)

Query: 53  SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELS 112
           S + I  P + G + +W     +WDY FY     +  ++ + S   ++LTE PM   +  
Sbjct: 11  SYLQISYPMENGIIKNWTDMELLWDYAFY-----EQMKLPDTSNGKILLTEPPMNPIKNR 65

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               +V+FE+Y F  +Y A  A    + +        LS                   +V
Sbjct: 66  EKMCEVMFEKYNFGGVYVAIQAVLALYAQG-------LSS-----------------GVV 101

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNI 230
           +DSG   + I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  I
Sbjct: 102 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTADFETVRQI 161

Query: 231 KENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288
           KE   ++S  +       ++  T VE Y LPD +   +G                     
Sbjct: 162 KEKLCYVSYDLDLDTKLARETTTLVESYELPDGRVIKVG--------------------- 200

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
            E F  PE  F P + +V + G+ E +  ++      +RS +   IV +GG+   P   S
Sbjct: 201 SERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLSGGSSMYPGLPS 260

Query: 349 RIYTELQK 356
           R+  EL++
Sbjct: 261 RLEKELKQ 268

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 83/368 (22%), Positives = 150/368 (40%), Gaps = 65/368 (17%)

Query: 4   APLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI---------- 52
           +P+++D G+  +K G + +  P +   + + +        ++    +KDI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEASEVR 64

Query: 53  SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELS 112
           S + I  P + G + +W     +WDY FY     +  ++   S   ++LTE PM   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPMNPLKNR 119

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               +V+FE+Y F  +Y A  A    + +        LS                   +V
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQG-------LSS-----------------GVV 155

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNI 230
           +DSG   + I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 231 KENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288
           KE   ++S  +       ++  T VE Y LPD +   +G                     
Sbjct: 216 KEKLCYVSYDLDLDTRLARETTTLVEKYELPDGRIIKVG--------------------- 254

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
            E F  PE  F P + +V   G+ E +  ++      +RS +   IV +GG+   P   S
Sbjct: 255 QERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGLPS 314

Query: 349 RIYTELQK 356
           R+  EL++
Sbjct: 315 RLEKELKQ 322

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 78/365 (21%), Positives = 156/365 (42%), Gaps = 64/365 (17%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETY---------YLSNQINNIKDISS 54
           P++IDNGS  IK G+S +E P  +  + +   KY+           ++ N+   ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGL-- 71

Query: 55  VSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRN 114
           + ++ P + G +  W+    IW +        +  E     E+ L++TE PM   +    
Sbjct: 72  LRLQYPIEHGVVEDWDSMELIWAHILNEVLQLQNIE-----EHPLLITEAPMNPLKNREV 126

Query: 115 TDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVID 174
             QV+FE +   +LY          + N     +  SG++                 VID
Sbjct: 127 MAQVLFETFNLPALY----------VSNPAVLSLYASGRTT--------------GCVID 162

Query: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESMLVNNI 230
            G      +P+  G     ++ +MD+GGR     L   L+++     +  + E  +V  I
Sbjct: 163 CGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKSAGVSLFS-SSEREIVRTI 221

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDE 290
           KE       V Y+ +  KK            + ++M   +D+     LP+  + I + ++
Sbjct: 222 KEK------VCYLATDIKKE-----------ENTYMQESQDLTSVFKLPD-GKCIEIGND 263

Query: 291 LFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRI 350
            +  PE  F P++      G+ +  ++S++ +   LR+ ++++I+ +GG   +  FG R+
Sbjct: 264 RYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIILSGGTTTLRGFGDRM 323

Query: 351 YTELQ 355
             +L+
Sbjct: 324 LHDLE 328

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 102/426 (23%), Positives = 166/426 (38%), Gaps = 83/426 (19%)

Query: 17  FGYSNQETPFVALNALA------KDKYET----YYLSNQINNIKDISSVSIKRPHQLGQL 66
           FG S   T F +L A A        K  T    +Y+ N+        S S+  P + GQ+
Sbjct: 69  FGNSTSATSFDSLAASALLSNNLAGKRGTEDLDFYIGNEALAASRGPSYSLSYPIRHGQV 128

Query: 67  VSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVFEEYGFD 126
            +W+     W+   +       +   E  ++  +LTE P+  PE      ++ FE +   
Sbjct: 129 ENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 182

Query: 127 SLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNCSWIIPMI 186
            LY          I       +  S  S    D S          VIDSG   + +IP+ 
Sbjct: 183 GLY----------IAVQAVLALAASWTSSKVTDRSLTGT------VIDSGDGVTHVIPVA 226

Query: 187 KGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESMLVNNIK-ENCMFISPVS 241
           +G     A+K + + GR    F+  LL+E       +V         IK E C       
Sbjct: 227 EGYVIGSAIKNIPIAGRDITLFIQSLLRE-----RGEVDTSLRTAERIKQEYC------- 274

Query: 242 YIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHST-LPEHSQS-----IILEDELFSVP 295
                         YV PD    F  + RD  K +  + E+S+S     + +  E F  P
Sbjct: 275 --------------YVCPDIVKEFNKFDRDAGKFAQFIVENSESTKKKIVDVGYERFLAP 320

Query: 296 EGFFHPEMA--NVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTE 353
           E FF+PE+A  + L P +   + +++   P  +R  + NNIV +GG+    +FG R+  +
Sbjct: 321 EIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRD 379

Query: 354 LQKQV-----QTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRV------TKQEY 402
           L+  V     Q+E +        + ++ + +  ++       L   T        TKQ+Y
Sbjct: 380 LKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTAEFKSYCHTKQDY 439

Query: 403 NEHGFE 408
            E+G E
Sbjct: 440 EEYGPE 445

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/362 (20%), Positives = 152/362 (41%), Gaps = 58/362 (16%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETY---------YLSNQINNIKDISS 54
           P++IDNGS  IK G+S +E P  +  + +   KY+           ++ N+   ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 55  VSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRN 114
           + ++ P + G +  W+    IW Y        +  E     E+ L++TE PM   +    
Sbjct: 72  LRLRYPMKHGVVEDWDSMELIWSYVLNEVLQLQNIE-----EHPLLITEAPMNPLKNREM 126

Query: 115 TDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVID 174
             QV+FE +   ++Y +            D + + L    +T               V+D
Sbjct: 127 IAQVMFETFNLSAIYVS------------DPAVLSLYASGRTT------------GCVVD 162

Query: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENC 234
            G      +P+  G     ++ +MD+GG    G + E + ++       S+  ++ +E  
Sbjct: 163 CGEGYCSSVPIYDGFALPASIMRMDIGG----GDITEQLQFQIRKSAGVSLFSSSEREIV 218

Query: 235 MFIS-PVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFS 293
             I   V Y+    KK            +  ++   +D+     LP+  +SI + ++ + 
Sbjct: 219 RTIKEKVCYLAKDAKKE-----------EDKYLQGTQDLISAFKLPD-GKSIEVGNDRYR 266

Query: 294 VPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTE 353
            PE  F P++      G+    ++S++ +   LR  ++++++ +GG   +  FG R+  +
Sbjct: 267 APEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILSGGTTTLKGFGDRMLHD 326

Query: 354 LQ 355
           L+
Sbjct: 327 LE 328

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 89/379 (23%), Positives = 151/379 (39%), Gaps = 70/379 (18%)

Query: 10  NGSYEIKFGYSNQETPFVAL--------NALAKDKYE---TYYLSNQINNIKDISSVSIK 58
           +GS    FG S   T F +L        N LA  +      +Y+ N+        S  + 
Sbjct: 66  SGSGRQYFGNSTSATAFNSLSSGSALMSNNLAGKRGTEDLDFYIGNEALIAAQGPSYGLS 125

Query: 59  RPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQV 118
            P + GQ+ +W+     W+   +       +   E  ++  +LTE P+  PE      ++
Sbjct: 126 YPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHCFLLTEPPLNPPENREQVAEI 179

Query: 119 VFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYN 178
            FE +    LY          I       +  S  S   +D S          VIDSG  
Sbjct: 180 FFESFNCAGLY----------IAVQAVLALAASWTSSKVIDRSLTGT------VIDSGDG 223

Query: 179 CSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFIS 238
            + +IP+ +G     A+K + + GR +   +++ +  R  + T         +E C    
Sbjct: 224 VTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLLRERGEEDTSLRTAERIKQEYC---- 279

Query: 239 PVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQS------IILEDELF 292
                            YV PD    F  + RD +K +     SQ       + +  E F
Sbjct: 280 -----------------YVCPDIVKEFNKFDRDSEKFAQFVVESQEKTRRKVVDVGCERF 322

Query: 293 SVPEGFFHPEMA--NVLKPGIIETILE-SLFILPESLRSLMVNNIVCTGGNFNIPNFGSR 349
             PE FF+PE+A  + L P  + TI++ ++   P  +R  + NNIV +GG+    +FG R
Sbjct: 323 MAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRR 380

Query: 350 IYTELQ-----KQVQTEWV 363
           +  +L+     + VQ+E++
Sbjct: 381 LQRDLKSIVNNRIVQSEYL 399

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 85/388 (21%), Positives = 150/388 (38%), Gaps = 63/388 (16%)

Query: 40  YYLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL 99
           +Y+ N+        S S+  P + GQ+ +W+     W+   +       +   E  ++  
Sbjct: 100 FYIGNEALAAAQGQSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 153

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE P+  PE      ++ FE +    LY          I       +  S  S    D
Sbjct: 154 LLTEPPLNPPENREQVAEIFFESFNCAGLY----------IAVQAVLALAASWTSPKVTD 203

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD 219
            S          VIDSG   + +IP+ +G     A+K + + GR +   +++ +  R   
Sbjct: 204 RSLTGT------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLLRERGEQ 257

Query: 220 VTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLP 279
            T         +E C                     YV PD    F  + RD  K +   
Sbjct: 258 DTSLKTAERIKQEYC---------------------YVCPDIVKEFNKFDRDASKFAQFV 296

Query: 280 EHSQS------IILEDELFSVPEGFFHPEMA--NVLKPGIIETILESLFILPESLRSLMV 331
             SQ       + +  E F  PE FF+PE+A  + L P +   + E++   P  +R  + 
Sbjct: 297 VESQEKTRKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLY 355

Query: 332 NNIVCTGGNFNIPNFGSRIYTELQKQV-----QTEWVCDVSIPKANAELQNWKAMKSFTE 386
           NNIV +GG+    +FG R+  +++  V     Q+E +        + ++ + +  ++   
Sbjct: 356 NNIVLSGGSTMFKDFGRRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAVW 415

Query: 387 NNEELYKHTRV------TKQEYNEHGFE 408
               L   T        TK++Y+E+G E
Sbjct: 416 FGGSLLAQTAEFKSYCHTKKDYDEYGPE 443

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 81/368 (22%), Positives = 146/368 (39%), Gaps = 65/368 (17%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQIN-NIKDI---------- 52
           +P+++D G+  +K G + +  P     ++             +N  +KD+          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64

Query: 53  SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELS 112
           S + I  P + G + +W     +WDY FY     +  ++   S   ++LTE P+   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPLNPLKNR 119

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
               +V+FE+Y F  +Y A  A    + +   +                         +V
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS------------------------GVV 155

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNI 230
           IDSG   + I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  I
Sbjct: 156 IDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 231 KENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288
           KE   ++S  +       ++  T VE Y LPD +   +G                     
Sbjct: 216 KEKLCYVSYDLELDTKLARETTTLVENYELPDGRVIKVG--------------------- 254

Query: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348
            E F   E  F P + +V   G+ E +  ++      +RS +   IV +GG+   P   S
Sbjct: 255 QERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPS 314

Query: 349 RIYTELQK 356
           RI  EL++
Sbjct: 315 RIEKELKQ 322

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 79/378 (20%), Positives = 159/378 (42%), Gaps = 66/378 (17%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETY---------YLSNQINNIKDISS 54
           P++IDNGS  IK G+S +E P  +  + +   KYE           ++ N+   ++ +  
Sbjct: 14  PIVIDNGSGIIKVGFSGEERPKALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 55  VSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRN 114
           + ++ P   G +  W+    IW Y        +  E     E+ L++TE PM   +    
Sbjct: 72  LRLRYPMTHGVVEDWDSMELIWSYMLNEVLQLQNIE-----EHPLLITEAPMNPLKNREV 126

Query: 115 TDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVID 174
             QV+FE +   +LY          I N     +  SG++                 V+D
Sbjct: 127 MAQVLFETFNLPALY----------ISNPAVLSLYASGRTT--------------GCVVD 162

Query: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESMLVNNI 230
            G      +P+  G     ++ +MD+GGR     L   L+++     +  + E  +V  I
Sbjct: 163 CGEGYCSTVPIYDGFALPASIMRMDIGGRDITEQLQFQLRKSAGISLFS-SSELEVVRMI 221

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDE 290
           KE   +++     ++ KK+            +  ++    D+     LP+  + I + ++
Sbjct: 222 KEKVCYLA-----KNIKKE------------EDRYLQGHHDLGSVFKLPD-GKCIEIGND 263

Query: 291 LFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRI 350
            +  PE  F P++      G+ +  ++S++ +   LR  ++++I+ +GG   +  FG R+
Sbjct: 264 RYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILSGGTTTLRGFGERM 323

Query: 351 YTELQKQVQTEWVCDVSI 368
             +L  +  ++  C + I
Sbjct: 324 LHDL--EALSKGTCKIKI 339

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 79/367 (21%), Positives = 159/367 (43%), Gaps = 58/367 (15%)

Query: 5   PLLIDNGSYEIKFGYSNQETPFVALNALA-KDKY---------ETYYLSNQINNIKDISS 54
           P+++DNGS  +K G+S  ETP +    +A K +Y         +  ++ N+   ++    
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLR--GL 70

Query: 55  VSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRN 114
           ++++RP   G++ +W+    +W + FY+     G   ++  ++ L++TE P+   +    
Sbjct: 71  LALRRPISRGEVTNWDDMELLWSHIFYSKLQL-GQGNSQIGDHPLLITEAPLNSTKNRET 129

Query: 115 TDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVID 174
             ++++E + FD+LY A  A                      Y  G      Q    V++
Sbjct: 130 MCEILYETFNFDALYVAHPAVL------------------SLYATG------QTTGCVLE 165

Query: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENC 234
            G   S   P+ +G     +++++D+GGR +     + + +     T  S+  N+ +E  
Sbjct: 166 CGEGYSASTPVYQGFALPSSIRRIDIGGRDIT----QELQFYIRKSTGLSLFSNSEQE-- 219

Query: 235 MFISPVSYIESFKKKALTKVEYVLPDF---QTSFMGYVRDMKKHSTLPEHSQSIILEDEL 291
                   + + K+KA     YV  D+   +  F  + R+      LP+  Q +      
Sbjct: 220 -------IVRTIKEKA----NYVALDYKFEEEKFFIHERENTSTVKLPD-GQELTFGKGK 267

Query: 292 FSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIY 351
           +   E  F P++       + E +LES+  +   LR+ ++ NIV +GG   +  F  R  
Sbjct: 268 YRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLLENIVLSGGTTMLKGFDQRTM 327

Query: 352 TELQKQV 358
           +E +K +
Sbjct: 328 SETKKML 334

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 88/368 (23%), Positives = 151/368 (41%), Gaps = 69/368 (18%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDISS--------V 55
           P++IDNG+  IK G++ +  P  +  + +   KY+    SN I +   I +        +
Sbjct: 14  PIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGIL 73

Query: 56  SIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNT 115
            ++ P   G + +W+    IW Y F   DD    E    +E+ +++TE P+      +  
Sbjct: 74  KLRHPMLRGVVQNWDDMETIWQYVF---DDTLYLE--NLNEHPILITEPPLNNMANRQKM 128

Query: 116 DQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDS 175
            + +FE +GF ++Y                  I +S     Y  G      Q     +D 
Sbjct: 129 CEALFEIFGFPAVY------------------ISVSPVLSLYASG------QTTGCAVDC 164

Query: 176 GYNCSWIIPMIKGVPYYKAVKKMDMGG-----RFLNGLLKETISYRHYDVTDESMLVNNI 230
           G      IP+  G     +VKK+D+GG     +    +LK T  + +   + E  +V  I
Sbjct: 165 GDGYCTSIPVYNGFSLASSVKKIDIGGCDITEQLQFSILKNTGLFMY--SSSEREIVRTI 222

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHST---LPEHSQSIIL 287
           KE                    KV Y+  D+      Y+ + +K ++   LP+     I 
Sbjct: 223 KE--------------------KVCYIATDYNLETEKYLFNEEKMASQFKLPDGKMLNIS 262

Query: 288 EDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFG 347
           + + ++  E  F PE+       + E   +S+  +   LR  + +NIV +GG    P FG
Sbjct: 263 QGK-YTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIVLSGGTTMCPGFG 321

Query: 348 SRIYTELQ 355
           SR+  ELQ
Sbjct: 322 SRLLKELQ 329

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 91/365 (24%), Positives = 147/365 (40%), Gaps = 72/365 (19%)

Query: 17  FGYSNQETPFVALNA-------LAKDKYE---TYYLSNQINNIKDISSVSIKRPHQLGQL 66
           FG S   T F +LNA       LA  +      +Y+ N+        S S+  P + GQ+
Sbjct: 62  FGNSTSATSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSYSLSYPIRHGQI 121

