Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0A018208.261ON58158128620.0
TDEL0F038808.261ON57958416460.0
Kpol_543.378.261ON57858116300.0
SAKL0H17050g8.261ON58458016000.0
TBLA0F030808.261ON58357615990.0
Smik_12.1478.261ON61361615660.0
YLR088W (GAA1)8.261ON61461615500.0
Suva_10.1728.261ON61461615430.0
KLTH0G13706g8.261ON58458115300.0
KLLA0F19118g8.261ON57857015180.0
AGR087C8.261ON57757015120.0
CAGL0L12232g8.261ON59159215120.0
Skud_12.1568.261ON61261415070.0
Ecym_43098.261ON57757014750.0
NCAS0B038608.261ON58358314610.0
Kwal_56.238048.261ON57858514530.0
NDAI0J013908.261ON58358514530.0
ZYRO0C01672g8.261ON56957514510.0
KAFR0B055508.261ON55554714370.0
KNAG0H032508.261ON58558814320.0
CAGL0L02783g8.628ON89195810.34
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0A01820
         (581 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...  1107   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   638   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   632   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   620   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   620   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   607   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   601   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   598   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   593   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   589   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   587   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   587   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   585   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   572   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   567   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   564   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   564   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   563   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   558   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   556   0.0  
CAGL0L02783g Chr12 (324952..327627) [2676 bp, 891 aa] {ON} highl...    36   0.34 

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score = 1107 bits (2862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/581 (93%), Positives = 544/581 (93%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXCLPLDGQYRRTYISENALLP 60
           MALIEVLHRRATKLGLLPKVIGK                 CLPLDGQYRRTYISENALLP
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLILCLPLDGQYRRTYISENALLP 60

Query: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120
           SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL
Sbjct: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120

Query: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180
           YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN
Sbjct: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180

Query: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240
           PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV
Sbjct: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240

Query: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300
           AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI
Sbjct: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300

Query: 301 QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS 360
           QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS
Sbjct: 301 QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS 360

Query: 361 AVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQPHL 420
           AVCLSISFGISAAHSYINNQYITVPLSDN                    QINETFLQPHL
Sbjct: 361 AVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQPHL 420

Query: 421 MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL 480
           MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL
Sbjct: 421 MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL 480

Query: 481 AFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLISSFK 540
           AFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLISSFK
Sbjct: 481 AFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLISSFK 540

Query: 541 YMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKKNL 581
           YMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKKNL
Sbjct: 541 YMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKKNL 581

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/584 (53%), Positives = 414/584 (70%), Gaps = 12/584 (2%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXCLPLDGQYRRTYISENALLP 60
           M+LI  LHRR   LGL+PK++                    LPL+G+YRRTYISENALLP
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60

Query: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120
           SQAYSYFRE+EWN LRGYRT IE L +  +R RNE ++ WL +FG+K A+Y +   GDTL
Sbjct: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120

Query: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180
           YGV ++QRGDGTEA++LA PW N D  VN+ G ++GI+L+R+FSRWP+WSKNII+V+SEN
Sbjct: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180

Query: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240
           P  +M+SWV+AYH SLDLTGGS+EAA+VLD+P  ++YF+ VE++++G+NGE PNLD+VN+
Sbjct: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240

Query: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300
           AIS+ EHEG+KVSL G++  ++  + +++RL  +L G+KN+ALSG RK+ GNEAFSG RI
Sbjct: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300

Query: 301 QALTLKACGTEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLP 359
           QA+TLKA GTEG HD+TTFGRIPEA+FRS+NNLLEKFHQSFFFY L+APR+FVSI SYLP
Sbjct: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360

Query: 360 SAVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQPH 419
            AV LSISF +++  + INN Y  +PLS                      Q+   F  P 
Sbjct: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420

Query: 420 LMILAFLLISFLPL---TNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFG 476
           ++I    LISFLPL     I +P       L+YRLKS AF++ SLVLTSLL++NF LAF 
Sbjct: 421 ILISFSALISFLPLLLKKKIAEP-------LAYRLKSVAFLFFSLVLTSLLMVNFFLAFA 473

Query: 477 MGLLAFPLTFTKSCS-EMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDL 535
           MGL AFP+T  ++ S    + + K+ N   L +SNPFIA +IF   FE D+  F VF++ 
Sbjct: 474 MGLTAFPMTLVRTSSLNNYSLRIKLKNSILLLLSNPFIASYIFCQCFEPDLPGFTVFTEF 533

Query: 536 ISSFKYMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKK 579
            +++K +G WTW + CIGW  +W MV ++ L+T  + LD   KK
Sbjct: 534 ATAWKELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRKKK 577

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/581 (53%), Positives = 413/581 (71%), Gaps = 3/581 (0%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXCLPLDGQYRRTYISENALLP 60
           M+++E L RR    GLLPK +                    LP+DGQ+RRTYISENAL+P
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLMLYLPMDGQFRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120
           SQAYSYFRE+EWNILRGYR  IE L    +  RN ++SSWL +FG+K +VY N   GD+L
Sbjct: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120

Query: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180
           YGV+N+ RGDGTE++VLAVPWYN ++E N+ GAALG+SL+R+ SRWP+WSKNII+V SEN
Sbjct: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180

Query: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240
           P +A++SWV+AYH SLDLTGGS+EAA+VLD+P  S+YFE++E+++NG NG LPNLD+VN+
Sbjct: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240

Query: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300
           AIS+ EHEG+KVSL GL   EM    Y++RLK +  G KN AL+G R++YGNEAFSG RI
Sbjct: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300

Query: 301 QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS 360
           QALTLKA G   HD+TTFGR+ EA+FRS+NNLLEKFHQSFFFYFL+APR+FVSIGSYLP+
Sbjct: 301 QALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPA 360

Query: 361 AVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQPHL 420
           AV LSISF +++  S++NNQY+++  S                           + QP L
Sbjct: 361 AVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPLL 420

Query: 421 MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL 480
           ++L  ++IS +PL   P+ L   +P L+YRLK+ +F+Y+SLV+TSLLV+NF LAFGMGL 
Sbjct: 421 LLLGNVVISTIPLA-APKNLSISEP-LAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLF 478

Query: 481 AFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLISSFK 540
           A+P+T     +     + K  N   LAISNPFIA ++F++I E  +   E    L+ ++ 
Sbjct: 479 AYPMTLVM-LNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWN 537

Query: 541 YMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKKNL 581
            +G+WTW I CIGWF +W +V I+ L   +   + ++KK+L
Sbjct: 538 KLGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKKHL 578

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/580 (52%), Positives = 410/580 (70%), Gaps = 7/580 (1%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXC-LPLDGQYRRTYISENALL 59
           MAL+E LHRR   +GLLPK I                     +P DGQ+RRTYISENAL+
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDT 119
           PSQAYSYFRE+EWN+LRGYRT IE         RNE +SSWL  FG K A+Y N   G+T
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 120 LYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISE 179
           LYG+ ++ RGDGTEA+VLA PWYN++N+ N GG AL +SLSR+FSRWP+WSKNII+V+SE
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 180 NPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVN 239
           +P  A++SWV+AYH SLDLTGGS+EAA+V+DFP  +++F++VE++F+G+NGELPNLD+VN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 240 VAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRR 299
           VA+ + EHEG+KVSL G++  E+  + +F+R+KT++ GVKN ALSG +K +GNE FSG R
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 300 IQALTLKACGTEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYL 358
           I ++TLKACGT+G  DITTFGRIPEAIFRSVNNLLEKFHQSFFFY L+APR FVSIGSYL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 359 PSAVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQP 418
           P+AV LS+SF +++ ++ +NN+Y ++PL                       Q      QP
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 419 HLMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMG 478
            L++   +L+  +P   I    + I+   SYRLKSFA++Y S+VLTSLLV+NF+LAFG+G
Sbjct: 421 ELLLSLNVLLLLMP---IIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLG 477

Query: 479 LLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLISS 538
            LAFP+T  ++ S     ++++ NC  L ISNPFIAI++F    + ++   +VF  L S+
Sbjct: 478 CLAFPMTLVRTTSG--NLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSA 535

Query: 539 FKYMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTK 578
           +K +G WTW + CIGW  +W +V  + +D+    +  D K
Sbjct: 536 WKDLGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEK 575

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/576 (54%), Positives = 411/576 (71%), Gaps = 15/576 (2%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXCLPLDGQYRRTYISENALLP 60
           MAL+  +HRR   +GL+PK++ +                  LP+DGQYR TYISENAL+P
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120
           SQAYSYFRESEWNILRGYRT I+     P+R RN V++ WL +FG K +VY N   GDTL
Sbjct: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120

Query: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180
           YG++N+ RGDGTEAIVLA+PWYN D E N GGAALGI+LSR+FSRWPIWSKNII+V SEN
Sbjct: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180

Query: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240
           P  A++SWVDAYH+SLDLTGGS+EAAIV+D+PS S++F++VE+Y++GINGELPNLD++N+
Sbjct: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240

Query: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300
           AI + EHEG++VSL GL    ++ ++YF+RL+TLL G K++ LSG +  +GNEAFSG RI
Sbjct: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300

Query: 301 QALTLKACGT---EGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSY 357
           QA+TLKA  T     HDIT+FGRI EA FRSVNNLLEKFHQSFFFY ++AP++FVSI SY
Sbjct: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360

Query: 358 LPSAVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQ 417
           LPSAV  S++F IS+  SYINN Y T+P+                       +++  F +
Sbjct: 361 LPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420

Query: 418 PHLMILAFLLISFLP--LTN---IPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFA 472
           P L++L  + +S LP  L N   IP+P       LSYRLKS AF+YISLVLTSLLV+NF+
Sbjct: 421 PRLLVLGSVFLSVLPHLLGNRFTIPEP-------LSYRLKSIAFLYISLVLTSLLVLNFS 473

Query: 473 LAFGMGLLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVF 532
           LAFG+G+L F +T  K+ +   + + +V N  +L +SNPF ++ +F  IF+ DI   ++F
Sbjct: 474 LAFGIGILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIF 533

Query: 533 SDLISSFKYMGNWTWAITCIGWFTTWQMVYIANLDT 568
            + I S+  +  WTW I C+GW   W +V I+++ T
Sbjct: 534 YEFIHSWNTLNCWTWFIICVGWLPPWILVSISSIQT 569