Query: 67  VSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVFEEYGFD 126
            +W+     W+   +       +   E  ++  +LTE P+  PE      ++ FE +   
Sbjct: 122 ENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 175

Query: 127 SLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNCSWIIPMI 186
            LY          I       +  S  S    D S          VIDSG   + +IP+ 
Sbjct: 176 GLY----------IAVQAVLALAASWTSSKVTDRSLTGT------VIDSGDGVTHVIPVA 219

Query: 187 KGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESMLVNNIKENCMFISPVSY 242
           +G     A+K + + GR    F+  LL+E         TD S+                 
Sbjct: 220 EGYVIGSAIKNIPIAGRDITLFIQSLLRER------GETDTSLRT--------------- 258

Query: 243 IESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTL----PEHSQSIILED--ELFSVPE 296
            E  K++      YV PD    F  + R+  K +       E +Q  I++   E F  PE
Sbjct: 259 AERIKQEYC----YVCPDIVKEFNKFDRNPDKFAQFIVENQEKTQKKIVDVGYERFLAPE 314

Query: 297 GFFHPEMA--NVLKPGIIETILE-SLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTE 353
            FF+PE+A  + L P  + TI++ ++   P  +R  + NNIV +GG+    +FG R+  +
Sbjct: 315 IFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRD 372

Query: 354 LQKQV 358
           ++  V
Sbjct: 373 IKSIV 377

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 95/424 (22%), Positives = 164/424 (38%), Gaps = 73/424 (17%)

Query: 10  NGSYEIKFGYSNQETPFVALNALAKDKYET--YYLSNQINNIKDISSVSIKRPHQLGQLV 67
           N +    F  +N  +  ++ N   K   E   +Y+ N+        S S+  P + GQ+ 
Sbjct: 68  NSTSATSFNDNNLSSMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSYSLSYPIRHGQVE 127

Query: 68  SWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVFEEYGFDS 127
           +W+     W+   +       +   E  ++  +LTE P+  PE      ++ FE +    
Sbjct: 128 NWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQIAEIFFESFNCAG 181

Query: 128 LYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNCSWIIPMIK 187
           LY          I       +  S  S    D S          VIDSG   + +IP+ +
Sbjct: 182 LY----------IAVQAVLALAASWTSSKVTDRSLTGT------VIDSGDGVTHVIPVAE 225

Query: 188 GVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESMLVNNIKENCMFISPVSYI 243
           G     A+K + + GR    F+  LL+E         T E +     +E C         
Sbjct: 226 GYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSLRTAERIK----QEYC--------- 272

Query: 244 ESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQS------IILEDELFSVPEG 297
                       YV PD    F  + RD +K +     +Q       + +  E F  PE 
Sbjct: 273 ------------YVCPDIVKEFNKFDRDGEKFAQFVVENQESTRKKIVDVGYERFLAPEI 320

Query: 298 FFHPEMA--NVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQ 355
           FF+PE+A  + L P +   + +++   P  +R  + NNIV +GG+    +FG R+  +L+
Sbjct: 321 FFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLK 379

Query: 356 KQV-----QTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRV------TKQEYNE 404
             V     Q+E +        N ++ + +  ++       L   T        TK++Y+E
Sbjct: 380 GIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDYDE 439

Query: 405 HGFE 408
           +G E
Sbjct: 440 YGPE 443

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 80/333 (24%), Positives = 134/333 (40%), Gaps = 64/333 (19%)

Query: 40  YYLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL 99
           +Y+ N+       ++ S+  P + GQ+ +W+     W+   +       +   E  ++  
Sbjct: 107 FYIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 160

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE P+  PE      ++ FE +    LY          I       +  S  S   +D
Sbjct: 161 LLTEPPLNPPENREQVAEIFFESFNCAGLY----------IAVQAVLALAASWTSSKVVD 210

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISY 215
            S          VIDSG   + +IP+ +G     A+K + + GR    F+  LL+E    
Sbjct: 211 RSLTGT------VIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLLRE---- 260

Query: 216 RHYDVTDESMLVNNIK-ENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKK 274
              +V         IK E C                     YV PD    F  + RD +K
Sbjct: 261 -RGEVDTSLRTAERIKQEYC---------------------YVCPDIVKEFNKFDRDAEK 298

Query: 275 HSTLPEHSQS------IILEDELFSVPEGFFHPEMA--NVLKPGIIETIL-ESLFILPES 325
            +     +Q       + +  E F  PE FF+PE+A  + L P  + T+L +++   P  
Sbjct: 299 FAQYVVENQDKTRQKVVDIGYERFLAPEIFFNPEIASSDFLTP--LPTVLDQTIQACPID 356

Query: 326 LRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQV 358
           +R  + NNIV +GG+    +FG R+  +L+  V
Sbjct: 357 VRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIV 389

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 82/369 (22%), Positives = 152/369 (41%), Gaps = 66/369 (17%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQ-----INNIKD--ISSVS 56
           P+++DNGS  +K G+   + P     + +   KY+   +        + N+       + 
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGLLK 72

Query: 57  IKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTD 116
           ++ P   G + +WE    +WD+ F +       +V+   E+ LV+TE P+          
Sbjct: 73  LRYPMDHGIIENWEHMETVWDHIFKDC-----LKVSNLGEHPLVVTEAPLNPKPNREKMC 127

Query: 117 QVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSG 176
           + +FE +   +LY A  A             + L    +T               V+++G
Sbjct: 128 ETLFESFNIPALYIANPA------------VLSLYASGRTT------------GCVVEAG 163

Query: 177 YNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESMLVNNIKE 232
                 +P+ +G     +++++D+GGR     L   L+++     Y  + E  +V  IKE
Sbjct: 164 DGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQLQLRKSTGMWLYS-SSEQEIVRLIKE 222

Query: 233 NCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHST---LPEHSQSIILED 289
           N        YI S  KK   K              ++ D +K S    LP+  +++++  
Sbjct: 223 NG------CYICSNHKKEEEK--------------FLLDQEKKSISFKLPD-GKNLVIGP 261

Query: 290 ELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSR 349
             F  PE  F+P +       + + I++S+  +   LRS ++NNI  +GG+     F  R
Sbjct: 262 GRFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNITLSGGSTMFQGFCDR 321

Query: 350 IYTELQKQV 358
           + TEL   V
Sbjct: 322 LITELDFSV 330

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 80/332 (24%), Positives = 129/332 (38%), Gaps = 62/332 (18%)

Query: 40  YYLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL 99
           +Y+ N+        S S+  P + GQ+  W      W+   +       +   E  ++  
Sbjct: 101 FYIGNEALAAAQGPSYSLSYPIRHGQVEDWNHMERFWENSIFK------YLRTEPEDHFF 154

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE P+  PE      ++ FE +    LY          I       +  S  S    D
Sbjct: 155 LLTEPPLNPPENREQVAEIFFESFNCAGLY----------IAVQAVLALAASWTSSKVTD 204

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISY 215
            S          VIDSG   + +IP+ +G     A+K + + GR    F+  LL+E    
Sbjct: 205 RSLTGT------VIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLLRE---- 254

Query: 216 RHYDVTDESMLVNNIK-ENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKK 274
              +V         IK E C                     YV PD    F  + RD  K
Sbjct: 255 -RGEVDTSLRTAERIKQEYC---------------------YVCPDIVKEFNKFDRDATK 292

Query: 275 HSTL----PEHSQSIILED--ELFSVPEGFFHPEMA--NVLKPGIIETILESLFILPESL 326
            +       E +Q  +++   E F  PE FF+PE+A  + L P +   + +++   P  +
Sbjct: 293 FAQFIVENKEKTQKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDV 351

Query: 327 RSLMVNNIVCTGGNFNIPNFGSRIYTELQKQV 358
           R  + NNIV +GG+    +FG R+  +L+  V
Sbjct: 352 RKGLYNNIVLSGGSTMFKDFGRRLQRDLRSIV 383

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 133/328 (40%), Gaps = 54/328 (16%)

Query: 40  YYLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL 99
           +Y+ N+       +S S+  P + GQ+ +W+     W+   +       +   E  ++  
Sbjct: 99  FYIGNEALIASQGASYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 152

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE P+  PE      ++ FE +    LY          I       +  S  S   +D
Sbjct: 153 LLTEPPLNPPENREQIAEIFFESFNCAGLY----------IAVQAVLALAASWTSSKVVD 202

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD 219
            S          VIDSG   + +IP+ +G     A+K + + GR +   ++  +  R   
Sbjct: 203 RSLTGT------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLLRERGEA 256

Query: 220 VTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTL- 278
            T         +E C                     YV PD    F  + RD +K +   
Sbjct: 257 DTSLRTAERIKQEYC---------------------YVCPDIVKEFNKFDRDPEKFAQYV 295

Query: 279 ---PEHSQSIILED--ELFSVPEGFFHPEMA--NVLKPGIIETIL-ESLFILPESLRSLM 330
               E +Q  +++   E F  PE FF+PE+A  + L P  + TI+ +++   P  +R  +
Sbjct: 296 VENQEKTQKKVVDVGYERFLAPEIFFNPEIASSDFLTP--LPTIVDQTIQACPIDVRKGL 353

Query: 331 VNNIVCTGGNFNIPNFGSRIYTELQKQV 358
            NNIV +GG+    +FG R+  +L+  V
Sbjct: 354 YNNIVLSGGSTMFKDFGRRLQRDLKSIV 381

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/365 (20%), Positives = 155/365 (42%), Gaps = 64/365 (17%)

Query: 5   PLLIDNGSYEIKFGYSNQETPFVALNALAKD-KYETY---------YLSNQINNIKDISS 54
           P++IDNGS  IK G+S +E P      L  + KY+           ++ N    ++ +  
Sbjct: 14  PVVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL-- 71

Query: 55  VSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRN 114
           + ++ P + G +  W+    IW Y        +  ++    E+ L++TE PM   +    
Sbjct: 72  LKLRYPIKHGVVEDWDSMELIWSYVLN-----EVLQLQNIGEHPLLITEAPMNPLKNREQ 126

Query: 115 TDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVID 174
             QV+FE +   +LY          + N     +  SG++                 V+D
Sbjct: 127 MAQVLFETFDVSALY----------VSNPAVLSLYASGRTT--------------GCVVD 162

Query: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGG----RFLNGLLKETISYRHYDVTDESMLVNNI 230
            G      +P+  G     ++ +MD+GG      L   L+++     +  + E  +V  +
Sbjct: 163 CGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFS-SSEREIVRTM 221

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDE 290
           KE   +++     ++ KK+            +  ++   +D+     LP+  + I + ++
Sbjct: 222 KEKVCYLA-----KNIKKE------------EEKYLQGTQDLISTFKLPD-GRCIEVGND 263

Query: 291 LFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRI 350
            +  PE  F P++  +   G+ +  ++S++ +   LR  ++++I+ +GG   +  FG R+
Sbjct: 264 RYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRM 323

Query: 351 YTELQ 355
             +L+
Sbjct: 324 LWDLE 328

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 78/331 (23%), Positives = 130/331 (39%), Gaps = 60/331 (18%)

Query: 40  YYLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL 99
           +Y+ N+        S S+  P + GQ+ +W+     W+   +       +   E  ++  
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 148

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE P+  PE      ++ FE +    LY          I       +  S  S    D
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLY----------IAVQAVLALAASWTSSKVTD 198

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISY 215
            S          VIDSG   + +IP+ +G     A+K + + GR    F+  LL+E    
Sbjct: 199 RSLTGT------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA 252

Query: 216 RHYDVTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKH 275
                T E +     +E C                     YV PD    F  + RD  K 
Sbjct: 253 DTSLRTAEKIK----QEYC---------------------YVCPDIVKEFNKFDRDPSKF 287

Query: 276 STLPEHSQ------SIILEDELFSVPEGFFHPEMA--NVLKPGIIETILESLFILPESLR 327
           +     +Q      ++ +  E F  PE FF+PE+A  + L P +   + +++   P  +R
Sbjct: 288 AQFVVENQEKTRRKAVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVR 346

Query: 328 SLMVNNIVCTGGNFNIPNFGSRIYTELQKQV 358
             + NNIV +GG+    +FG R+  +L+  V
Sbjct: 347 KGLYNNIVLSGGSTMFKDFGRRLQRDLKSIV 377

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 93/392 (23%), Positives = 154/392 (39%), Gaps = 75/392 (19%)

Query: 40  YYLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL 99
           +Y+ N+        S S+  P + GQ+ +W+     W+   +       +   E  ++  
Sbjct: 102 FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 155

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE P+  PE  +   ++ FE +    LY          I       +  S  S    D
Sbjct: 156 LLTEPPLNPPENRQQVAEIFFESFNCAGLY----------IAVQAVLALAASWTSSKVTD 205

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISY 215
            S          VIDSG   + +IP+ +G     A+K + + GR    F+  LL+E    
Sbjct: 206 RSLTGT------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEQ 259

Query: 216 RHYDVTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKH 275
                T E +     +E C                     YV PD    F  + RD +K 
Sbjct: 260 DASLRTAERIK----QEYC---------------------YVCPDIVKEFNKFDRDSEKF 294

Query: 276 STL----PEHSQSIILED--ELFSVPEGFFHPEMA--NVLKPGIIETILESLFILPESLR 327
           +       E +   +++   E F  PE FF+PE+A  + L P +   + E++   P  +R
Sbjct: 295 AQFIVENKERTTKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPVVVDETIQACPIDVR 353

Query: 328 SLMVNNIVCTGGNFNIPNFGSRIYTELQKQV-----QTEWV-------CDVSIPKANAEL 375
             + NNIV +GG+    +FG R+  +L+  V     Q+E +        DVS+     + 
Sbjct: 354 KGLYNNIVLSGGSTMFKDFGRRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQR 413

Query: 376 QN-WKAMKSFTENNEELYKHTRVTKQEYNEHG 406
              W       +  E  +K    TKQ+Y E+G
Sbjct: 414 NAVWFGGSLLAQTGE--FKSYCHTKQDYEEYG 443

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 84/368 (22%), Positives = 140/368 (38%), Gaps = 63/368 (17%)

Query: 10  NGSYEIKFGYSNQETPFVAL--------NALAKDKYE---TYYLSNQINNIKDISSVSIK 58
           NGS    FG S   T F  L        N LA  +      +Y+ N+        S S+ 
Sbjct: 63  NGSSNPYFGNSTSATNFGGLTGGKMLLSNNLAGKRGTEDLDFYIGNEALVAAQSPSYSLS 122

Query: 59  RPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQV 118
            P + GQ+ +W+     W+   +       +   E  +++ +LTE P+  PE      ++
Sbjct: 123 YPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYFLLTEPPLNPPENREQVAEI 176

Query: 119 VFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYN 178
            FE +    LY          I       +  S  S   +D S          VIDSG  
Sbjct: 177 FFESFNCAGLY----------IAVQAVLALAASWTSSKVIDRSLTGT------VIDSGDG 220

Query: 179 CSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFIS 238
            + +IP+ +G     A+K + + GR +   ++  +  R    T         +E C    
Sbjct: 221 VTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLLRERGEADTSLRTAERIKQEYC---- 276

Query: 239 PVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQS------IILEDELF 292
                            YV PD    F  + R  +K +     SQ       + +  E F
Sbjct: 277 -----------------YVCPDIVKEFNKFDRQPEKFAQFIVESQEKTKQKVVDVGYERF 319

Query: 293 SVPEGFFHPEMA--NVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRI 350
             PE FF+PE+A  + L P +   + +++   P  +R  + NNIV +GG+    +F  R+
Sbjct: 320 LAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRL 378

Query: 351 YTELQKQV 358
             +++  V
Sbjct: 379 QRDMKSIV 386

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 81/374 (21%), Positives = 153/374 (40%), Gaps = 72/374 (19%)

Query: 5   PLLIDNGSYEIKFGYSNQETP----FVALNALAKDKYETYYLSNQINNI-----KDISSV 55
           P+++DNGS  IK G+S +E P    +  +     DK     LS++   +     K    +
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 56  SIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNT 115
            ++ P + G +  W    ++W + FY+       ++N   ++ +++TE P+   E     
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYSS-----LKLNNIGDHPMLVTEAPLNPLENRDKM 125

Query: 116 DQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDS 175
            ++++E +   ++Y                  + +      Y  G      +    VID 
Sbjct: 126 CEMLYETFNVPAVY------------------VSIQAVLALYAGG------RTTGCVIDC 161

Query: 176 GYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESMLVNNIK 231
           G  C   +P+  G     A++++D+ GR    FL  LL+++I       + E  +V  IK
Sbjct: 162 GDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLS-SSEREIVRMIK 220

Query: 232 ENCMFISP------VSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSI 285
           E   +++P        Y  S   + LTK  + LPD +   +G                  
Sbjct: 221 EKACYVAPEVAAEEQKYASSRGSEELTK--FKLPDGKILSLGA----------------- 261

Query: 286 ILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPN 345
               E F  PE  F P++       I +   +S+  +   LRS + +++V +GG+     
Sbjct: 262 ----EKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSLVLSGGSTLFAG 317

Query: 346 FGSRIYTELQKQVQ 359
           FG R+  EL+ + +
Sbjct: 318 FGDRLLNELRSRCE 331

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 78/331 (23%), Positives = 129/331 (38%), Gaps = 60/331 (18%)

Query: 40  YYLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL 99
           +Y+ N+        S S+  P + GQ+ +W+     W+   +       +   E  ++  
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 148