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/616 (49%), Positives = 414/616 (67%), Gaps = 39/616 (6%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXCLPLDGQYRRTYISENALLP 60
           MAL+E LHRR   +GL+P++I                    LP+DGQYRRTYISENAL+P
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120
           SQAYSYFRESEWNILRGYR+ IE +++  +  RN ++ SWL +FG K A+Y+N   G+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180
           YGV ++ RGDGTEA+VLAVPW+N+D++ N+GGAALG+SL+R+FSRWP+WSKNII+V SEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180

Query: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240
           P  A++SWV+AYH SLDLTGGS+EAA+V+D+ S  ++FE+VE+ ++G+NGELPNLD+VNV
Sbjct: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240

Query: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300
           AIS+ EHEG+KVSL GL L ++  ++Y++RLK L  G+++ AL+G +  +GNEAFSG RI
Sbjct: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300

Query: 301 QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS 360
           Q++TLKA G  GHDITTFGRIPEA+FRS+NNLLEKFHQSFFFY L+APR FVSI SYLPS
Sbjct: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQPHL 420
           AV LS++F IS+ +++INN Y ++ +                       Q+        L
Sbjct: 361 AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL 420

Query: 421 MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL 480
           ++   ++  FLPL  I    + I   LSYRLK+ AF+Y SLVLTSLL++NFA+A  +G L
Sbjct: 421 LMAISMISCFLPL--ILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTL 478

Query: 481 AFPLTFTKSCSEMITFKSKVINCFYLAI-------------------------------- 508
           AFP+T  K+  E  + + +V    Y++I                                
Sbjct: 479 AFPMTLVKTIIES-SGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLL 537

Query: 509 ----SNPFIAIFIFVSIFEDDITNFEVFSDLISSFKYMGNWTWAITCIGWFTTWQMVYIA 564
               +NPFI+I IF S F+D+   F+V + L+S++  +  W+W + CIGW   W +V  +
Sbjct: 538 LLVLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLAS 597

Query: 565 NLDTPRSALDGDTKKN 580
           + ++ R  L    K++
Sbjct: 598 SFESKRVMLKSKEKQS 613

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/616 (49%), Positives = 409/616 (66%), Gaps = 38/616 (6%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXCLPLDGQYRRTYISENALLP 60
           MAL+E LHRR   +GL+P++I                    LP+DGQYRRTYISENAL+P
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120
           SQAYSYFRESEWNILRGYR+ I+ +++  +  RN ++ SWL +FG K A+Y+N   G+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180
           YGV ++ RGDGTEA+VLAVPW+N+D+E NIGGAALG+SL+R+FSRWP+WSKNII+V SEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240
           P  A++SWV+AYH SLDLTGGS+EAA+VLD+ S  ++FE+VE+ ++G+NGELPNLD+VN+
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300
           AIS+ EHEG+KVSL GL   ++  +++++RLK L  G+++ ALSG +K +GNEAFSG RI
Sbjct: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300

Query: 301 QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS 360
           Q++TLKA G  GHDITTFGRIPEA+FRS+NNLLEKFHQSFFFY L+APR FVSI SYLPS
Sbjct: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQPHL 420
           AV LSI+F IS+ +++INN Y  + L                       Q         L
Sbjct: 361 AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL 420

Query: 421 MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL 480
           ++   +   FLPL  I    I I   LSYRLK+ AF+Y SLV TSLL++NFA+A  +G L
Sbjct: 421 LMTISMASCFLPL--ILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478

Query: 481 AFPLTFTKSCSE-----------------------------MITF-------KSKVINCF 504
           AFP+TF K+  E                             M T        K K+ N  
Sbjct: 479 AFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLV 538

Query: 505 YLAISNPFIAIFIFVSIFEDDITNFEVFSDLISSFKYMGNWTWAITCIGWFTTWQMVYIA 564
            L ++NPFI+I +F   F+D+   F++ + L+S++  +  W+W + CIGW   W ++  +
Sbjct: 539 LLILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILAS 598

Query: 565 NLDTPRSALDGDTKKN 580
           + ++    +    K++
Sbjct: 599 SFESKSVVVRSKEKQS 614

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/616 (48%), Positives = 415/616 (67%), Gaps = 38/616 (6%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXCLPLDGQYRRTYISENALLP 60
           MAL+E LHRR   +GL+P+VI                    LP+DGQYRRTYISENAL+P
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120
           SQAYSYFRE+EWNILRGYR+ IE  ++  +  RN ++ SWL +FG K A+Y+N   G+TL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180
           YGV ++ RGDGTEA+VLA+PW+N++ E N+GGA+LG+SL+R+FSRWP+WSKNII+V SEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240
           PH A++SWV+AYH SLDLTGGS+EAA+VLD+ S  ++FE+VE+ ++G+NGELPNLD+VNV
Sbjct: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240

Query: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300
           AIS+IEHEG+KVSL GL   ++  + +F+RLK L  G+++ ALSG +  +GNEAFSG RI
Sbjct: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS 360
           Q++TLKA G  GHDITTFGRIPEA+FRS+NNLLEKFHQSFFFY L+APR FVSI SYLPS
Sbjct: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQPHL 420
           AV LS++F +S+ +++INN Y ++ L                       Q+  + L   L
Sbjct: 361 AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL 420