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE P+  PE      ++ FE +    LY          I       +  S  S    D
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLY----------IAVQAVLALAASWTSSKVTD 198

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISY 215
            S          VIDSG   + +IP+ +G     A+K + + GR    F+  LL+E    
Sbjct: 199 RSLTGT------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA 252

Query: 216 RHYDVTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKH 275
                T E +     +E C                     YV PD    F  + RD  K 
Sbjct: 253 DTSLRTAEKIK----QEYC---------------------YVCPDIVKEFNKFDRDPSKF 287

Query: 276 STLPEHSQS------IILEDELFSVPEGFFHPEMA--NVLKPGIIETILESLFILPESLR 327
           +     +Q       + +  E F  PE FF+PE+A  + L P +   + +++   P  +R
Sbjct: 288 AQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVR 346

Query: 328 SLMVNNIVCTGGNFNIPNFGSRIYTELQKQV 358
             + NNIV +GG+    +FG R+  +L+  V
Sbjct: 347 KGLYNNIVLSGGSTMFKDFGRRLQRDLKSIV 377

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 78/334 (23%), Positives = 130/334 (38%), Gaps = 60/334 (17%)

Query: 40  YYLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL 99
           +Y+ N+        S S+  P + GQ+ +W+     W+   +       +   E  ++  
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 148

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE P+  PE      ++ FE +    LY          I       +  S  S    D
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLY----------IAVQAVLALAASWTSSKVTD 198

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISY 215
            S          VIDSG   + +IP+ +G     A+K + + GR    F+  LL+E    
Sbjct: 199 RSLTGT------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA 252

Query: 216 RHYDVTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKH 275
                T E +     +E C                     YV PD    F  + RD  K 
Sbjct: 253 DTSLRTAEKIK----QEYC---------------------YVCPDIVKEFNKFDRDPSKF 287

Query: 276 STLPEHSQS------IILEDELFSVPEGFFHPEMA--NVLKPGIIETILESLFILPESLR 327
           +     +Q       + +  E F  PE FF+PE+A  + L P +   + +++   P  +R
Sbjct: 288 AQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVR 346

Query: 328 SLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQTE 361
             + NNIV +GG+    +FG R+  +L+  V + 
Sbjct: 347 KGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNSR 380

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 82/374 (21%), Positives = 153/374 (40%), Gaps = 75/374 (20%)

Query: 5   PLLIDNGSYEIKFGYSNQETPFV-----ALNALAKDKYETY-----YLSNQINNIKDISS 54
           P+++DNGS  IK G++  + P V       N LA+    T      Y+ N     +  ++
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERR--AT 69

Query: 55  VSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRN 114
           + ++ P+    ++SW+   ++WDY   N       E+ +  E+ +VLT +  T  +    
Sbjct: 70  LHLESPYSTNAIMSWDRLEDLWDYVLLNK-----LEIEQLQEHPVVLTNSMSTSKKEEEK 124

Query: 115 TDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVID 174
             +V+FE++             IP I    +  + L G  +T                + 
Sbjct: 125 MCEVLFEKFS------------IPAIYCSRDPIMSLYGLGRTT------------GCSVS 160

Query: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDES---MLVNNIK 231
            G+    I  +I G+    + +  + GG  +   + + + + H  + +      L+ +IK
Sbjct: 161 CGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIELIRSIK 220

Query: 232 ENCMFISPVSYIESFKKKALTKV----EYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIIL 287
           E C  +S   Y E    + +T      +Y LPD     +G                    
Sbjct: 221 ERCCVLSKDFYNEIRAYELITSKTSNNKYRLPDGNIIEIG-------------------- 260

Query: 288 EDELFSVPEGFFHPEMANVLKPGIIETILESLF---ILPESLRSLMVNNIVCTGGNFNIP 344
             E F  PE  F+P+     +  + + I+ S+    ILP   RS ++ +IV +GG+  I 
Sbjct: 261 -SERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILP---RSQLLESIVLSGGSSLIK 316

Query: 345 NFGSRIYTELQKQV 358
            FG R+  E++K++
Sbjct: 317 GFGERLTKEIRKEI 330

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 84/360 (23%), Positives = 142/360 (39%), Gaps = 62/360 (17%)

Query: 17  FGYSNQETPFVALNALA------KDKYET----YYLSNQINNIKDISSVSIKRPHQLGQL 66
           FG S   T F +L + A        K  T    +Y+ N+        S S+  P + GQ+
Sbjct: 64  FGNSTSATSFNSLASAALLSNNLAGKRGTEDLDFYIGNEALAASQGPSYSLSYPIRHGQV 123

Query: 67  VSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVFEEYGFD 126
            +W+     W+   +       +   E  ++  +LTE P+  PE      ++ FE +   
Sbjct: 124 ENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 177

Query: 127 SLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNCSWIIPMI 186
            LY          I       +  S  S   +D S          VIDSG   + +IP+ 
Sbjct: 178 GLY----------IAVQAVLALAASWTSSKVVDRSLTGT------VIDSGDGVTHVIPVA 221

Query: 187 KGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFISPVSYIESF 246
           +G     A+K + + GR +   ++  +  R  + T         +E C            
Sbjct: 222 EGYVIGSAIKNIPIAGRDITLFIQSLLRERGEEDTTLRTAERIKQEYC------------ 269

Query: 247 KKKALTKVEYVLPDFQTSFMGYVRDMKKHST-LPEHSQS-----IILEDELFSVPEGFFH 300
                    YV  D    F  + RD +K +  + E+S+      I +  E F  PE FF+
Sbjct: 270 ---------YVCSDIVKEFNKFDRDPQKFAQFIVENSEKTKRKVIDVGYERFLAPEIFFN 320

Query: 301 PEMA--NVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQV 358
           PE+A  + L P +   + +++   P  +R  + NNIV +GG+    +FG R+  +L+  V
Sbjct: 321 PEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKGIV 379

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 91/373 (24%), Positives = 145/373 (38%), Gaps = 74/373 (19%)

Query: 10  NGSYEIKFGYSNQETPFVALNA-------LAKDKYE---TYYLSNQINNIKDISSVSIKR 59
           N S    FG S   T F  LN        LA  +      +Y+ N+        S S+  
Sbjct: 68  NSSATPYFGNSTSATSFNNLNKNMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSYSLSY 127

Query: 60  PHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVV 119
           P + GQ+ +W+     W+   +       +   E  ++  +LTE P+  PE      ++ 
Sbjct: 128 PIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFFLLTEPPLNPPENREQIAEIF 181

Query: 120 FEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNC 179
           FE +    LY          I       +  S  S    D S          VIDSG   
Sbjct: 182 FESFNCAGLY----------IAVQAVLALAASWTSSKVTDRSLTGT------VIDSGDGV 225

Query: 180 SWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESMLVNNIK-ENC 234
           + +IP+ +G     A+K + + GR    F+  LL+E       +V         IK E C
Sbjct: 226 THVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRE-----RGEVDTSLKTAERIKQEYC 280

Query: 235 MFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTL----PEHSQSIILED- 289
                                YV PD    F  + RD  K +       E ++  +++  
Sbjct: 281 ---------------------YVCPDIVKEFNKFDRDGSKFAQFIVENQEQTRKKVVDVG 319

Query: 290 -ELFSVPEGFFHPEMA--NVLKPGIIETILE-SLFILPESLRSLMVNNIVCTGGNFNIPN 345
            E F  PE FF+PE+A  + L P  + T+++ ++   P  +R  + NNIV +GG+    +
Sbjct: 320 YERFLAPEIFFNPEIASSDFLTP--LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKD 377

Query: 346 FGSRIYTELQKQV 358
           FG R+  +L+  V
Sbjct: 378 FGRRLQRDLKSIV 390

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 90/394 (22%), Positives = 153/394 (38%), Gaps = 75/394 (19%)

Query: 40  YYLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL 99
           +Y+ N+        + S+  P + GQ+ +W      W+   +       +   E  ++  
Sbjct: 104 FYIGNEALTAAQGPAYSLSYPIKHGQVENWNHMERFWENSIFK------YLRTEPEDHFF 157

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE P+  PE      ++ FE +    LY          I       +  S  S    D
Sbjct: 158 LLTEPPLNPPENREQVAEIFFESFNCAGLY----------IAVQAVLALAASWTSSKVTD 207

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISY 215
            S          VIDSG   + +IP+ +G     A+K + + GR    F+  LL+E    
Sbjct: 208 RSLTGT------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRE---- 257

Query: 216 RHYDVTDESMLVNNIK-ENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKK 274
              +V         IK E C                     YV PD    F  + RD+ K
Sbjct: 258 -RGEVDTSLKTAERIKQEYC---------------------YVCPDIVKEFNKFDRDVGK 295

Query: 275 HSTLPEHSQS------IILEDELFSVPEGFFHPEMA--NVLKPGIIETILE-SLFILPES 325
            S     +Q       + +  E F  PE FF+PE+A  + L P  + TI++ ++   P  
Sbjct: 296 FSQFIIENQGKTQKKIVDVGYERFLAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPID 353

Query: 326 LRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQV-----QTEWVCDVSIPKANAELQNWKA 380
           +R  + +NIV +GG+    +FG R+  +L+  V     Q+E +        + ++ + + 
Sbjct: 354 VRKGLYSNIVLSGGSTMFKDFGRRLQRDLRSIVNDRIAQSELLSGTKSTGVDVQVISHRR 413

Query: 381 MKSFTENNEELYKHTRV------TKQEYNEHGFE 408
            ++       L   T        TK++Y E+G E
Sbjct: 414 QRNAVWFGGSLLAQTAEFKSYCHTKRDYEEYGPE 447

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/328 (23%), Positives = 134/328 (40%), Gaps = 54/328 (16%)

Query: 40  YYLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL 99
           +Y+ ++        S S+  P + GQ+ +W+     W+   +       +   E  +++ 
Sbjct: 91  FYIGDEAIAASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYF 144

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE P+  PE      ++ FE +    LY          I       +  S  S   +D
Sbjct: 145 LLTEPPLNPPENREQVAEIFFESFNCAGLY----------IAVQAVLALAASWTSSKVVD 194

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD 219
            S          VIDSG   + +IP+ +G     A+K + + GR +   ++  +  R  +
Sbjct: 195 RSLTGT------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEE 248

Query: 220 VTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHST-L 278
            T         +E C                     YV  D    F  + RD +K +  +
Sbjct: 249 DTTLRTAERIKQEYC---------------------YVCSDIVKEFNKFDRDSEKFAQFI 287

Query: 279 PEHSQS-----IILEDELFSVPEGFFHPEMA--NVLKPGIIETIL-ESLFILPESLRSLM 330
            E+S+      I +  E F  PE FF+PE+A  + L P  + TI+ +++   P  +R  +
Sbjct: 288 VENSEKTRRKVIDVGYERFLAPEIFFNPEIASSDFLTP--LPTIVDQTIQACPIDVRKGL 345

Query: 331 VNNIVCTGGNFNIPNFGSRIYTELQKQV 358
            NNIV +GG+    +FG R+  +L+  V
Sbjct: 346 YNNIVLSGGSTMFKDFGRRLQRDLKGIV 373

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 75/157 (47%), Gaps = 10/157 (6%)

Query: 268 YVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIE----TILESLFIL 322
           ++R  + H +   H Q  + L  E   VPE  F P +A   + GI E     +L+     
Sbjct: 590 FLRGPRPHDSEDVHQQHQLHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSK 649

Query: 323 PESLR---SLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWK 379
           P +L    S MVNN+  TGGN  IP   +RI  E  + +       V + + +  L  WK
Sbjct: 650 PGNLSAASSRMVNNVWITGGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSE-DPSLDAWK 708

Query: 380 AMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
            M     NNE  YK+T VT++EY E+G ++  + + G
Sbjct: 709 GMAKLA-NNETDYKNTAVTRKEYEEYGPDYIKEHKLG 744

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 108/253 (42%), Gaps = 54/253 (21%)

Query: 4   APLLIDNGSYEIKFGYSNQETP-FVALNALAKDK----YETY-YLSNQINNIKDISSVSI 57
           A + ID GSY I+ GY+NQ TP ++    L K +     +T+ ++ N     + I S S 
Sbjct: 37  ARIAIDFGSYNIRAGYTNQNTPSYIFPTRLTKHRDRKLQKTFTFIGNDTLLDQTIRSQS- 95

Query: 58  KRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQ 117
           K P     L +W+   ++ +Y F++     G   N    N L++ E    L     +  Q
Sbjct: 96  KSPFDGTLLTNWDYVEDMLEYTFHH----LGVSGNNGVSNPLIINERLACLQSQRNSWYQ 151

Query: 118 VVFE-------EYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFN 170
           ++FE        +G DSL+                SF         Y + +KE+      
Sbjct: 152 LLFETFDLPEVSFGIDSLF----------------SF---------YGNSTKED-----G 181

Query: 171 LVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGG----RFLNGLLKETISYRHYDVTDESML 226
           LVI+ G   + +IP++ G       K+++ GG     FL+ LL  T+ Y ++     ++ 
Sbjct: 182 LVINCGNEETDVIPIVGGRGILSECKRINWGGSQSTNFLSSLL--TLKYPYFPAKLSTLQ 239

Query: 227 VNNIKENCMFISP 239
              + E+  + SP
Sbjct: 240 YTQMYEDYCYTSP 252

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/331 (23%), Positives = 129/331 (38%), Gaps = 60/331 (18%)

Query: 40  YYLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL 99
           +Y+ N+        S S+  P + GQ+ +W+     W+   +       +   E  ++  
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHFF 148

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE P+  PE      ++ FE +    LY          I       +  S  S    D
Sbjct: 149 LLTEPPLNPPENREQVAEIFFESFNCAGLY----------IAVQAVLALAASWTSSKVTD 198

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISY 215
            S          VIDSG   + +IP+ +G     A+K + + GR    F+  LL+E    
Sbjct: 199 RSLTGT------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA 252

Query: 216 RHYDVTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKH 275
                T E +     +E C                     YV PD    F  + +D  K 
Sbjct: 253 DTSLRTAEKIK----QEYC---------------------YVCPDIVKEFNKFDKDPSKF 287

Query: 276 STLPEHSQS------IILEDELFSVPEGFFHPEMA--NVLKPGIIETILESLFILPESLR 327
           +     +Q       + +  E F  PE FF+PE+A  + L P +   + +++   P  +R
Sbjct: 288 AQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVR 346

Query: 328 SLMVNNIVCTGGNFNIPNFGSRIYTELQKQV 358
             + NNIV +GG+    +FG R+  +L+  V
Sbjct: 347 KGLYNNIVLSGGSTMFKDFGRRLQRDLKSIV 377

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 73/157 (46%), Gaps = 10/157 (6%)

Query: 268 YVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIE----TILESLFIL 322
           ++R  + H +   H Q  + L  E   VPE  F P M    + GI E     +L+     
Sbjct: 594 FLRGPRPHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQ 653

Query: 323 PESLRSL---MVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWK 379
           P  L      MVNN++ TGGN  +P    RI  E    + T     V++  ++  L  WK
Sbjct: 654 PGKLSQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNM-SSDPSLDAWK 712

Query: 380 AMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
            M +   N EE Y+ T ++K+EY E+G E+  + + G
Sbjct: 713 GMAALARN-EEQYRKTVISKKEYEEYGPEYIKEHKLG 748

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 96/225 (42%), Gaps = 52/225 (23%)

Query: 3   EAPLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETY-----YLSNQINNIKDISSVS 56
           ++P+ ID GS +++ G+ N  TP  +  NAL K +         ++ N  + + D +  S
Sbjct: 37  QSPIAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNKNFTFVGN--DTLLDQAVRS 94

Query: 57  IKRPHQLGQLVS-WELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNT 115
             R    G  V+ W L  EI DY F++     G   +    N ++LTE   T+     N 
Sbjct: 95  QSRSPFDGPFVTNWNLTEEILDYTFHH----LGVVPDNGIPNPILLTERLATVQSQRTNW 150

Query: 116 DQVVFEEY-------GFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQD 168
            Q++FE Y       G DSL+     N+ P            SG +KT            
Sbjct: 151 YQILFETYNVPGVTFGIDSLFSF--YNYNP------------SG-NKT------------ 183

Query: 169 FNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLL 209
             LVI  G+  + +IP++ G       K+++ GG     +LN L+
Sbjct: 184 -GLVISCGHEDTNVIPVVDGAGILTDAKRINWGGHQAVDYLNDLM 227

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 77/365 (21%), Positives = 143/365 (39%), Gaps = 64/365 (17%)

Query: 5   PLLIDNGSYEIKFGYSNQETPFVALNALAKDK-YETY---------YLSNQINNIKDISS 54
           P++IDNGS  +K G+  +E P     +L  D  Y            ++ N+   ++ +  
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL-- 68

Query: 55  VSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRN 114
           + +K P + G +  W+    +W +       F   ++    E+ L++TE P+        
Sbjct: 69  LKLKHPMERGVVSDWDDMELLWSHIL-----FDSLQLTSGMEHPLLITEAPLNPESNKEK 123

Query: 115 TDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVID 174
             +V FE +             IP I       + + G    Y  G      +    V+D
Sbjct: 124 MLEVFFETFN------------IPAI------CVSIPGVLSLYASG------RTTGCVVD 159