Query: 421 MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL 480
           ++   L I FLP+    +  + I   LSYRLK+ AF+Y SLV TSLL++NFA+A  +G L
Sbjct: 421 LMTISLAICFLPIALSGK--VHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478

Query: 481 AFPLTFTKSCS------------EMITFKSK-----VINCFY------------------ 505
           AFP+TF K+ +              I+ K++      +N  Y                  
Sbjct: 479 AFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNLL 538

Query: 506 -LAISNPFIAIFIFVSIFEDDITNFEVFSDLISSFKYMGNWTWAITCIGWFTTWQMVYIA 564
            L ++NPFI+I +F  +F+D+   F++ + L+S++  +  W+W I C+GW   W ++  +
Sbjct: 539 LLILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILAS 598

Query: 565 NLDTPRSALDGDTKKN 580
           + ++    +    K++
Sbjct: 599 SFESKSVVVKSKEKQS 614

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/581 (50%), Positives = 398/581 (68%), Gaps = 8/581 (1%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXX-XXXCLPLDGQYRRTYISENALL 59
           MALIE L RR   LGLLP+++                     LPL+GQYR TYISENAL+
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDT 119
           PSQAYSYFRE+EWNILRGYRT I+ L +K ++ RNEV++SW  +FG K A Y++   G+T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 120 LYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISE 179
           +YGV ++ RGDGTEA+VLA PWYN D E NIGGAAL  +LSR+FSRWP+WSKNII+V S+
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 180 NPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVN 239
           +P  +++SWV AYH SLDLTGGS+E+A+VLD+P  +++F++VE+Y+ G+NGELPNLD+VN
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 VAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRR 299
           VA+ + EHEG+KVSL G++  EM   +YF+++KT++ GVK  ALSG +  YGNEAFSG R
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 300 IQALTLKACGTEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYL 358
           IQA+ L+A GT+G  DITTFGRIPEA FRSVNNLLEKFHQSFFFY L+APR+FVSI SYL
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 359 PSAVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQP 418
           P+AV  S+SF ++     + +     P                         +   +   
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 419 HLMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMG 478
            L+I    +I+ LP     Q    I+   SY+ KS AF+Y+S+VLTSLLV+NFALAFG+G
Sbjct: 421 SLLISCNAVIAVLPAIFGRQ---GIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIG 477

Query: 479 LLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLISS 538
           LLAFPL   K+    +T + +V N   L +SNPFI+  +FV+ FE  ++  ++F  L+ +
Sbjct: 478 LLAFPLILVKAP---MTSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQA 534

Query: 539 FKYMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKK 579
           ++ +G WTW++ CIGW  +W +V  + +  P   + G +++
Sbjct: 535 WQKLGCWTWSVVCIGWLPSWLLVACSGIPMPYQPVGGPSQR 575

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/570 (52%), Positives = 397/570 (69%), Gaps = 6/570 (1%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXX-XXXCLPLDGQYRRTYISENALL 59
           MAL+E LHRR   +GL+PK I K                   LP DGQ+RRTYISENALL
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 60  PSQAYSYFRESEWNILRGYRTAIEAL-IDKPARVRNEVISSWLTDFGMKHAVYDNAADGD 118
           PSQAYSYFRESEWNILRGYRT ++           N  +S WL +FG+K A+YD+   G+
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 119 TLYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVIS 178
           TLYG++++ RGDGTEA+V+A PWYN + E N GGAAL ISL R+FSRWP+WSKNII+V+S
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 179 ENPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIV 238
           E+P  +++SWV AYH SLDLTGGS+E+AIVLD+P  S+ F+++E++++G+NGE PNLD+V
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 239 NVAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGR 298
           NVA+ + EHEG+KVSL GL  SE+  + Y +RLKT+L G+K+S LSG +  YGNEAFSG 
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 299 RIQALTLKACGTEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSY 357
           RIQ+LTLKA G +G HDITTFGR+PEA+ RSVNNLLEKFHQSFFFY L+APR+F+SIG+Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 358 LPSAVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQ 417
           L +AV +S++F  +A +  +NN+Y  +PL                       Q+   F  
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 418 PHLMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGM 477
           P +++    + S LPL  + +  + IQ   SYR K+FA+IY+++VLTSLLV+NF+LA  M
Sbjct: 421 PRVLLGLSGIFSVLPL--LSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVM 478

Query: 478 GLLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLIS 537
           GLLAFP+T T +  E    +  + N   L ISNPFIA +  V+  E  ++ F+VF  LI 
Sbjct: 479 GLLAFPMTRTTTIIES-NLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIE 537

Query: 538 SFKYMGNWTWAITCIGWFTTWQMVYIANLD 567
           + + +G WTW I C+GW+ +W +V  A++D
Sbjct: 538 ASQQLGCWTWYIICLGWYPSWLLVTYASID 567

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/570 (50%), Positives = 397/570 (69%), Gaps = 6/570 (1%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXC-LPLDGQYRRTYISENALL 59
           MA++E LHR+   +GL+PK+I                     LP++GQYRRTYISENAL+
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDT 119
           PSQAYSYFRESEWNILRGYR+ I+ +    A  RN +++SW+ ++G K AVY++   G+T
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 120 LYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISE 179
           LY V ++ RGDGTEA+VLA PW   + + N GG AL +++ RYFSRWP+WSKNII+V+SE
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 180 NPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVN 239
           +PH +++SWV AYH  LDLTGGS+EAAIVLD+P  ++YF+ VE+ + G+NG +PNLD++N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 240 VAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRR 299
           VA+ + EHEG+KV+L G    E+ T +YF+R++ LL G+K+ ALSG ++  GNEAFSG R
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 300 IQALTLKACGTEGH-DITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYL 358
           IQ++TLKA GT G  DITTFGR+PEA+FRSVNNLLEKFHQSFFFY L+APR+FVSIGSYL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 359 PSAVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQP 418
           P+AV LSISF + A  S +NN++ ++PL                       ++      P
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 419 HLMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMG 478
            L++   +++SF+P   +      IQ   S+R K+ A++Y S VL+SLLVMNF LAF +G
Sbjct: 421 ALLLAFNVVVSFMPFALVKY---KIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVG 477

Query: 479 LLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLISS 538
           LLAFP+TF ++     + + K+ N   L +SNPFI+I +FV +FE ++T F VF  LI +
Sbjct: 478 LLAFPMTFVRTTVHA-SVRQKMKNSLLLLLSNPFISICVFVHLFEPELTGFSVFYSLIDA 536

Query: 539 FKYMGNWTWAITCIGWFTTWQMVYIANLDT 568
           +  +G WTW + C+GW+  W MV  +++D+
Sbjct: 537 WNDLGCWTWYVLCLGWYPAWIMVAYSSIDS 566

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/592 (49%), Positives = 414/592 (69%), Gaps = 13/592 (2%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXCLPLDGQYRRTYISENALLP 60
           M+L++ ++RR ++ G + K++ +                  LPLDGQYRRTYISENAL+P
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLLAILPLDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120
           SQAYSYFRE+EWNILRGYR+ IE L       RNEV++ WL + G+K A+Y++   G TL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120

Query: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180
           YGV ++ RGDGTEA+VLA+PW N D++ N+GGAALG+SLS++F RWP+WSKNII+V SE+
Sbjct: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180

Query: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240
              A+++WVDAYH SLDLT GS+EAA+VLD+PSKS++FE+VE+ ++G+NGELPNLD+VN+
Sbjct: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300
           A+S+ EHEG+KVSL GL  +EMY + YF RLK +  G+KN ALSG ++++GNEAFSG RI
Sbjct: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300

Query: 301 QALTLKACGTEGH-DITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLP 359
           Q++TL+A G EG  DIT FGRIPEA+FRSVNNLLEKFHQS+FFY L+APR+FVSI +YLP
Sbjct: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360

Query: 360 SAVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQPH 419
           SAV +S++F + +  S INN Y+++P S                      ++        
Sbjct: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420

Query: 420 LMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGL 479
            ++   + ++FLPL    + +  I   ++YRLKS   IY SL+LTSLL++NFAL F +GL
Sbjct: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIGL 480

Query: 480 LAFPLT-----FTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDIT-NFEV-F 532
           LAFPLT      TK+ ++  + KS + N F L I+NPFI++++F +  + D   +F V +
Sbjct: 481 LAFPLTKLAVISTKTIADE-SRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIY 539

Query: 533 SDLISSFKYMGNWTWAITCIGWFTTWQMVYIANLDT----PRSALDGDTKKN 580
           + +I+S+  +G WTW I C+GW   W +  I+++ +     R+++  D K+N
Sbjct: 540 NRMITSWDTLGCWTWFIICLGWLPYWLISVISSIPSQPIVERTSILDDKKEN 591

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/614 (48%), Positives = 407/614 (66%), Gaps = 36/614 (5%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXCLPLDGQYRRTYISENALLP 60
           MAL+E LHRR   +GL+P++I                    LP+DGQYRRTYISENAL+P
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120
           SQAYSYFRESEWN+LRGYR+ IE + +  +  RN  + SWL +FG K A+Y++   G+TL
Sbjct: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120

Query: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180
           YGV ++ RGDGTEA+VLA+PW+N+D+E N+GGAALG+SL+R+FSRWP+WSKNII+V SEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240
           P  A++SWV+AYH SLDLTGGS+EAA+VLD+ S  ++FE+VE+ ++G+NGELPNLD+VN+
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300
           AIS+ EHEG+KVSL GL   ++  + +++RLK L  G+++ ALSG +  +GNEAFSG RI
Sbjct: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS 360
           Q++TLKA G  GHDITTFGRIPEA+FRS+NNLLEKFHQSFFFY L+APR FVSI SYLPS
Sbjct: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQPHL 420
           AV  S++F IS+ +++INN Y ++ L                       QI        L
Sbjct: 361 AVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL 420

Query: 421 MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL 480
           ++   L   FLPL  +    + I   LSYRLK+ AF+Y SLV TSLL++NFA+A  +G L
Sbjct: 421 LMTISLATCFLPL--VLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSL 478

Query: 481 AFPLTF---------------TKSCSEMIT-------------------FKSKVINCFYL 506
           AFP+TF               TKS + + T                    + ++ N   L
Sbjct: 479 AFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLLL 538