Query: 175 SGYNCSWIIPMIKGVPYYKAVKKMDMGG----RFLNGLLKETISYRHYDVTDESMLVNNI 230
            G      +P+ +G     ++K++++GG    + L   L++      +  + E  LV  +
Sbjct: 160 CGEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQLRKESGVWLFS-SGERELVRTM 218

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDE 290
           KE   ++S    +   K +   K  +      T+F            LP+ +  + L   
Sbjct: 219 KEKSCYVS----LNQLKDEE--KFTFEPGKMNTNF-----------KLPDGNM-LTLSKS 260

Query: 291 LFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRI 350
            F  PE  F P++    +P + E  L+S+  +   LR  +++ I  +GG      FG R 
Sbjct: 261 RFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITLSGGTTMFRGFGDRF 320

Query: 351 YTELQ 355
             ELQ
Sbjct: 321 LQELQ 325

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 76/159 (47%), Gaps = 14/159 (8%)

Query: 268 YVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIE----TILESLFIL 322
           ++R  + H +   H Q  + L  E   VPE  F P +    + GI E     +L+     
Sbjct: 594 FLRGPRPHDSENIHEQHQMHLNVERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQ 653

Query: 323 PESLRSL---MVNNIVCTGGNFNIPNFGSRIYTELQK--QVQTEWVCDVSIPKANAELQN 377
           P  L S    MVNN+  TGGN  +P    RI  E  +   V T +  ++S   ++  L  
Sbjct: 654 PGKLSSTSLDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVNMS---SDPSLDA 710

Query: 378 WKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
           WK M +  +N EE YK T ++K+EY E+G ++  + + G
Sbjct: 711 WKGMAALAQNKEE-YKKTVISKKEYEEYGPDYIKEHKLG 748

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 107/263 (40%), Gaps = 55/263 (20%)

Query: 4   APLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQI-----NNIKDISSVSI 57
            P+ ID GS +++ G+ NQ  P  +  N L K  +    L+        + + D +  S 
Sbjct: 38  VPIAIDFGSSKLRAGFVNQAAPTHIFPNVLTK--FRDRKLNKNFTFVGNDTLLDQAVRSQ 95

Query: 58  KRPHQLGQLVS-WELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTD 116
            R    G  V+ W    EI DY F++     G   N    N ++LTE   T+     N  
Sbjct: 96  SRSPFDGPFVTNWNFTEEIMDYTFHH----LGVSPNNGVRNPILLTERMATVQSQRANWY 151

Query: 117 QVVFEEY-------GFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDF 169
           Q++FE Y       G DSLY     N               +  +KT             
Sbjct: 152 QIMFETYNVPGVTFGIDSLYGFYNQN---------------TSGNKT------------- 183

Query: 170 NLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESM 225
            LVID G+  + +IP++ G       K+++ GGR    +L+ L+   + Y ++      +
Sbjct: 184 GLVIDCGHEDTNVIPVVDGTGVLTDAKRINWGGRQAVDYLSDLM--ALKYPYFPTKLSYL 241

Query: 226 LVNNIKENCMFISPVSYIESFKK 248
               + ++  ++SP +Y E  KK
Sbjct: 242 QYETMYQDYCYVSP-NYDEDIKK 263

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 55/168 (32%), Positives = 80/168 (47%), Gaps = 15/168 (8%)

Query: 260 DFQTSFMG-YVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIE---T 314
           D++ S +  ++R  + H +   H Q  + L  E   VPE  F P M    + GI E   T
Sbjct: 585 DWRNSLLHLFLRGPRPHDSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICELSET 644

Query: 315 ILESLFILPE---SLRSL-MVNNIVCTGGNFNIPNFGSRIYTELQK--QVQTEWVCDVSI 368
           IL   F       S  SL MVNNI+ TGGN  +P    RI  E  +   V T    ++S 
Sbjct: 645 ILMKKFGSQRGKLSSTSLDMVNNILITGGNAKVPGLRERIVKEFTEFLPVGTNVAVNIS- 703

Query: 369 PKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
             +N  L  W+ M +   N  E YK T ++K+EY E+G ++  + + G
Sbjct: 704 --SNPSLDAWRGMAALARNKAE-YKKTVISKEEYEEYGPDYIKEHKLG 748

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 107/262 (40%), Gaps = 55/262 (20%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQI-----NNIKDISSVSIK 58
           P+ ID GS  ++ G+ NQ TP  +  N L K  +    L+        + + D +  S  
Sbjct: 39  PIAIDFGSSRLRAGFVNQATPTHIFPNVLTK--FRDRKLNKNFTFVGNDTLLDQAVRSQS 96

Query: 59  RPHQLGQLVS-WELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQ 117
           R    G  V+ W    EI DY F++     G   N    N ++LTE   T+     N  Q
Sbjct: 97  RSPFDGPFVTNWNFTEEIMDYTFHH----LGVLPNNGISNPILLTERMATVQSQRANWYQ 152

Query: 118 VVFEEY-------GFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFN 170
           ++FE Y       G DSLY         F  N+ +              G+K        
Sbjct: 153 ILFETYNVPGVTFGIDSLYS--------FYNNNPS--------------GNKTG------ 184

Query: 171 LVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESML 226
           LVID  +  + ++P++ G       K+++ GG     +LN L+   + Y ++      + 
Sbjct: 185 LVIDCSHEDTSVVPIVDGAGILTDAKRINWGGHQAVDYLNDLM--ALKYPYFPTKMSYLQ 242

Query: 227 VNNIKENCMFISPVSYIESFKK 248
              + ++  ++SP +Y E  KK
Sbjct: 243 YETMYQDYCYVSP-NYDEDIKK 263

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 79/161 (49%), Gaps = 18/161 (11%)

Query: 268 YVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIE---TILESLFILP 323
           ++R  + H +   H Q  + L  E   VPE  F P M  + + GIIE   TI+ + F   
Sbjct: 587 FLRGPRPHDSEDAHEQHQMHLNVERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKF--G 644

Query: 324 ESLRSL------MVNNIVCTGGNFNIPNFGSRIYTELQK--QVQTEWVCDVSIPKANAEL 375
            S R L      M NN+  TGGN  +P    RI  E  +   V T++   V+   ++  +
Sbjct: 645 SSRRQLSSVSQEMANNVFLTGGNVRVPGLRDRIVREFTEFLPVGTKYNIKVA---SDPAI 701

Query: 376 QNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
             WK M  F +++ + YK + VTK+EY E+G ++  + + G
Sbjct: 702 DAWKGMAKFAQSSTD-YKGSYVTKKEYEEYGPDYIKEHKLG 741

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 82/204 (40%), Gaps = 31/204 (15%)

Query: 5   PLLIDNGSYEIKFGYSNQETP---FVALNALAKDKY--ETYYLSNQINNIKDISSVSIKR 59
           P+ ID GS E++ GY+NQ  P   F       +D+   +T+       N++       + 
Sbjct: 38  PIAIDFGSSEVRAGYTNQSLPSHVFPTRLTRHRDRKINKTFTFVGNDTNLEQTLRTQSRS 97

Query: 60  PHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVV 119
           P     + +W+   ++ +Y F    +  G   ++   N ++LTE   TL     N  Q++
Sbjct: 98  PFDGPMITNWDYVEDMMEYTF----NHLGVVGHDGISNPILLTEKMATLQSQRSNWYQLM 153

Query: 120 FEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNC 179
           FE +G   L     + F  F  N  +S                        LVI SG   
Sbjct: 154 FECFGVPKLTFGIDSLFSYFANNQSDS----------------------TGLVISSGNED 191

Query: 180 SWIIPMIKGVPYYKAVKKMDMGGR 203
           + +IP++ G       K+++ GGR
Sbjct: 192 TNVIPVVCGKGILSEAKRINWGGR 215

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 89/400 (22%), Positives = 153/400 (38%), Gaps = 87/400 (21%)

Query: 40  YYLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL 99
           +Y+ N+        S S+  P + GQ+ +W+     W+   +       +   E  ++  
Sbjct: 106 FYIGNEALIASQGPSYSLSYPIRHGQIENWDHMERFWENSIFK------YLRAEPEDHFF 159

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE P+  PE      ++ FE +    LY          I       +  S  S    D
Sbjct: 160 LLTEPPLNPPENREQVAEIFFESFNCAGLY----------IAVQAVLALAASWTSSQVTD 209

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISY 215
            S          VIDSG   + +IP+ +G     A+K + + GR    F+  LL+E    
Sbjct: 210 RSLTGT------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA 263

Query: 216 RHYDVTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKH 275
                T E +     +E C                     YV PD        V++  K 
Sbjct: 264 DTSLRTAERIK----QEYC---------------------YVCPDI-------VKEFNKF 291

Query: 276 STLPEHSQSIILED-------------ELFSVPEGFFHPEMA--NVLKPGIIETILE-SL 319
              PE     I+E+             E F  PE FF+PE+A  + L P  + T+++ ++
Sbjct: 292 DRQPEKFAQFIIENQDKTKQKVVDIGYERFLAPEIFFNPEIASSDFLTP--LPTVVDHTI 349

Query: 320 FILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQ-----KQVQTEWVCDVSIPKANAE 374
              P  +R  + NNIV +GG+    +F  R+  +++     + +Q E V  V     + +
Sbjct: 350 QACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDIKSIVNSRIIQNEAVTGVKSTGVDVQ 409

Query: 375 LQNWKAMKSFTENNEELYKHTRV------TKQEYNEHGFE 408
           + + +  ++       L   T        TK++Y E+G E
Sbjct: 410 VISHRKQRNAVWFGGSLLAQTAEFKSYCHTKKDYEEYGPE 449

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 87/399 (21%), Positives = 149/399 (37%), Gaps = 85/399 (21%)

Query: 40  YYLSNQINNIKDISSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL 99
           +Y+ N+        + S+  P + GQ+ +W+     W+   +       +   E  ++  
Sbjct: 104 FYIGNEALVASQGPAYSLSYPIRHGQVENWDHMERFWENSIFK------YLRAEPEDHFF 157

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE P+  PE      ++ FE +    LY          I       +  S  S    D
Sbjct: 158 LLTEPPLNPPENREQVAEIFFESFNCAGLY----------IAVQAVLALAASWTSAQVTD 207

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISY 215
            S          VIDSG   + +IP+ +G     A+K + + GR    F+  LL+E    
Sbjct: 208 RSLTGT------VIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLLRERGEA 261

Query: 216 RHYDVTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKH 275
                T E +     +E C                     YV PD        V++  K 
Sbjct: 262 DSSLKTAERIK----QEYC---------------------YVCPDI-------VKEFNKF 289

Query: 276 STLPEHSQSIILED-------------ELFSVPEGFFHPEMA--NVLKPGIIETILESLF 320
              PE     I+E+             E F  PE FF+PE+A  + L P +   + +++ 
Sbjct: 290 DRQPEKFAQFIIENQDKTTKKVIDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQ 348

Query: 321 ILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQV-----QTEWVCDVSIPKANAEL 375
             P  +R  + NNIV +GG+    +F  R+  +++  V     Q E +        + ++
Sbjct: 349 ACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDVKSIVSNRIAQNEALTGTKSTGVDVQV 408

Query: 376 QNWKAMKSFTENNEELYKHTRV------TKQEYNEHGFE 408
            + +  ++       L   T        TK++Y EHG E
Sbjct: 409 ISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDYEEHGPE 447

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 74/162 (45%), Gaps = 10/162 (6%)

Query: 268 YVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIE----TILESLFIL 322
           ++R  + H +   H Q  + L  E   VPE FF P M    + G+ E     +L      
Sbjct: 589 FLRGPRPHDSENSHEQHQMHLNVERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGAS 648

Query: 323 PESLRSL---MVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWK 379
           P  + S+   M  N+  TGGN  IP    RI  E    +      +V+I  ++  L  W+
Sbjct: 649 PRQMSSITSEMAKNVWVTGGNAKIPGLRERIVKEFTGFLPVNTSFNVNI-SSDPSLDAWR 707

Query: 380 AMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQNWL 421
            M  + +N E  YK + ++K+EY E+G ++  + + G  N+ 
Sbjct: 708 GMAKYAQN-ETDYKKSFISKKEYEEYGPDYIKEHKLGNMNYF 748

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 84/213 (39%), Gaps = 47/213 (22%)

Query: 3   EAPLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETY-----YLSNQINNIKDISSVS 56
           + P+ +D GS +++ G  N+ TP  V  N + + +         ++ N +N  + + + S
Sbjct: 36  DVPIAVDFGSNQLRAGLINRATPSHVFTNRITRFRDRKLMKTMTFIGNDVNLDQAVRAQS 95

Query: 57  IKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTD 116
            K P     + +W+   +I +Y F    +  G   N    N +++TE   TL     +  
Sbjct: 96  -KSPFDGPMVTNWDYVEDILEYTF----NHLGSTPNNGISNPILVTERLATLQTQRSSWY 150

Query: 117 QVVFE-------EYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDF 169
           QV+FE        +G DSL+                           Y   +  N+    
Sbjct: 151 QVLFECFNVPGVTFGIDSLF--------------------------AYYQNTTANST--- 181

Query: 170 NLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGG 202
            LVI  G   + IIP++ G       K+++ GG
Sbjct: 182 GLVIGCGNEDTNIIPVVDGQGMLTEAKRINWGG 214

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 76/159 (47%), Gaps = 14/159 (8%)

Query: 268 YVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIE---TILESLF-IL 322
           ++R  + H +   H Q  I L  E   VPE  F P M  + + GI E   TIL   F   
Sbjct: 593 FLRGPRPHDSEDIHQQHQIHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSE 652

Query: 323 PESLRSL---MVNNIVCTGGNFNIPNFGSRIYTELQK--QVQTEWVCDVSIPKANAELQN 377
           P+ L  L   M NNI  TGGN  IP    RI  E ++   V T++  +++   ++     
Sbjct: 653 PKHLSELSLTMANNIWLTGGNSKIPGLRERIVKEFREFLPVNTQFNVNMT---SDPTFDA 709

Query: 378 WKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
           W  M    +N E  YK T ++K+EY E+G E+  + + G
Sbjct: 710 WNGMAKLAQN-ETDYKKTIISKKEYEEYGPEYIKEHKLG 747

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 89/223 (39%), Gaps = 47/223 (21%)

Query: 3   EAPLLIDNGSYEIKFGYSNQETP---FVALNALAKDKY--ETYYLSNQINNIKDISSVSI 57
           E P+ ID GS  ++ GY+N+  P   F       +D+   +T+  +    ++       +
Sbjct: 36  EIPIAIDFGSSTVRAGYTNEARPSHIFPTKLTRYRDRKINKTFTFTGNDCSLDQTIRSQM 95

Query: 58  KRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQ 117
           K P     + +W+   +I  Y F    +  G   +   +N +++TE   T+     N  Q
Sbjct: 96  KSPFDGALITNWDYVEDILQYTF----NHLGVVPDHGVQNPIIITEKLATIQSQRSNWYQ 151

Query: 118 VVFEEY-------GFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFN 170
           ++FE Y       G DSL+         F  N++ S                        
Sbjct: 152 LLFETYNVPKATFGIDSLF--------AFYNNNNGSATSTG------------------- 184

Query: 171 LVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLL 209
           +VID  +  + IIP++ G       K+++ GGR    +L+ LL
Sbjct: 185 MVIDCSHEETNIIPIVDGQGILTDAKRINWGGRHAIDYLSNLL 227

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 111/262 (42%), Gaps = 55/262 (20%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQI------NNIKDISSVSI 57
           P+ ID GSY +K GY+NQ  P  V  N L   +Y    L+  +       N+     +  
Sbjct: 38  PIAIDFGSYNVKAGYTNQSLPTHVFTNKLT--RYRDRKLAKTMTFIGNDTNLDQPLRIQA 95

Query: 58  KRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDS-ENHLVLTETPMTLPELSRNTD 116
           KRP+    + +WE   EI+DY  ++     G +    S  N ++LTE    L     N  
Sbjct: 96  KRPYDGLFIANWEYAEEIFDYTLHH----LGVQTTNGSISNPIILTEKMACLQSQRANWY 151

Query: 117 QVVFE-------EYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDF 169
           Q++FE        +G DSLY         F  N  N F           DG         
Sbjct: 152 QLLFETFDVPSATFGLDSLYA--------FYNNCANPFES---------DG--------- 185

Query: 170 NLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESM 225
            LVI+ G+  + I+P+++G       K+++ GGR    +L+ LL  T+ Y ++       
Sbjct: 186 -LVINCGHEDTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLL--TLKYPYFPTKLSEF 242

Query: 226 LVNNIKENCMFISPVSYIESFK 247
               + E+  ++SP +Y E  K
Sbjct: 243 QYQTMYEDFCYVSP-NYNEDIK 263

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 76/161 (47%), Gaps = 18/161 (11%)

Query: 268 YVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFIL---- 322
           ++R  + H +   H Q  I +  E   VPE  F P +    + GI E + E+LF+     
Sbjct: 599 FLRGPRPHDSEDPHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISE-LSETLFLRKFNS 657

Query: 323 -PESLRSL---MVNNIVCTGGNFNIPNFGSRI---YTELQKQVQTEWVCDVSIPKANAEL 375
            P  L S+   M+NN+  TGG+  +P    RI   YTE    V T+   ++S    +  L
Sbjct: 658 SPRKLSSISERMLNNVWLTGGHAKLPGLKERIVKEYTEFLP-VGTKMSINIS---NDPSL 713

Query: 376 QNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
             WK M     N + L K  +VTK++Y E+G E+  +   G
Sbjct: 714 DTWKGMAKLASNTDYL-KKIQVTKKDYEEYGPEYMMEHNLG 753

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 72/157 (45%), Gaps = 10/157 (6%)

Query: 268 YVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIE----TILESLFIL 322
           ++R  + H +   H Q  + L  E   VPE  F P M    + GI E     +L+     
Sbjct: 594 FLRGPRPHDSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQ 653

Query: 323 PESLRSL---MVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWK 379
           P  L      M NN+  TGGN  +P    RI  E    +      ++++  ++  L  WK
Sbjct: 654 PGKLSQTSIDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININM-SSDPSLDAWK 712

Query: 380 AMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
            M +  +N EE YK T ++++EY E+G ++  + + G
Sbjct: 713 GMAALAQNEEE-YKRTIISRKEYEEYGPDYIKEHKLG 748

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 90/224 (40%), Gaps = 50/224 (22%)

Query: 3   EAPLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETY-----YLSNQINNIKDISSVS 56
           + P+ ID GS +++ G+ NQ  P  V  N L K +         ++ N     + + S S
Sbjct: 37  QLPIAIDFGSSKLRAGFVNQSAPTHVFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQS 96

Query: 57  IKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTD 116
            K P     + +W    EI DY F++     G        N ++LTE   T+     N  
Sbjct: 97  -KSPFDGPFVTNWNFTEEILDYTFHH----LGIVPENGISNPILLTERMATVQSQRANWY 151

Query: 117 QVVFEEY-------GFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDF 169
           Q++FE Y       G DSLY     N+ P            SGK                
Sbjct: 152 QILFETYNVPGVTFGIDSLYGF--YNYYP------------SGKQT-------------- 183

Query: 170 NLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLL 209
            LVID G+  + +IP++ G       K+++ GG     +LN L+
Sbjct: 184 GLVIDCGHEDTNVIPIVDGAGILTDAKRINWGGHQAVDYLNDLM 227

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 62/130 (47%), Gaps = 9/130 (6%)

Query: 294 VPEGFFHPEMANVLKPGIIE----TILESLFILPESLRS---LMVNNIVCTGGNFNIPNF 346
           VPE  F P M    + GIIE     +L+     P  L      M  N+  TGG+  +P  
Sbjct: 622 VPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQLPGL 681

Query: 347 GSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHG 406
            +RI  E    +  +    V+I K +  L  WK M  F+ ++ + +K + ++K+EY E+G
Sbjct: 682 KTRIVKEFTSFLPNDAKFSVNISK-HPSLDAWKGMAKFSSDDAD-FKSSLISKKEYEEYG 739

Query: 407 FEWTTKQRFG 416
            E+  + R G
Sbjct: 740 PEYIKEHRLG 749

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 87/219 (39%), Gaps = 33/219 (15%)

Query: 5   PLLIDNGSYEIKFGYSNQETP---FVALNALAKDKYETY---YLSNQINNIKDISSVSIK 58
           P+ ID G+  +K GY N+  P   F       +D+  +    ++ N  N    + S S K
Sbjct: 39  PIAIDFGTCSVKAGYVNKADPAFNFPTRLTRFRDRKMSRTMTFIGNDTNLDYAVRSQS-K 97

Query: 59  RPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQV 118
            P     + +WE   +I +Y F +     G   N    N L++TE   TL     N  Q+
Sbjct: 98  TPFDGPFVTNWEYAEDILEYTFKH----LGVTANHGISNPLIMTEKLATLQSQRANWYQL 153

Query: 119 VFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYN 178
           +FE +   ++       F  +   D +S   + G            N QD N        
Sbjct: 154 LFETFNTSNVSFGIDNVFAFYANTDKHSSGLVFGL-----------NNQDTN-------- 194

Query: 179 CSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRH 217
              +IP+I G P     K+++ GG    G L + ++ ++
Sbjct: 195 ---VIPIIDGKPVLTDTKRINWGGSQSVGYLSDLMTLKY 230

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 87/217 (40%), Gaps = 40/217 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRPH-- 61
           + ++ID GSY    GYS  + P   L ++    Y  Y       NI    S+ I R    
Sbjct: 15  SAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKDYE 70

Query: 62  -----QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTD 116
                + G ++ W+   E W +   N        +N +S    +LTE      E  + + 
Sbjct: 71  LKPIVKDGLVIDWDTAQEQWQWALKNE-----LYLNSNSGTPALLTEPVWNSTENRKKSL 125

Query: 117 QVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSG 176
           +V+ E   F++ Y AP +  + F     N                         LV+D G
Sbjct: 126 EVLLEGMQFEACYLAPTSTCVSFAAGRPNC------------------------LVVDIG 161

Query: 177 YNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETI 213
           ++   + P++ G+   K+ ++  + G+F+N L+K+ +
Sbjct: 162 HDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 45/107 (42%), Gaps = 3/107 (2%)

Query: 310 GIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQT-EWVCDVSI 368
           G+   +  S+      LR+ + +N+V TGG   IP    R+ TEL K + + ++    + 
Sbjct: 384 GLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 369 PKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
                + Q+W      T      +    V K+EY E G E     RF
Sbjct: 444 HTMERQYQSWLGGSILTSLG--TFHQLWVGKKEYEEVGVERLLNDRF 488

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 71/158 (44%), Gaps = 12/158 (7%)

Query: 268 YVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILP--- 323
           ++R  + H +   H Q  + L  E   VPE  F P +  + + GI+E + E+L +     
Sbjct: 586 FLRGPRSHDSESIHEQHQMHLNVERIRVPEVIFQPSIGGLDQAGIVE-LCETLLLKKFGS 644

Query: 324 -----ESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNW 378
                  +  +M  NI  TGGN  +P    R+  E    +      +V + + +  +  W
Sbjct: 645 NRRELSEISKMMAKNIFITGGNAKLPGIRERVVREFTGFLPVGTNLNVKLAE-DPSMSAW 703

Query: 379 KAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
           + M  F  NN  LY+ + +TK+EY E G E+  +   G
Sbjct: 704 RGMAKFA-NNTSLYETSIMTKKEYEELGPEYIKEHNLG 740

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 106/244 (43%), Gaps = 57/244 (23%)

Query: 3   EAPLLIDNGSYEIKFGYSNQETP-FVALNALA----KDKYETY-YLSNQINNIKDISSVS 56
           + P+ ID GSYE++ GY NQ  P  V  N LA    +    TY ++ N  N  + I + S
Sbjct: 36  DTPIAIDFGSYEVRAGYVNQGDPALVFTNRLARYRDRKASRTYTFVGNDTNLDQSIRTQS 95

Query: 57  IKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTD 116
            K P     + +W+   +I  Y F++  D +G   N    N +++TE    L     N  
Sbjct: 96  -KSPFDGSMITNWDYVDDILAYTFHHL-DVRG---NGGVPNPVLITERMAALQSQRSNWY 150

Query: 117 QVVFEEY-------GFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDF 169
           +++FE Y       G DSL+                SF    G+      G         
Sbjct: 151 ELLFECYNLQKVTFGIDSLF----------------SFY---GEHPPGTTG--------- 182

Query: 170 NLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESM 225
            + I+SG   + +IP++ G       K+++ GG+    +LNGLL  ++ Y ++     + 
Sbjct: 183 -IAINSGNEDTSVIPVVNGKGILTEAKRINWGGQQSVGYLNGLL--SLKYPYF----PTK 235

Query: 226 LVNN 229
           LVNN
Sbjct: 236 LVNN 239

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 97/221 (43%), Gaps = 39/221 (17%)

Query: 225 MLVNNIKENCMFISPVSYIESFKK--KALTKVEYVLPDFQTSFMG--------------- 267
           M+ N+I +N     P +  E+ ++  K + ++E  L +F  +F G               
Sbjct: 533 MVYNDISQN-----PEALDEAIEEDYKDIVEIEKELLEFDPNFTGEDTLDAQYDWRNSIL 587

Query: 268 --YVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIE----TILESLF 320
             ++R  + H +   H Q  + L  E   VPE  F P M    + G+ E     +L+   
Sbjct: 588 HLFLRGPRPHDSDDVHEQHQMHLNIERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFG 647

Query: 321 ILPESLRSL---MVNNIVCTGGNFNIPNFGSRIYTELQK--QVQTEWVCDVSIPKANAEL 375
             P  L      M NNI  +GGN  +P   +RI  E      V T+   ++S   ++  L
Sbjct: 648 SSPNQLSKTAEDMANNIWLSGGNAKVPGLKNRIVKEFTSFLPVGTKLSVNMS---SDPLL 704

Query: 376 QNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
            +WK M  + ++  E Y  + +TK+EY E+G E+  + + G
Sbjct: 705 DSWKGMAKWAKS--EDYNKSFITKKEYEEYGPEYIKEHKMG 743

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 93/231 (40%), Gaps = 37/231 (16%)

Query: 2   GEAPLLIDNGSYEIKFGYSNQETP---FVALNALAKDK---YETYYLSNQINNIKDISSV 55
           G+ P+ ID GS  +K GY+NQ+ P   F       +D+       ++ N I+  + + + 
Sbjct: 36  GDVPIAIDFGSNTLKAGYTNQDVPSLVFPTRLTRFRDRRLNRTMTFIGNDISLDQAVRAQ 95

Query: 56  SIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNT 115
           S K P     + +WE   E+ +Y F +     G   +    N L+ +E    +       
Sbjct: 96  S-KSPFDGSMVTNWEYIDEMLEYTFKH----LGVLGDNGISNPLIFSEKLAVVQAQRSQW 150

Query: 116 DQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDS 175
            Q++FE +          A F       DN F   +  S   +D +         L+I  
Sbjct: 151 YQLLFETFNISK------ATF-----GIDNQFAFFANNS---IDST--------GLMIGC 188

Query: 176 GYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTD 222
               + +IP++ GV   +  K+++ GG     ++N LL     Y    +TD
Sbjct: 189 NNEDTNVIPIVNGVASLQECKRINWGGNHAVSYMNNLLSLKYPYFPTKLTD 239

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 66/145 (45%), Gaps = 13/145 (8%)

Query: 281 HSQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFI--LPESLRSL------MVN 332
           H   + +  E   VPE  F P M    + GI E + E+L +     + R L      M  
Sbjct: 602 HQHQMHMNIERIRVPEVLFQPNMGGEDQAGIPE-LCETLLLRKFGSTQRQLSDVSTSMAQ 660

Query: 333 NIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKA-NAELQNWKAMKSFTENNEEL 391
           N+  TGGN  +P    RI  E  + + +      SI K+ +  L  W+ M    +N E+ 
Sbjct: 661 NVWITGGNAKLPGLRERIVKEFSEFLPS--GSPFSIRKSQDPSLDAWRGMAKLAQNTED- 717

Query: 392 YKHTRVTKQEYNEHGFEWTTKQRFG 416
           +KH  +TKQEY E+G E+  +   G
Sbjct: 718 FKHGYITKQEYLEYGPEYIKEHNLG 742

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 81/212 (38%), Gaps = 49/212 (23%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDISSVSIKRPHQL 63
           P+ ID GS +++ GY N   P  +  N L +  Y    L+  +  I + +S+      Q 
Sbjct: 38  PIAIDFGSSKLRAGYVNDPNPSHIFPNRLTR--YRDRKLAKTMTFIGNDTSLDQAVRVQA 95

Query: 64  -----GQLVS-WELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQ 117
                G LV+ W+   +  +Y F    +  G   N    N LV+ E   T+     N  Q
Sbjct: 96  KSAFDGPLVTNWDYVEDTLEYTF----NHLGVAANGGISNPLVINERLATIQSQRANWYQ 151

Query: 118 VVFE-------EYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFN 170
           ++FE        +G DSL+                 F   SG + T              
Sbjct: 152 ILFECFDVPGVTFGIDSLF----------------GFYHNSGPNST-------------G 182

Query: 171 LVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGG 202
           LVI  G   + +IP++ G       K+++ GG
Sbjct: 183 LVIGCGNEDTNVIPVVDGKGVLTESKRINWGG 214

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 116/260 (44%), Gaps = 52/260 (20%)

Query: 5   PLLIDNGSYEIKFGYSNQETP---FVALNALAKDKYETYYLSNQINNIK-DISSVSIKRP 60
           P+ ID GS E++ G+ NQ+ P   F    +  +D+ +   L+   N+   D+S  S  + 
Sbjct: 38  PIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNRNLTFIGNDTNLDLSVRSQAKS 97

Query: 61  HQLGQLVS-WELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVV 119
              G +VS W+   EI +Y F++     G   N+   N +++TE   TL     N  Q++
Sbjct: 98  PYDGAIVSNWDYTEEIMEYTFHH----LGVNGNDGVSNPILMTEKLATLQSQRENWYQLL 153

Query: 120 FE-------EYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
           FE        +G DSL+         F  N+D +    SG                  LV
Sbjct: 154 FECFGVPQVTFGIDSLFS--------FYANNDAT---ASG------------------LV 184

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESMLVN 228
           I+SG   + +IP++ G       K+++ GGR    +L+ LL   + Y ++ +   +    
Sbjct: 185 INSGNEDTHVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLL--ALKYPYFPIKPSTHQFQ 242

Query: 229 NIKENCMFISPVSYIESFKK 248
           ++ E+  ++S V Y +  +K
Sbjct: 243 SLYEDFCYVS-VDYQDEIRK 261

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 61/136 (44%), Gaps = 13/136 (9%)

Query: 290 ELFSVPEGFFHPEMANVLKPGIIETILESLFI---------LPESLRSLMVNNIVCTGGN 340
           E   VPE  F P MA + + G+ E I E+ F+         L E  + L   N+  TGGN
Sbjct: 609 ERIRVPEVIFQPSMAGLDQAGVTE-ICETNFLKKFGSTRSQLSEGSKKLAA-NVFLTGGN 666

Query: 341 FNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQ 400
             +P    RI  E    +      +V +   +A +  W+ M   ++   + YK + +T++
Sbjct: 667 MRLPGVRERIVREFTGMLPMGSNLNVRMASDSA-VDAWRGMAKLSQAGSQ-YKGSYITRK 724

Query: 401 EYNEHGFEWTTKQRFG 416
           EY E G ++  +   G
Sbjct: 725 EYQELGADYIKEHNLG 740

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 73/158 (46%), Gaps = 12/158 (7%)

Query: 268 YVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFI--LPE 324
           ++R  + H +   H Q  + +  E   VPE  F P +  + + G++E + E++ +     
Sbjct: 591 FLRGPRPHDSENIHEQHQMHINVERIRVPEVIFQPSIGGLDQAGVVE-LCETVLLKKFDS 649

Query: 325 SLRSL------MVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNW 378
           S R+L      M  N+  TGGN  +P    RI  E    +       V++ K +  L  W
Sbjct: 650 SRRALSATCEKMAKNVFITGGNTKLPGIRERIVREFTGFLPVGTELKVTLAK-DPSLSAW 708

Query: 379 KAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
           K M  F  ++   YK + +TK+EY E+G E+  +   G
Sbjct: 709 KGMAKFA-SDPTSYKSSILTKREYEEYGPEYIKEHNLG 745

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 85/222 (38%), Gaps = 49/222 (22%)

Query: 4   APLLIDNGSYEIKFGY-SNQETPFVALNALA----KDKYETYYLSNQINNIKDISSVSIK 58
            P+ ID GSYE++ GY +N+E   V    LA    +    TY    +   +        +
Sbjct: 41  GPIAIDFGSYEVRAGYVANKEPALVFPTRLARYRDRKASRTYTFVGRDTGLDASIRTQSR 100

Query: 59  RPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQV 118
            P     + +W+   ++  Y F++     G        N +VLTE   TL     N  ++
Sbjct: 101 SPFDGPMVTNWDYVDDMLAYTFHH----LGVRGGGGVPNAVVLTERLATLQSQRANWYEL 156

Query: 119 VFEEY-------GFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNL 171
           ++E Y       G DSL+                SF    G   T              L
Sbjct: 157 LYEAYNLQEVTFGIDSLF----------------SFYGERGPGST-------------GL 187

Query: 172 VIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLL 209
           V+ SG   + ++P++ G       K+++ GG+    +L GLL
Sbjct: 188 VVSSGNEDTCVVPVVDGRGVVSEAKRINWGGQQAVDYLTGLL 229

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 97/220 (44%), Gaps = 33/220 (15%)

Query: 4   APLLIDNGSYEIKFGYSNQETPF------VALNALAKDKYETYYLSNQINNIKDISSVSI 57
            P+ +D GSYE++ G+++Q+TP       +      K +    ++ N  +    + S S 
Sbjct: 40  TPIALDFGSYEVRAGFTSQDTPSHVFPTKIVRYKERKIQKALTFIGNDCSLDNAVRSHS- 98

Query: 58  KRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQ 117
           + P+    + +WE   ++  Y F++     G + N+   N ++LTE   T+     N  Q
Sbjct: 99  RSPYDGSLITNWEYMEDMLSYTFHH----LGVQPNDGISNPMILTEKMATVQAQRSNWYQ 154

Query: 118 VVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGY 177
           ++FE YG       P   F             + G    Y + S ++      L+I+SG+
Sbjct: 155 LLFECYGI------PQVTF------------GIDGLFSFYANNSPDST----GLIINSGH 192