Query: 507 AISNPFIAIFIFVSIFEDDITNFEVFSDLISSFKYMGNWTWAITCIGWFTTWQMVYIANL 566
            ++NPFI+I +F  +F+++   F++ + LIS++  +  W W + CIGW   W ++  ++ 
Sbjct: 539 VLTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598

Query: 567 DTPRSALDGDTKKN 580
           ++    +    K++
Sbjct: 599 ESRSVVVKSKEKQS 612

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/570 (49%), Positives = 387/570 (67%), Gaps = 6/570 (1%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXC-LPLDGQYRRTYISENALL 59
           MA++E LHRR   +GL+P++I                     LPL+GQYRRTYISENAL+
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDT 119
           PSQAYSYFRESEWNILRGYR  +E L D     RN +++SW+ ++G K ++  N   G+T
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 120 LYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISE 179
           LYG+ ++ RGDGTEA+VLA PW  TD   N GGAAL ISL+RYF+RWP+WSKNII+V+S 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 180 NPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVN 239
           +P  ++++WV AYH  LDLTGGS+E+A+VLD+P  ++YF+++E+ +NG+NG LPNLD++N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 240 VAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRR 299
            A+ + EHEG+KVSL G+   E+   +Y  RLKTLL G+K+  L+G +   G+EAF+G R
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 300 IQALTLKACGTEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYL 358
           IQ++TLKA G +G  D+TTFGR+PEAIFRSVNNLLEKFHQSFFFY L++PR FVSIGSYL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 359 PSAVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQP 418
           P+A+ LS SF I++A S +NN+Y  +PL                       +       P
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 419 HLMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMG 478
            L++   + +SF+  T I      IQ   SYR K+FA +Y S+VLTSLLV+NFALA  +G
Sbjct: 421 SLLLAFNVALSFISFTVIKY---KIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVG 477

Query: 479 LLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLISS 538
           +LAFP++ TK+ +   T + K+ N   L  SNPFIA +I   +FE  +    +F  LI +
Sbjct: 478 VLAFPMSLTKTTTNA-TMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDA 536

Query: 539 FKYMGNWTWAITCIGWFTTWQMVYIANLDT 568
           +  +G WTW + CIGW+ +W +V  +++D+
Sbjct: 537 WTQLGCWTWYVLCIGWYPSWILVAYSSIDS 566

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/583 (49%), Positives = 399/583 (68%), Gaps = 5/583 (0%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXCLPLDGQYRRTYISENALLP 60
           M L E + R+    GL+PKVI                    LP +GQYR TYISENAL+P
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVIIGILPFEGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120
           SQAYSYFRESEWNI+RGYR+ I  L +  A  RN ++S WL  FG K  +Y N   GDTL
Sbjct: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120

Query: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180
           YGV+++ RGDGTE++VLA+PW+N D E N+ GAALG++L+RYFSRWP+WSKNII+V +EN
Sbjct: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180

Query: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240
           P  A++SWV+AYH SLDLTGGS+EAAIVLDF  + + F+++E+Y++G+NGELPNLD+VN+
Sbjct: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240

Query: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300
            +   EHEG+KVSL G    ++   + F+RLK L+  +KNSALSG +K YGNEAFSG RI
Sbjct: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300

Query: 301 QALTLKACGTEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLP 359
           Q++TL+A G  G  D+T+FGR+PEA+FRS+NNLLEKFHQSFFFY ++APRHFVSI SYLP
Sbjct: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360

Query: 360 SAVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQPH 419
           S V +SI F +++ +SY NN Y T+P                         I      P 
Sbjct: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420

Query: 420 LMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGL 479
           +++   ++I   P   I +    ++  LSYRL+S AF+++SL+LTSLL++NF LAFGMGL
Sbjct: 421 ILLAVNIIICLYP--AILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGL 478

Query: 480 LAFPLTFTKS-CSEMITF-KSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLIS 537
           L+FP+T  K+  S+  T  +++V N   L +SNPFIA ++F  + +++ +  +VF  L+S
Sbjct: 479 LSFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVS 538

Query: 538 SFKYMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKKN 580
           + + +G WTW + C+GW+T W +V I+ LDT + + D +  K 
Sbjct: 539 ASRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKK 581

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/585 (49%), Positives = 397/585 (67%), Gaps = 14/585 (2%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXX-XXXCLPLDGQYRRTYISENALL 59
           MALIE L R+   LGLLP+++                     LPL+GQYR TYISENAL+
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDT 119
           PSQAYSYFRE+EWNILRGYRT I+ L +K +  RNE++ SWL +FG+K A+Y++ + G+T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 120 LYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISE 179
           LYGV ++ RGDGTEA+VL+ PW+N D E N GG AL ++L+RYFSRWP+WSKNII+V S+
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 180 NPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVN 239
           +P  +++SWV AYH SLDLTGGS+E+A+VLD+P  +++F++VE+Y+ G+NGELPNLD+VN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 VAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRR 299
           VAI V EHEG+KVSL G+   EM    YF R+KT++ G+K  ALSG ++ YGNEAFSG R
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 300 IQALTLKACGTEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYL 358
           IQA+ L+A G  G  DITTFGR+PEA+FRSVNNLLEKFHQSFFFY L+APR+FVSI SYL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 359 PSAVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQP 418
           P+AV  S+SF ++A  + +     T   S +                     ++ TF + 
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGAST---SQSGILPNIAAVVGFTVALLFSFTVSVTFARF 417

Query: 419 HLMILAFLLISFLPLTNIPQPL---ITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAF 475
           H  +   +LIS+  +T +   L   + IQ   ++RLK+ A++Y+S+VLTSLLV+NFALAF
Sbjct: 418 HHPV---ILISWSVMTALAPILLNRVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAF 474

Query: 476 GMGLLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDL 535
           G+GLLAFPL   K+ +   T +    N   L +SNPFI+  +F   FE  +   ++   L
Sbjct: 475 GIGLLAFPLILVKNST---TPRLLFKNSLLLLLSNPFISTCLFAYFFEPLLPGLQILEQL 531

Query: 536 ISSFKYMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKKN 580
           + ++   G WTW + CIGW  +W ++  +++ T  S L    +K 
Sbjct: 532 VQAWNEFGCWTWCVVCIGWLPSWLLIAYSSMITDVSTLLNSAEKK 576

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/585 (48%), Positives = 397/585 (67%), Gaps = 8/585 (1%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXCLPLDGQYRRTYISENALLP 60
           M L+E + R     GL+PK++ +                  LP+DGQYR TYISENAL+P
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120
           SQAYSYFRE+EWNI+RGYR  +  + +  +R RN+++ SWL +FG+K  +Y+N  D + L
Sbjct: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENR-DNEVL 119

Query: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180
           YGV+++ RGDGTEAIVLAVPW+N D E N  GAA+G++L+RYFSRWP+WSKNII+V SEN
Sbjct: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179

Query: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240
           P  A++SWV+AY+ SLDLTGGS+EAAIVLD P +++YF+++E+Y++G+NGELPNLD+VN+
Sbjct: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239

Query: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300
            I + EHEG++VSL G    ++  ++Y+ RLK L+  +++SA SG  K +GNEAFSG RI
Sbjct: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299

Query: 301 QALTLKACGTEGH-DITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLP 359
           Q++TLK  G  G  DIT FGR+PEA+FRS+NNLLEKFHQSFFFY L+APR FVSI SYLP
Sbjct: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 360 SAVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQPH 419
           SAV LS++F I+   SYINN    +P   N                    Q+      P 
Sbjct: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPIPS 419

Query: 420 LMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGL 479
           L++L  ++IS   +    + L   +P +S RL+SFAF+++SL+LTSLL++NF L+F +GL
Sbjct: 420 LLLLINIVISISSIIIQNKKL--FKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGL 477

Query: 480 LAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDD----ITNFEVFSDL 535
           +AFP+T  +S +     + K+ N   L ISNPFIA+ I+ ++  +     +    V + L
Sbjct: 478 MAFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRL 537

Query: 536 ISSFKYMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKKN 580
           IS++K M  WTW + C+GW  +W MV I+ ++  R     D KKN
Sbjct: 538 ISAWKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVKKN 582

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/575 (49%), Positives = 395/575 (68%), Gaps = 23/575 (4%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXCLPLDGQYRRTYISENALLP 60
           MALIE L RR  ++GL+PK+I                    LP++GQ+RRTYISENAL+P
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120
           SQAYSYFRESEWNILRGYR+ IE   +     RNE ++ WL +FG K ++Y+N   GD+L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120

Query: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180
           YG+ +++RGDGTEAI+LAVPWYN + ++N+GGA+LGISLSR+FSRWP+WSKNII+V SEN
Sbjct: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180

Query: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240
           P+ A++SWV AYH SLDLTGGS+EAAIVLD+P  ++YF++ E+ + G+NGELPNLD+VN+
Sbjct: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240

Query: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300
           A+S+ EHEGV VSL G+    +   SY++RLK LL G+   A +G   L GNEAFSG RI
Sbjct: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300

Query: 301 QALTLKACGTEG--HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYL 358
           Q++T+KA G EG  +DITTFGRIPEA+FRS+NNLLEKFHQS+FFY LVAPR+FVSI SYL
Sbjct: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360

Query: 359 PSAVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQP 418
           P+ V L+  F +++ +S + NQY  +    +                    Q+   ++  
Sbjct: 361 PATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLF-LYVPS 419

Query: 419 HLMILAFLLIS-FLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGM 477
            ++++AF+++   LPL      L TI   LS+RL+ +AF+Y+SLV+TSL+++NF LAF +
Sbjct: 420 TILLVAFIVVMLLLPLA--AGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVV 477

Query: 478 GLLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLIS 537
           G+LAFP+T   +    +TFK   +    L ISNP ++ FI          + ++   LIS
Sbjct: 478 GILAFPMTAVGT-QRSLTFKKYAL----LIISNPLVSFFIVKP-------HPQLLQKLIS 525

Query: 538 SFKYMGNWTWAITCIGWFTTWQMVYIA-----NLD 567
           +++ +G WTW + C+GW  +W ++ ++     NLD
Sbjct: 526 AWQDLGCWTWFVLCLGWLPSWTLIALSACSSTNLD 560

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/547 (49%), Positives = 381/547 (69%), Gaps = 4/547 (0%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXCLPLDGQYRRTYISENALLP 60
           M L+E + R+   +GL+PK+                     LP+DGQYR TYISENAL+P
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLISIAILPIDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120
           SQAYSYFRE+EWNILRGYRT +E ++D P   RN+++ +WL D G K   ++N+    T+
Sbjct: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116