Query: 178 NCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRH 217
             + IIP+IKG       K++D GG      LK  +S ++
Sbjct: 193 EDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 85/211 (40%), Gaps = 30/211 (14%)

Query: 233 NCMFISPVSYIESFKK--KALTKVEYVLPDFQTSFMG-----------------YVRDMK 273
           N + I+P +  ES +   + + ++E  L +F  SF                   ++R  +
Sbjct: 534 NDIAITPEALDESIEDEYREIVELEKSLLEFDPSFTEEDTLDAQYDWRNSVLHLFLRGPR 593

Query: 274 KHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIET---ILESLFILPESLRSL 329
            H+    H Q  + L  E    PE  F P M  + + GI E    IL   F    S  S 
Sbjct: 594 PHNGEDVHQQHQLHLNIERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQ 653

Query: 330 ----MVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFT 385
               M +NI  TGGN  IPN   RI  E    +      +V+  + N  L  WK M  F 
Sbjct: 654 QCLDMASNIFITGGNTKIPNLRERIVNEFTGFLPVNTPLNVNYAQ-NVSLDAWKGMAKFA 712

Query: 386 ENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
            ++   Y  T VTK EY E G  +  + + G
Sbjct: 713 RSD--TYSSTCVTKVEYEEFGPNYIKEHKLG 741

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 63/135 (46%), Gaps = 11/135 (8%)

Query: 290 ELFSVPEGFFHPEMANVLKPGIIETILESLFI--------LPESLRSLMVNNIVCTGGNF 341
           E   VPE  F P M  + + GIIE I E+ F+           S+   + +N+  TGGN 
Sbjct: 609 ERIRVPEVIFQPSMGGLDQAGIIE-ICETNFLKKFGSSRSELSSISRSLASNVFLTGGNM 667

Query: 342 NIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQE 401
            +P    R+  E +  +      +V +    A L  W+ M   +  +  L++ T VT+QE
Sbjct: 668 RLPGMRERVVREFRGLLPIGTELNVRMANDCA-LDAWRGMAKLSRTDS-LFRDTYVTRQE 725

Query: 402 YNEHGFEWTTKQRFG 416
           Y+E+G ++  +   G
Sbjct: 726 YHEYGPDYIKEHNLG 740

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 106/253 (41%), Gaps = 51/253 (20%)

Query: 3   EAPLLIDNGSYEIKFGYSNQETP---FVALNALAKDK---YETYYLSNQINNIKDISSVS 56
           E  + ID GS E++ GY NQE P   F    A  +D+       ++ N  N   D+S  S
Sbjct: 36  ETAIAIDFGSSEVRAGYGNQERPSHIFPNRIARWRDRKLNRNLTFIGNDTN--LDLSVRS 93

Query: 57  IKRPHQLGQLVS-WELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNT 115
             R    G LV+ W+   +I +Y F++     G +  +   N +++TE    L     N 
Sbjct: 94  QSRSPYDGALVTNWDYTEDIMEYTFHH----LGVKGTDGIPNPIIMTEKLGALHSQRDNW 149

Query: 116 DQVVFEEYGFDSLYKAPAANF-----IPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFN 170
            Q++FE +G      AP   F       F  N+D S    SG                  
Sbjct: 150 YQLLFECFG------APQVTFGLDSLFSFYANNDAS---ASG------------------ 182

Query: 171 LVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHYDVTDESML 226
           LVI SG   + IIP++ G       K+++ GGR    +L+ LL   + Y ++ +   +  
Sbjct: 183 LVISSGNEDTHIIPVVDGKGVLGEAKRINWGGRQSVDYLSNLL--ALKYPYFPIKPSTHQ 240

Query: 227 VNNIKENCMFISP 239
              + +   ++SP
Sbjct: 241 FKALYDEFCYVSP 253

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 86/217 (39%), Gaps = 40/217 (18%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRPH-- 61
           + ++ID GSY    GYS  + P   L ++    Y  Y        I    S+ I R    
Sbjct: 15  SAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGNKKIFSEQSIGIPRKDYE 70

Query: 62  -----QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTD 116
                + G ++ W+   E W +   N        +N +S    +LTE      E  + + 
Sbjct: 71  LKPIIENGLVIDWDTAQEQWQWALQNE-----LYLNSNSGIPALLTEPVWNSTENRKKSL 125

Query: 117 QVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSG 176
           +V+ E   F++ Y AP +  + F     N                         LV+D G
Sbjct: 126 EVLLEGMQFEACYLAPTSTCVSFAAGRPNC------------------------LVVDIG 161

Query: 177 YNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETI 213
           ++   + P++ G+   K+ ++  + G+F+N L+K+ +
Sbjct: 162 HDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 3/107 (2%)

Query: 310 GIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQT-EWVCDVSI 368
           G+ + +  S+      LR+ + +N+V TGG  +IP    R+ TEL K + + ++    + 
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 369 PKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
                + Q+W      T      +    V K+EY E G E     RF
Sbjct: 444 HTIERQYQSWLGGSILTSLG--TFHQLWVGKKEYEEVGVERLLNDRF 488

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 75/159 (47%), Gaps = 10/159 (6%)

Query: 265 FMGYVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIE---TILESLF 320
           F  ++R  + H +   H Q  + +  E   VPE  F P +    + GI E   TI+   F
Sbjct: 591 FHLFLRGPRPHDSENIHEQHQMHINVERIRVPEVMFQPILGGQDQAGITEICETIITKKF 650

Query: 321 -ILPESL--RSL-MVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQ 376
              P +L  +SL M  N+   GGN  +P   SR+  E  + + ++   +V+I +A   L 
Sbjct: 651 GSTPRNLSQQSLDMAKNVWLVGGNAQVPGLKSRVVKEFTEFLPSDTKINVNISEAPT-LD 709

Query: 377 NWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
            W  M     N EE Y+ T VT +EY+E G ++  + + 
Sbjct: 710 VWNGMYRLA-NTEEDYQRTIVTSEEYDECGVDYLKEHKL 747

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 88/214 (41%), Gaps = 35/214 (16%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAK--DKYETYYLS--NQINNIKDISSVSIKR 59
           P+ ID GSYE++ GY+N   P  +  N  +K  D+    YL        +   +    + 
Sbjct: 42  PIAIDFGSYELRAGYTNISRPSHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQTTRSQARS 101

Query: 60  PHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVV 119
           P     +V+W++  +I  Y F++     G + +    N +++ E    L     N  Q +
Sbjct: 102 PFDGPLVVNWDMVEDILQYTFHH----LGVQPDNGVTNPIIINEKLACLQSQRSNWYQTL 157

Query: 120 FEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNC 179
           FE +G   +  A              +F   +G S T              +VID GY  
Sbjct: 158 FESFGVPKVSMAVEGML---------AFYGHNGGSST-------------GIVIDCGYED 195

Query: 180 SWIIPMIKGVPYYKAVKKMDMGGR----FLNGLL 209
           + +IP+++G       K+++ GG     +L+ LL
Sbjct: 196 TNVIPIVEGQGMMLDAKRINWGGHSSIDYLSNLL 229

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 69/157 (43%), Gaps = 10/157 (6%)

Query: 268 YVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGI---IETILESLF-IL 322
           ++R  + H +   H Q  + L  E   VPE  F P +    + GI    ETIL + F   
Sbjct: 591 FLRGPRPHDSENIHEQHQLHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSK 650

Query: 323 PESLRSL---MVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWK 379
           P  L      M  NI  TGG+  +P    RI  E    +       V + K N  L  W 
Sbjct: 651 PRELSETSLGMAKNIWLTGGHSKLPGLRERIVKEFTGFLPVGTKLGVKMSK-NPSLDAWY 709

Query: 380 AMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416
            M+   +N E  YK + ++K++Y E+G E+  + + G
Sbjct: 710 GMRKLAQN-EADYKDSIISKKDYEEYGAEYIKEHKLG 745

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 46/221 (20%), Positives = 90/221 (40%), Gaps = 33/221 (14%)

Query: 3   EAPLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETY-----YLSNQINNIKDISSVS 56
           E P+ ID GSYE++ GY++   P  +  N L + +         ++ N +   + + S S
Sbjct: 36  ETPIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRHRDRKLSKTFTFIGNDVLLDQTVRSQS 95

Query: 57  IKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTD 116
            K P     + +W+   +I  Y F    +  G   +    N L++ E   +L    +N  
Sbjct: 96  -KSPFDGSFIANWDYVEDIMQYTF----NHLGVVGDNSVRNPLIINEPLGSLQSQRKNWY 150

Query: 117 QVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSG 176
           +++FE +   ++       F  +  N+ N             DG          +VI+  
Sbjct: 151 ELLFECFHLPNVSFGIDGMFGFYANNEGNQ------------DG----------IVINCS 188

Query: 177 YNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRH 217
              + +IP++ G       K+++ GGR     L + +S ++
Sbjct: 189 NEETDVIPVVDGRGVLTDAKRINWGGRQAVDYLSDLMSLKY 229

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 68/342 (19%), Positives = 127/342 (37%), Gaps = 78/342 (22%)

Query: 6   LLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRPH---- 61
           ++ID GS+    GYS  + P     A+    Y  Y    +  ++ +  S+ + R      
Sbjct: 17  IIIDPGSFNTNIGYSGTDCP----QAILPSCYGQYINDEEKPSLFNEQSIGLPRKDYEIK 72

Query: 62  ---QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTD-Q 117
              + G++V W+   E W++        K   + E ++    L   P+   E +R    +
Sbjct: 73  EIVRSGEVVDWDKAQEQWEWA------IKSVLLFESNKGLPALLTEPIWNSEDNRKKSLE 126

Query: 118 VVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGY 177
           V+ E   F++ Y  P A  + F                               LV+D G+
Sbjct: 127 VLLEGMDFEACYLTPTATAVSFAMGRPTC------------------------LVVDIGH 162

Query: 178 NCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETIS------------------YRHYD 219
           + + + P+I G+   K+  +  + G  LN L++ ++                    R +D
Sbjct: 163 DITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPREILPLFQVAKKRPEFVKRSFD 222

Query: 220 VTDESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLP 279
                 L+N       F++   + + FK+  L     V P   T F   +  + K S   
Sbjct: 223 YEIHPSLLN-------FVNERQFFQEFKETML----QVAPTSLTKFKSELEQLSKRSIEA 271

Query: 280 EHSQSIILEDEL-FSVPEGFFHPEMAN------VLKPGIIET 314
              + ++ + E  F++ E  F PE A       + K G++ET
Sbjct: 272 PWGEDLVFDSETRFNIAEQLFRPETAKFPEDWPISKDGVVET 313

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 4/116 (3%)

Query: 301 PEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQT 360
           PE  N +  G+ + I  S+      LR+ + +N+V TGG+ +IP    RI  EL K +  
Sbjct: 367 PEAKNEIS-GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPA 425

Query: 361 -EWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
            ++    S      + Q+W             +    V KQEY E G +   K RF
Sbjct: 426 LKFRMLTSGQAREKQYQSWLGGSILASLG--TFHQLWVGKQEYAEVGADRLLKDRF 479

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 88/216 (40%), Gaps = 38/216 (17%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNAL----AKDKYETYYLSNQINNIKDISSVSIKR 59
           + ++ID GSY    GYS  + P   L ++      DK      S Q   I       +K 
Sbjct: 15  SAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKSTSDKDSKTIFSEQSIGIPR-KDYELKP 73

Query: 60  PHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL--VLTETPMTLPELSRNTDQ 117
             + G ++ W+   E W +   N       E+  DS + +  +LTE      E  + + +
Sbjct: 74  IIENGLVIDWDTAQEQWQWALKN-------ELYLDSNSGIPALLTEPVWNSTENRKKSLE 126

Query: 118 VVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGY 177
           V+ E   F++ Y AP +  + F     N                         LV+D G+
Sbjct: 127 VLLEGMQFEACYLAPTSTCVSFAAGRPNC------------------------LVVDIGH 162

Query: 178 NCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETI 213
           +   + P++ G+   K+ ++  + G+F+N L+K+ I
Sbjct: 163 DTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 3/107 (2%)

Query: 310 GIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQT-EWVCDVSI 368
           G+ + +  S+      LR+ + +N+V TGG  +IP    R+ TEL K + + ++    + 
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 369 PKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
                + Q+W      T      +    V KQEY E G +     RF
Sbjct: 444 HTRERQYQSWLGGSILTSLG--TFHQLWVGKQEYEEVGVDRLLNDRF 488

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 89/224 (39%), Gaps = 45/224 (20%)

Query: 6   LLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDI-----SSVSIKRP 60
           ++ID GSY    GYS  + P     ++    Y  Y  + +  N K        S+ + RP
Sbjct: 15  IVIDPGSYTTNIGYSGSDCP----ESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLARP 70

Query: 61  H-------QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSR 113
                   + G++  W+   E WD+   N        +  +S   ++LTE      E  +
Sbjct: 71  DYEIKRIVENGEIADWDTAQEQWDWVLKNE-----LFLKSNSGIPVLLTEPIWNSVENRK 125

Query: 114 NTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVI 173
            + +V+ E   F++ Y +P +  + F     N                         LV+
Sbjct: 126 KSLEVLLEGMDFEACYLSPVSTCVSFAAGRPNC------------------------LVV 161

Query: 174 DSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRH 217
           D G++ + + P+I G+   K+  +  + GR++N L++  +  R 
Sbjct: 162 DIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKPRE 205

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 310 GIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQV 358
           GI + +  S+      LR+ + +N+V TGG   IP    R+  EL K++
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSKRL 458

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 86/219 (39%), Gaps = 35/219 (15%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNA-----LAKDKYETYYLSNQINNIKDISSVSIK 58
           + ++ID GSY    GYS  ++P + + +        +K      ++Q   +       IK
Sbjct: 15  SAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKKSFNDQFMGMAR-PDFEIK 73

Query: 59  RPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQV 118
           R  + G +V WE   E W +   +   F  F+          LTE      E  + + +V
Sbjct: 74  RILEDGCVVDWEAAQEQWTWAIRDELKFGSFK-----GTPAFLTEAIWNSEENRKKSLEV 128

Query: 119 VFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYN 178
           + E   F++ Y AP A  + F                               LV+D G++
Sbjct: 129 LLEGMEFEACYIAPTATCVSFAMGRPTC------------------------LVVDIGHD 164

Query: 179 CSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRH 217
            + + P++ G+   K+  +  + G+ LN L+++ +  R 
Sbjct: 165 VASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 303 MANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEW 362
           +AN++   I+ET ++        LR+ + +N+V TGG+ +I     R+ TEL K++    
Sbjct: 377 LANLVNTAIMETDVD--------LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPA-L 427

Query: 363 VCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
              +       E Q+   +     ++   +    V +QEY E G E   K RF
Sbjct: 428 KFRILTSGHLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 74/337 (21%), Positives = 128/337 (37%), Gaps = 67/337 (19%)

Query: 6   LLIDNGSYEIKFGYSNQETPFVAL-------NALAKDKYETYYLSNQINNIKDISSVSIK 58
           ++ID GSY    GYS  ++P + +        A  K+  +++   N    I       IK
Sbjct: 17  VVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSF---NDQFMIMPRPDFEIK 73

Query: 59  RPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQV 118
           R  + G +V WE   E W +   +   F+ F+          LTE      E  + + +V
Sbjct: 74  RILENGCVVDWEAAQEQWAWAIRDELKFESFK-----GTPAFLTEAIWNPEENRKKSLEV 128

Query: 119 VFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYN 178
           + E   F++ Y AP A    F                               LV+D G++
Sbjct: 129 LLEGMEFEACYIAPTATCTSFAMGRPTC------------------------LVLDIGHD 164

Query: 179 CSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRH----YDVTD----------ES 224
            + + P++ G+   K+  +  + G+ LN L++  +  R     Y V            E 
Sbjct: 165 VASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRELVPLYKVERKRPEFVPKKFEF 224

Query: 225 MLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQS 284
            +  ++ E   F +   +++  K+  L      LP FQ+     +    K S      ++
Sbjct: 225 TVSKSVDE---FANSRGFLQECKETMLHVAAVELPKFQSE----LETTSKRSIEAPWGEN 277

Query: 285 IILE-DELFSVPEGFFHP--EMA----NVLKPGIIET 314
           II + +  +S  E  F P  EM      V K G++ET
Sbjct: 278 IIFDSNARYSFAEQLFKPTKEMLPSDWPVTKDGVVET 314

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 1/90 (1%)

Query: 326 LRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFT 385
           LR+ + +N+V TGG+ +IP    R+ TEL K++       +       E Q+   +    
Sbjct: 392 LRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPA-LKFRILTSGHLRERQSRAWLGGSI 450

Query: 386 ENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
            ++   +    V +QEY E G E   K RF
Sbjct: 451 LSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 97/236 (41%), Gaps = 63/236 (26%)

Query: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNI-----KDIS----- 53
           P+ ID GS +I+ GY+NQ TP  +  N L      T Y   +IN        D+S     
Sbjct: 38  PIAIDFGSSQIRAGYTNQSTPSHIFPNRL------TRYRDRKINKTFTFIGNDVSLDQAI 91