Query: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180
           YG+++S RGDGTEAIVLA+PW+N++ + N GGAALG+SL+R+F RWPIWSKNII+V SE+
Sbjct: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176

Query: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240
              +++SWV+AYH SLDLTGGS+EAA++LD+ S+S++F++VE++++G+NGELPNLD+VN+
Sbjct: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236

Query: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300
           A+S+ EHEG+KVSL GL   E+   S ++R K LL  +K+S+L+G +K +GNEAFSG RI
Sbjct: 237 AVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296

Query: 301 QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS 360
           QALTLKACG  G DITTFGRIPEA+FRS+NNLLEKFHQSFF+Y L+APR+FVSI SYLP+
Sbjct: 297 QALTLKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPA 356

Query: 361 AVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQPHL 420
           AV LS++F  S+   ++N+   ++P   +                         +  P +
Sbjct: 357 AVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVM 416

Query: 421 MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL 480
           ++   +L SF+PL +   PL   +  +++R+K+FAF Y SLVLTSLL++NF LA  +G+L
Sbjct: 417 LMFICILFSFIPLISRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGVL 476

Query: 481 AFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLISSFK 540
           AFP+T  K  + + T    + N   L +SNP+I+I  F +IF+ ++T       LI ++ 
Sbjct: 477 AFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLIPAWN 536

Query: 541 YMGNWTW 547
            M  WTW
Sbjct: 537 DMNCWTW 543

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/588 (49%), Positives = 396/588 (67%), Gaps = 12/588 (2%)

Query: 1   MALIEVLHRRATKLGLLPKVIGKXXXXXXXXXXXXXXXXXCLPLDGQYRRTYISENALLP 60
           M L E L R+A KLGLLPK++                    +P++GQYR TYISENAL+P
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMILIIPMNGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRTAIEALIDK--PARVRNEVISSWLTDFGMKHAVYDNAADGD 118
           SQAYSYFRE+EWNILRGYRT IE L  +   A  R ++++ WL +FG K AVY N   GD
Sbjct: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120

Query: 119 TLYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVIS 178
           TLYGV ++ RGDGTEA+VL  PW N++ E NIGG+AL I+LSRYFSRWP+WSKNII+V S
Sbjct: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180

Query: 179 ENPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIV 238
           +NP  A++SWV+AYH SLDLTGGS+EAA++LD+PS ++YF + E++F G+NGELPNLD+V
Sbjct: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240

Query: 239 NVAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGR 298
           NVA+ + +HEG+KVSL GL  SE+  ++Y++RLK L  G+K+S L+G +K +GNE FSG 
Sbjct: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300

Query: 299 RIQALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYL 358
           RIQA+TLKA G    DITTFGRIPEA+FRS+NNLLEKFHQSFFFYFL++P +FVSI SYL
Sbjct: 301 RIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSYL 360

Query: 359 PSAVCLSISFGISAAHSYINNQYITVPLSDNXXXXXXXXXXXXXXXXXXXXQINETFLQP 418
           PSAV LSI+F I+A  + +NN Y +                              +   P
Sbjct: 361 PSAVLLSITFAIAAVDATVNNAYASALHITYTLLAALASVISLLVSFLVAHWFLYSTTSP 420

Query: 419 HLMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMG 478
             +IL  ++++  PL  + +    ++  + YR+++  +IY SL+LTSLL++NF LAF +G
Sbjct: 421 LYLILGSVVLAVSPLV-MSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFSIG 479

Query: 479 LLAFPLTFTK-----SCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFED-DITNFEVF 532
           L  +P+T  K     S S+M     K+ N   L ISNPF+A ++  ++ E+ +  N +VF
Sbjct: 480 LFGYPMTLVKPLNIYSKSQM---SLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVF 536

Query: 533 SDLISSFKYMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKKN 580
           + L S++K +  WTW + C+GW  TW +V  ++  +  +A     KK+
Sbjct: 537 AALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKS 584

>CAGL0L02783g Chr12 (324952..327627) [2676 bp, 891 aa] {ON} highly
           similar to uniprot|P32266 Saccharomyces cerevisiae
           YOR211c MGM1 dynamin-like protein
          Length = 891

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 42/95 (44%), Gaps = 9/95 (9%)

Query: 287 RKLYGNEAFSGRRIQALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLV 346
           R+  G     GR +Q L L+    +   I  FG I   +F S+     +FH   F  FL+
Sbjct: 12  RRQMGFSVLGGRPVQQLLLRRLFADAQTIGRFGPIQRMVFESI-----RFHHPKFTPFLI 66

Query: 347 --APRHFVSIGSYLPSAVCLS--ISFGISAAHSYI 377
             + R+   I   +   V +   +  G++AA SYI
Sbjct: 67  WNSKRNISIIPKIVGKVVRIPVYVGGGMAAAGSYI 101

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,328,420
Number of extensions: 2401312
Number of successful extensions: 7329
Number of sequences better than 10.0: 35
Number of HSP's gapped: 7454
Number of HSP's successfully gapped: 39
Length of query: 581
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 466
Effective length of database: 40,294,809
Effective search space: 18777380994
Effective search space used: 18777380994
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 69 (31.2 bits)