Query: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSR 113
               K P     + +W+   +I  Y F    +  G   +    N ++LTE   TL     
Sbjct: 92  RTQSKSPFDGSIITNWDYVEDIMQYIF----NHLGVVGHNGVSNPILLTEKLATLQSQRS 147

Query: 114 NTDQVVFEEY-------GFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNY 166
           N  Q++FE +       G DS++                +F  L+ +S T          
Sbjct: 148 NWYQLLFECFDIPEVTLGIDSMF----------------AFYGLNERSST---------- 181

Query: 167 QDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGR----FLNGLLKETISYRHY 218
               LVID G   + +IP+++G       K+++ GGR    +LN LL  T+ Y ++
Sbjct: 182 ---GLVIDCGNEETDVIPVVEGAGMLTDAKRINWGGRQAVDYLNDLL--TLKYPYF 232

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 63/143 (44%), Gaps = 14/143 (9%)

Query: 268 YVRDMKKHSTLPEHSQ-SIILEDELFSVPEGFFHPEMANVLKPGIIE---TILESLF--- 320
           ++R  + H +   H Q  + L  E   VPE  F P M    + GIIE   TIL   F   
Sbjct: 591 FLRGPRPHDSEDIHQQHQMHLNVERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSE 650

Query: 321 ---ILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQN 377
              + P +L   M NN+  TGGN  +P    RI  E    +      +V     N  L  
Sbjct: 651 QRKLSPTAL--AMANNLWITGGNSKLPGMKERIVKEFTGFLPVGTAFNVK-QSYNPSLDA 707

Query: 378 WKAMKSFTENNEELYKHTRVTKQ 400
           W  M   T N+E+ YK+T ++K+
Sbjct: 708 WNGMAKLTLNSED-YKNTIISKK 729

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 90/221 (40%), Gaps = 48/221 (21%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRPH-- 61
           + ++ID GSY    GYS  + P   L ++         L+   N+ K  S  SI  P   
Sbjct: 15  SAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK------LTADENSKKMFSEQSIGIPRKD 68

Query: 62  -------QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL--VLTETPMTLPELS 112
                  + G ++ W+   E W +   N       E+  DS + +  +LTE      E  
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALRN-------ELYLDSNSGIPALLTEPVWNSMENR 121

Query: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172
           + + +V+ E   F++ Y AP +  + F     N                         LV
Sbjct: 122 KKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNC------------------------LV 157

Query: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETI 213
           +D G++   + P++ G+   K+ ++  + G+F+N L+++ +
Sbjct: 158 VDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 46/107 (42%), Gaps = 3/107 (2%)

Query: 310 GIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQT-EWVCDVSI 368
           G+   +  S+      LR+ + +N+V TGG  +IP    R+ TEL K + + ++    + 
Sbjct: 383 GLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 442

Query: 369 PKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
                + Q+W      T      +    V KQEY E G E     RF
Sbjct: 443 HIRERQYQSWLGGSILTSLG--TFHQLWVGKQEYEEVGIERLLNDRF 487

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 89/229 (38%), Gaps = 48/229 (20%)

Query: 6   LLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDI--------SSVSI 57
           ++ID GSY    GY+  + P   L +   + +E    +++ N  K           S+ I
Sbjct: 17  VIIDPGSYTTNIGYAGTDCPQSILPSSFGEIHEAEESTSEDNTEKTRKTRKVFSEQSIPI 76

Query: 58  KRPH-------QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL--VLTETPMTL 108
            RP        + GQ+  W+   E W +   N       E++ +S   +  +LTE     
Sbjct: 77  PRPDYEVKRVVENGQVCDWDSAVEQWSWALRN-------ELHIESNRGIPAMLTEPLWNS 129

Query: 109 PELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQD 168
            E    + +++ E   F++ Y    +  + F     NS                      
Sbjct: 130 KENRSKSLEILLEGMEFEACYLTATSTAVSFATGRPNS---------------------- 167

Query: 169 FNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRH 217
             L++D G++ + + P+I G+   K+ +     GRFLN LL + +  R 
Sbjct: 168 --LIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 309 PGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTEL 354
           PGI++ I  S+      +R+ + +N+V TGG+  IP    RI  EL
Sbjct: 387 PGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNEL 432

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 89/232 (38%), Gaps = 49/232 (21%)

Query: 6   LLIDNGSYEIKFGYSNQETPF---------VALNALAKDKYETYYLSNQINNI--KDISS 54
           ++ID GS+    GYS  + P          ++L  +A +  E    ++  NN   K    
Sbjct: 17  VVIDPGSFTTNIGYSGTDCPQAILPSYYGEISLKEVASEGNEEIEENSASNNKSKKIFGE 76

Query: 55  VSIKRPH---------QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETP 105
            SI  P          + G+++ W+   E WD+   N        +  +S     LTE  
Sbjct: 77  QSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKNA-----LYLESNSGIPAFLTEPI 131

Query: 106 MTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENN 165
               E  + + +V+ E   F++ Y +P    I F     N                    
Sbjct: 132 WNTVENRKKSLEVLLEGLQFEACYLSPTPTCISFASGRPNC------------------- 172

Query: 166 YQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRH 217
                LV+D G++ + + P+I G+   K+  +  + GRF+N  +KE +  R 
Sbjct: 173 -----LVVDIGHDVASVSPVIDGMTLSKSSMRNFISGRFINEKIKEFLKPRE 219

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 4/117 (3%)

Query: 300 HPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQ 359
           +P  ++V+ PGI++ I  S+      LR+ + +NIV TGG   IP F  R+  EL K++ 
Sbjct: 387 NPTESSVI-PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLP 445

Query: 360 T-EWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
             ++    +      + Q W      +      +    V KQEY E G +   K RF
Sbjct: 446 ALKFRVLTTGQTRERQYQAWLGGSILSSLG--TFHQLWVGKQEYEESGADRLLKDRF 500

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/238 (18%), Positives = 91/238 (38%), Gaps = 61/238 (25%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISS--VSIKRPH 61
           + ++ID GSY    GYS  + P    +++   +Y ++  +N+ +  +D  S   + KR H
Sbjct: 15  SAVVIDPGSYSTNIGYSGTDCP----HSILPSRYGSFKKTNKDSGDEDTKSDESATKRAH 70

Query: 62  --------------------QLGQLVSWELEHEIWDYCFYNG---DDFKGFEVNEDSENH 98
                               + G +  W+   E W++   N    +  KG          
Sbjct: 71  IFSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNELFLESTKGIPA------- 123

Query: 99  LVLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYL 158
            +LTE      +  + + + + E   F++ Y AP +  + F     N             
Sbjct: 124 -LLTEPVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFATGRANC------------ 170

Query: 159 DGSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYR 216
                       LV+D G++   + P++ G+   K+ ++    G+++N L++  +  R
Sbjct: 171 ------------LVVDIGHDTCSVSPVVDGMTLSKSTRRSFFAGKYINHLIENFLKPR 216

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 44/107 (41%), Gaps = 3/107 (2%)

Query: 310 GIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQT-EWVCDVSI 368
           G+ + +  S+      LR+ + +N+  TGG   IP    R+  EL  ++   ++    + 
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 369 PKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
            K   E Q+W      T      +    V +QEY E G +     RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLG--TFHQLWVGRQEYEEVGADRLLNDRF 504

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 85/218 (38%), Gaps = 41/218 (18%)

Query: 6   LLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRPH---- 61
           ++ID GS+    GYS  + P   L +         Y   + + +    S+ + R      
Sbjct: 17  VVIDPGSFTTNIGYSGTDCPQAILPSCYGK-----YTEGEKDELFSEQSIGLPRKDYEIH 71

Query: 62  ---QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQV 118
              Q G++V WE   + WD+   +  + + FE N  S    +LTE      E  + + +V
Sbjct: 72  NIVQNGEVVDWEKAEKQWDWAIRS--ELR-FETN--SGMPALLTEPIWNSEENRKKSLEV 126

Query: 119 VFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYN 178
           + E   F + Y  P A  + F                               LV+D G++
Sbjct: 127 LLESMDFSACYLVPTATAVSFAMGRPTC------------------------LVVDIGHD 162

Query: 179 CSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYR 216
            + + P++ G+   K+  +  + G  LN L++  ++ R
Sbjct: 163 VTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPR 200

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 44/107 (41%), Gaps = 3/107 (2%)

Query: 310 GIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQT-EWVCDVSI 368
           G+ + I  S+      LR+ + +N+V TGG  ++P    RI  EL + +   ++    S 
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 369 PKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
                + Q W             +    V KQEY E G +   K RF
Sbjct: 434 QLRERQYQGWLGGSILASLG--TFHQLWVGKQEYAEVGADRLLKDRF 478

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 84/218 (38%), Gaps = 36/218 (16%)

Query: 4   APLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRPH-- 61
           + ++ID GSY    GYS  + P   L +   D   T     +   +    S+ I R    
Sbjct: 15  SAVVIDPGSYSTNIGYSGTDCPQAILPSCYGDYTNTDDPEGKKKKVFSEQSICIPRKDYE 74

Query: 62  -----QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTD 116
                + G ++ W+   E W +   N        +  +S    +LTE      E  + + 
Sbjct: 75  IKPIVENGVVIDWDAAQEQWSWALENQ-----LYLRSNSGIPALLTEPIWNTVENRKKSL 129

Query: 117 QVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSG 176
           +++ E   F++ Y A     + F           +G+S                LV+D G
Sbjct: 130 ELLLEGMDFEACYLASTPTCVSF----------GTGRSSC--------------LVVDLG 165

Query: 177 YNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETIS 214
           ++   + P++ G+   K+ K+    G +LN L+K  IS
Sbjct: 166 HDTCSVSPVVDGMTLSKSTKRNFFAGGYLNELIKNYIS 203

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 44/107 (41%), Gaps = 3/107 (2%)

Query: 310 GIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQT-EWVCDVSI 368
           G+ + +  S+      LR+ + +N+V TGG   IP    R+  EL  ++   ++    + 
Sbjct: 380 GVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPALKFRMITTG 439

Query: 369 PKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
                + Q+W      T      +    V K+EY + G +     RF
Sbjct: 440 HTRERQYQSWLGGSVLTSLG--TFHQLWVGKEEYQDVGVDRLLADRF 484

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 68/313 (21%), Positives = 130/313 (41%), Gaps = 52/313 (16%)

Query: 6   LLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDI----SSVSIKRPH 61
           ++ID GS+    GYS  + P   + + +    ET   + +I N + +    + + IK   
Sbjct: 17  IVIDPGSFVTNIGYSGTDCPQSIMPS-SYGNVETDGDTKRIFNEQPLLFPRAGMEIKPIV 75

Query: 62  QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTD-QVVF 120
           +   +V W+   E W+Y      D K FE N+ +   ++LTE P+   E SR    +++ 
Sbjct: 76  ENSTIVDWDRAQEQWEYALNT--DLK-FESNKGTP--VLLTE-PIWNSEASRKKSLEILL 129

Query: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNCS 180
           E   F++ Y A  ++ + F                               LV+D G++ S
Sbjct: 130 ESMEFEACYLAANSSAVSFAMGRPTC------------------------LVVDIGHDVS 165

Query: 181 WIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRH----YDVTDES------MLVNNI 230
            + P+I G+   K+  +  + G++LN L+ + +  R     + V  +        L  ++
Sbjct: 166 TVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREIVPIFQVLKKKPDFVKRTLSFDV 225

Query: 231 KENCM-FISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE- 288
            E+ + F +   + + FK+  L    ++ P   +SF   +    K S      + +I + 
Sbjct: 226 NESVINFANERQFFQEFKETLL----HIAPKSLSSFKDELATQTKRSLEAPWGEELIFDA 281

Query: 289 DELFSVPEGFFHP 301
           D  +S  E  F P
Sbjct: 282 DTRYSFAEQLFRP 294

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%)

Query: 310 GIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQV 358
           GI++ I +S+      LR+ + +N+V TGG   IP    RI  EL K +
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSL 463

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 64/168 (38%), Gaps = 35/168 (20%)

Query: 53  SSVSIKRPHQLGQLVSWELEHEIWDYCFYNG---DDFKGFEVNEDSENHLVLTETPMTLP 109
           S   +KR  + G +  W++  E W +        D FKG           +LTE      
Sbjct: 157 SDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSFKGIPA--------LLTEPVWNTV 208

Query: 110 ELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDF 169
           +  + + +V+ E+  F++ Y       + F     N                        
Sbjct: 209 QNRKKSLEVLLEKMEFEACYLTTIPTNVSFAAGKPNC----------------------- 245

Query: 170 NLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRH 217
            LV+D G++   + P+I G+   K+V++    GR+LN LL+  I  R 
Sbjct: 246 -LVVDVGHDTCSVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 61/137 (44%), Gaps = 4/137 (2%)

Query: 280 EHSQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGG 339
           E+ +  I + E   VP+     ++ N++ PGI + +  ++      LR+ + +N++ TGG
Sbjct: 462 ENGKRSIEDGENVDVPKKSDKKDIDNII-PGIADLVEATVNSSDVDLRATLAHNVILTGG 520

Query: 340 NFNIPNFGSRIYTELQKQVQT-EWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVT 398
              IP    R+  EL K++   ++    S  +   + Q W      T      +    V 
Sbjct: 521 TSLIPGLADRLMYELNKKLPALKFRILSSGHRRERKYQAWLGGSILTSLG--TFHQLWVG 578

Query: 399 KQEYNEHGFEWTTKQRF 415
           K+EY E G +   K RF
Sbjct: 579 KREYEEVGPDRLLKDRF 595

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/222 (19%), Positives = 84/222 (37%), Gaps = 39/222 (17%)

Query: 6   LLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDI---SSVSIKRPH- 61
           ++ID GS+    GYS  + P   L +      ET          K I   SS+ I RP  
Sbjct: 17  VIIDPGSFSTNIGYSGTDYPQSILPSSYGTYKETTEGQESTTKRKRIFSESSIQIPRPDY 76

Query: 62  ------QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNT 115
                 + G ++ W+   E W +   +        +   S    +LTE      E  + +
Sbjct: 77  EIKRIVENGSIMDWDAAQEQWSWALKSQ-----LHLQSTSGIPALLTEPIWNSVENRKKS 131

Query: 116 DQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDS 175
            +++ E   F++ Y +     + F     N                         LV+D 
Sbjct: 132 LEILLEGMNFEACYLSSVPTCVSFAAGRPNC------------------------LVVDI 167

Query: 176 GYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRH 217
           G++ + + P++ G+   K+  +  + G+++N L+++ +  R 
Sbjct: 168 GHDTTSVSPVVDGMTLSKSSMRNFIAGKYINTLIEKYLQPRE 209

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 45/107 (42%), Gaps = 3/107 (2%)

Query: 310 GIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIP 369
           G+ + +  ++      LR+ + +N+V TGG+ +IP    R+  EL +++       +S  
Sbjct: 392 GLADLVYSAIIKSDVDLRASLAHNVVLTGGSSSIPGLSDRLILELNRRLPALKFRILSTG 451

Query: 370 KAN-AELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
                + Q W      T      +    V K EYNE G E     RF
Sbjct: 452 HTKERQYQAWLGGSILTSLG--TFHQLWVGKNEYNEVGVERLLMDRF 496

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 87/214 (40%), Gaps = 33/214 (15%)

Query: 171 LVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNI 230
           LV+D G   S + P+I G     AV +    G FL+  + E ++       +E    NN 
Sbjct: 138 LVVDVGAAKSTVTPIIDGTVVQTAVARSKFAGDFLDMQVNELLTKIAPIKDEEEGDPNNR 197

Query: 231 KENCMFI--SPVSYIESFKKKALTKVEYVLPDFQTS---FMG--YVRD--MKKHSTLPEH 281
           K+  + +  +  ++I+ FK   L      L D  ++    MG  Y+++  ++K  T+   
Sbjct: 198 KDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQDLDSAALDMMGLTYIKNFLLQKQKTIS-- 255

Query: 282 SQSIILEDELFSVPEGFFHPEMAN---VLKPGIIETILESL---------------FILP 323
               + + +   + EG F P   +   V   G+ E + +S+                  P
Sbjct: 256 ----LTQKQCCELAEGLFQPRSVSQQFVAAEGLSEIVAKSVKKAGASTATSSSATNVTTP 311

Query: 324 ESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQ 357
           E   + ++ NI+ TG +  I     RI  +L  Q
Sbjct: 312 EQTHAALLTNILITGSSSLISGLEQRIVNDLSYQ 345

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/238 (19%), Positives = 95/238 (39%), Gaps = 55/238 (23%)

Query: 6   LLIDNGSYEIKFGYSNQETPFVALNAL------AKDKYETYYLSNQ--INNIKDISSVSI 57
           ++ID GS+    G+S  + P   L +        +D+   +   ++   NN ++ S + I
Sbjct: 17  VVIDPGSFTTNIGFSGSDYPQSILPSCYGAITEIEDQQADHNKPDESAANNTENASKIKI 76

Query: 58  KR---------PH---------QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHL 99
           ++         P          Q G++V W+   E W +   N    K  E         
Sbjct: 77  RKVFNEQSVGYPRANYEIKPIVQNGEVVDWDAAQEQWSWALENELFLKSNE-----GVPA 131

Query: 100 VLTETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLD 159
           +LTE      E  + + +V+ E  GF++ Y +     + F           +G+S     
Sbjct: 132 LLTEPIWNTVENRKKSLEVLLEGMGFEACYLSATPTCVSF----------AAGRSNC--- 178

Query: 160 GSKENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRH 217
                      LV+D G++   + P++ G+ + K+ ++  + G++LN L+ + +  R 
Sbjct: 179 -----------LVVDIGHDIISVSPVVDGMTFSKSTRRNVISGKYLNVLINDFLKPRE 225

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 47/108 (43%), Gaps = 3/108 (2%)

Query: 309 PGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQT-EWVCDVS 367
           PGI++ I  S+      LR+ + +N+V TGG   IP    RI  EL K++   ++    +
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLAN 456

Query: 368 IPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
                 + Q+W      +      +    V KQEY E G +     RF
Sbjct: 457 GQTRERQYQSWLGGSILSSLG--TFHQLWVGKQEYEEIGADRLLTDRF 502

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/216 (20%), Positives = 82/216 (37%), Gaps = 39/216 (18%)

Query: 6   LLIDNGSYEIKFGYSNQETPFVALNAL-AKDKYETYYLSNQINNIKDISSVSIKRPH--- 61
           ++ID GS+    G+S  + P   L +   + K ET    N    I    S+ I RP    
Sbjct: 17  VVIDPGSFSTNIGFSGTDCPQAILPSCYGEQKAETE--DNAPKKIFAEQSIGIPRPDYEI 74

Query: 62  ----QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQ 117
               Q   +V W+   E W +   +        +N +S    +LTE      E    + +
Sbjct: 75  KPIVQNSMVVDWDAAEEQWSWALKDI-----LYLNSNSGIPALLTEPIWNTLENKTKSLE 129

Query: 118 VVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGY 177
           ++ E   F++ Y +     + F     N                         LV+D G+
Sbjct: 130 ILLESLQFEACYLSSTPTCVSFASGRPNC------------------------LVVDLGH 165

Query: 178 NCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETI 213
           + + + P++ G+   K+  +  + G  +N L+K+ +
Sbjct: 166 DTTSVSPVVDGMTLSKSTMRNFLAGNCINELIKKPL 201

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 46/107 (42%), Gaps = 3/107 (2%)

Query: 310 GIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQT-EWVCDVSI 368
           G  + +  S+      LR+ + +NIV TGG  +IP F  R+ +EL K++   ++    + 
Sbjct: 375 GAADLVNASILASDVDLRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTG 434

Query: 369 PKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
                + Q W      T      +    V KQEY E G +     RF
Sbjct: 435 HLRERQYQAWLGGSILTSLGS--FHQLWVGKQEYEEVGPDRLLSDRF 479

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 50/117 (42%), Gaps = 4/117 (3%)

Query: 300 HPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQ 359
           +PE  N +  G+ + I  S+      LR+ + +N+V TGG  +IP    RI  EL K + 
Sbjct: 383 NPESKNEIA-GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLP 441

Query: 360 T-EWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
             ++    S      + Q+W      +      +    V KQEY E G     K RF
Sbjct: 442 ALKFRMLTSGHLKERQYQSWLGGSILSSLG--TFHQLWVGKQEYEEVGASRLLKDRF 496

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 46/232 (19%), Positives = 79/232 (34%), Gaps = 60/232 (25%)

Query: 6   LLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNI------------KDIS 53
           ++ID GSY    GYS  + P V L +    +Y  Y    +  +             K  S
Sbjct: 17  VVIDPGSYTTNIGYSGTDCPQVTLPS----RYGQYISEEEEKDEQEQQEDDRKLKQKVFS 72

Query: 54  SVSIKRPH---------QLGQLVSWELEHEIWDYCFYNGDDF---KGFEVNEDSENHLVL 101
             SI  P          + G ++ W+   E W +   +   F   KG            L
Sbjct: 73  EQSIGLPRNNYQIKPIVRNGSVIDWDSAQEQWSWAIQHELHFESTKGMPA--------FL 124

Query: 102 TETPMTLPELSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGS 161
           TE      E  + + +V+ E   F++ + +P    + F                      
Sbjct: 125 TEPIWNTEENRKKSLEVLLENMEFEACFLSPTPTCVSFAMGRPTC--------------- 169

Query: 162 KENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETI 213
                    LV+D G++   + P++ G+   K+     + G  LN LL + +
Sbjct: 170 ---------LVVDIGHDVCSVSPVVDGMTLSKSSTSNFIAGSLLNALLSKQL 212

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 114/271 (42%), Gaps = 51/271 (18%)

Query: 6   LLIDNGSYEIKFGYSNQETPFVAL-NALAKDK-----YETYYLSNQINNIKDISSVSIKR 59
           ++I NG+     G+SN E P   + ++  K K     + T+ + + + +    S +    
Sbjct: 9   VVIHNGTSTTIAGFSNSEIPKCIIPSSYLKKKDGSFVFGTFDMMDSLEDEGAESDIFTIV 68

Query: 60  PHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVL--TETP--MTLPE-LSRN 114
             QLG   +WE   + W+Y F               E  L    TE P  +T+P  +S+N
Sbjct: 69  DSQLGVPYNWEALEKQWEYIF---------------EKQLKCDPTELPVLITIPSSISKN 113

Query: 115 TD--QVVFEEYGFDSLYKAPAANFIPFIKNDDNSF-IRLSGKSKTYLDGSKENNYQDFNL 171
            D    V E+Y   +  K      IP+++  + S  I L    KT             +L
Sbjct: 114 EDIENKVIEQYCKIAFEKFK----IPYLQIVNESLSISLGLGKKT-------------SL 156

Query: 172 VIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIK 231
           VID   + S + P++ GV     + K   GG FL+  + +  S    D+ +E    +NI 
Sbjct: 157 VIDISGSGSSVTPIVDGVIIKNGIVKSKYGGDFLDYQIIKKFSTIDEDLEEEMTNSSNI- 215

Query: 232 ENCMFISPVSYIESFKKKALTKVEYVLPDFQ 262
               ++S  S+I++FKK  L   +  L D +
Sbjct: 216 ----WVSSNSWIKNFKKTMLQVTDKKLQDVE 242

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 86/212 (40%), Gaps = 33/212 (15%)

Query: 171 LVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNI 230
           L++D G   + + P+I G     A+ +    G FL+  + + +S +      E       
Sbjct: 94  LIVDLGAAKATVTPVIDGTVVQAAIGRSRFAGDFLDLQVGKLLSEKDDKQNGEESHEPTP 153

Query: 231 KENCMFISPVSYIESFKKKALTKVEYVLPDFQTS---FMG--YVRDM--KKHSTLPEHSQ 283
            E  ++ +  ++I+ FK   L      L D  ++    MG  YV++   ++  T+     
Sbjct: 154 LE--LWRNSRTWIQDFKSYMLQVAPSKLQDLDSAALDMMGLSYVKNFLYRRQKTIS---- 207

Query: 284 SIILEDELFSVPEGFFHPEMAN---VLKPGIIETILESL---------------FILPES 325
             +++ E  ++ EG F P   +       G+ E + +++                  PE 
Sbjct: 208 --LMQKECCALAEGLFQPSYVSQQFASSEGLSEIVAKAVKKAGASTATNSSATNATTPEQ 265

Query: 326 LRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQ 357
           + + ++ NIV TG +  IP    RI  +L  Q
Sbjct: 266 IHAALLTNIVITGSSSLIPGLEQRIVNDLSYQ 297

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 58/285 (20%), Positives = 114/285 (40%), Gaps = 48/285 (16%)

Query: 167 QDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETI--SYRHYDVTDES 224
           ++ +LV+D G +   + P+I G     AV +    G FL+  + E +  S       ++S
Sbjct: 137 RNTSLVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLDYQVAENLKNSLPIEPAGEDS 196

Query: 225 MLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQ-----TSFMGYVRDMKKHSTLP 279
            +  + K    + S  ++I  FK   L      + + +      +F     D KK+    
Sbjct: 197 KVPESFK---YWESSRTWIHDFKATMLQVSPSKIQELEGMQDTMAFSHNPLDNKKYFLYK 253

Query: 280 EHSQSIILED-ELFSVPEGFFHPEMAN---VLKPGIIETILESL---------------- 319
           + ++++ LE  E + + E  F P++A+     K G+ E +++++                
Sbjct: 254 KGNKTLTLEQRECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGAAVTTSNSGPAG 313

Query: 320 ----------------FILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWV 363
                              PE + + ++ NIV TG    +P    RI  EL  Q     +
Sbjct: 314 GGGPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVNELSYQFPQYKL 373

Query: 364 CDVSIPKA-NAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGF 407
              + P   + +LQ+W+   + + N         +T+QEY+ +G 
Sbjct: 374 SSFANPMVLDRKLQSWQGGVTMS-NLPSWELGNWITRQEYDANGI 417

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 310 GIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQT-EWVCDVSI 368
           GI + +  S+      LR+ + +NIV TGG+ ++P F  R+  EL K++   ++    + 
Sbjct: 378 GISDLVHSSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTKKLPALKFRVLTTG 437

Query: 369 PKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRF 415
                + Q+W      T      +    V K+EY E G E     RF
Sbjct: 438 HLRERQYQSWLGGSILTSLGS--FHQLWVGKREYEEVGAERLLNDRF 482

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 40/226 (17%), Positives = 85/226 (37%), Gaps = 48/226 (21%)

Query: 6   LLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDIS--------SVSI 57
           ++ID GS+    GYS  + P     A+    Y  +  +   +   + S        S++ 
Sbjct: 17  VVIDPGSFTTNIGYSGTDCP----QAILPSCYGHHKTNENADGDDEKSKPKVFAEQSLTF 72

Query: 58  KRPH-------QLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPE 110
            RP        + G +V W+   E WD+   N        +  +     ++TE+     E
Sbjct: 73  PRPDYEIKPIVENGLVVDWDAAQEQWDWALRNV-----LHLESNKGVPALMTESIWNTME 127

Query: 111 LSRNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFN 170
               + +V+ E   F++ Y +     + F     N                         
Sbjct: 128 NKTKSLEVLLETLDFEACYISSTPTCVSFATGRPNC------------------------ 163

Query: 171 LVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYR 216
           LV+D G++ +   P++ G+   ++ ++  + G+F++ L+ + +  R
Sbjct: 164 LVVDVGHDTASSSPVVDGMTLSRSTRRNFISGKFVDQLIGKYLQPR 209

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 65/319 (20%), Positives = 128/319 (40%), Gaps = 51/319 (15%)

Query: 6   LLIDNGSYEIKFGYSNQETPFVALNALAKDK-----YETYYLSNQINNIKDISSVSIKRP 60
           ++I NGS     G+SN E P   +++    K     + T+ + ++  + ++    +I   
Sbjct: 7   VVIHNGSSSTVAGFSNMELPQSIISSSYVQKGNERVFGTFAMLDECESKEECEVYTIMDK 66

Query: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120
           +  G   +WE     W Y +        +E+  D +   ++   P T  E+    D  V 
Sbjct: 67  N--GMPYNWEALEAQWRYLYE-------YELKVDPQELPLVISVPATHSEI----DPQVV 113

Query: 121 EEYGFD---SLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGY 177
           E Y FD   +  + PA   +     +  +     GKS                LVID G 
Sbjct: 114 ENY-FDLALNKLQVPALQIVV----EPLAVALAMGKSSA--------------LVIDVGA 154

Query: 178 NCSWIIPMIKGVPYYKAVKKMDMGGRFLN----GLLKETI-SYRHYDVTDESMLVNNIKE 232
             + + P++ G      V K   GG FL+     LL+E + S  H    + +  +   K 
Sbjct: 155 RGTTVTPIVDGTVVRSGVMKSRFGGDFLDYQVAKLLEEPLGSSSHEAWYNSATWIREFKS 214

Query: 233 NCMFISP--VSYIESFKKKALTKVEYVLPDFQTSFMGYVRD---MKKHSTLPEHSQSIIL 287
             + +    +S +E + +  L   +        ++  Y+ +    K++  L ++++++ L
Sbjct: 215 TMLQVCDKNLSELERYHRDQLLLQQQQQQQLGGAYHNYMTNPLTQKRNFLLKKNNKTVTL 274

Query: 288 E-DELFSVPEGFFHPEMAN 305
           E  + + V E  F P++A+
Sbjct: 275 ELRDCYRVCEYLFQPQLAS 293

>TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa]
          {ON} Anc_7.310 YDL195W
          Length = 1340

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 18/88 (20%)

Query: 9  DNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQIN-------------NIKDISSV 55
          DNGS    FG+S+  TP++A  A + D Y+T+  S+Q+N             +  DI  +
Sbjct: 8  DNGSI---FGWSSDVTPYLATGAGSSD-YDTFNTSSQVNENQPTLKLWSLISSKSDIPVL 63

Query: 56 SIKRPHQLGQLVSWELEHEIWDYCFYNG 83
          SI        L SW +++E+      NG
Sbjct: 64 SIDVDSTFNDL-SWSIDNEMIAGAMQNG 90

>YDR416W Chr4 (1298432..1301011) [2580 bp, 859 aa] {ON}  SYF1Member
           of the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; null
           mutant has splicing defect and arrests in G2/M; homologs
           in human and C. elegans
          Length = 859

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 29/57 (50%)

Query: 163 ENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD 219
           +N Y++F   ++  Y   W+  ++    YY +  ++D  G  L   L++T+ Y  +D
Sbjct: 284 DNQYEEFMRQMNGIYPDKWLFLILSLAKYYISRGRLDSCGDLLKKSLQQTLRYSDFD 340

>Smik_4.687 Chr4 (1219205..1221751) [2547 bp, 848 aa] {ON} YDR416W
           (REAL)
          Length = 848

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 13/57 (22%), Positives = 31/57 (54%)

Query: 163 ENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYD 219
           +N Y++F   ++  Y  +W+   +    YY +  ++D  G  L+  L++T+++  +D
Sbjct: 281 DNQYEEFMNQMNVMYAENWVFLTLSLAKYYISRGRLDSCGDLLDKSLRQTLNFSDFD 337

>Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034W
           (REAL)
          Length = 476

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 57/264 (21%), Positives = 99/264 (37%), Gaps = 53/264 (20%)

Query: 6   LLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRPHQ--- 62
           ++I NGS+    G+SN E P   + +    + +    +  I    D+   + ++ +    
Sbjct: 8   VVIHNGSHRTVAGFSNVELPQCIIPSSYVKRMDNAGEAQFIFGTYDMIDAAAEKHNGDEV 67

Query: 63  ------LGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPM--TLPELSRN 114
                  G   +WE     W Y +             D++  +   E P+  T+P  +  
Sbjct: 68  YTLIDGQGLPYNWEALELQWRYLY-------------DTQLKVSPEELPLVITMPATNGK 114

Query: 115 TDQVVFEEY---GFDSLYKAPAANFI--PFIKNDDNSFIRLS-GKSKTYLDGSKENNYQD 168
            D  + E Y    FD L K P    +  P         I LS GKS  +           
Sbjct: 115 PDMGILERYYELAFDKL-KVPVFQIVIEPLA-------IALSMGKSSAF----------- 155

Query: 169 FNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTD-ESMLV 227
              VID G +   + P+I G+    AV +   GG FL+  + E ++    +  D E+M  
Sbjct: 156 ---VIDMGASGCNVTPIIDGIVVKNAVVRSKFGGDFLDFQVHERLAPLIKEENDMENMAD 212

Query: 228 NNIKENCMFISPVSYIESFKKKAL 251
              +   ++    ++I+ FK   L
Sbjct: 213 EEKRSTDVWYDASTWIQQFKSTML 236

>TBLA0H03530 Chr8 complement(861391..862725) [1335 bp, 444 aa] {ON}
           Anc_8.523 YBR205W
          Length = 444

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 10/112 (8%)

Query: 69  WELEHEIWDYCFYNGDDFKGFEVNEDSENHLV-LTETPMTLPELSRNTDQVVFEEYGFDS 127
           W ++H++  +C    D FK   VN+     ++ L E P T+P L ++T +  F E   + 
Sbjct: 247 WRVDHDVKVHCKVQYDLFKFLRVNKKKYGFILSLHEYPETIPTLWQSTKE--FMEKHPEH 304

Query: 128 LYKAPAANFIPFIKNDDNSFIRLSGKSKTY----LDGSKENNYQDFNLVIDS 175
           + K    N + FI +D+     L      +    LD  +   YQD+   +DS
Sbjct: 305 VSK---NNLMKFISDDEGKTYNLCHFWSNFEVGSLDFFRSKQYQDYFKYLDS 353

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 4/87 (4%)

Query: 321 ILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEWVCDVSIP-KANAELQNWK 379
           I PE + SL++ N++ TGG   I     RI  EL  +     +   + P +    LQ W 
Sbjct: 434 ITPEHVYSLLLTNVIITGGTSLIDGMEQRIIRELSIRFPQYKLSTFTNPDQLQRSLQAWN 493

Query: 380 AMKSFTENNEELYKHTR-VTKQEYNEH 405
              S +  N   +  T+  TK+++N H
Sbjct: 494 GAVSLS--NLPKWGLTQWFTKEDFNNH 518

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,063,006
Number of extensions: 2512760
Number of successful extensions: 7972
Number of sequences better than 10.0: 167
Number of HSP's gapped: 7772
Number of HSP's successfully gapped: 208
Length of query: 421
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 309
Effective length of database: 40,638,807
Effective search space: 12557391363
Effective search space used: 12557391363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)