Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0A018108.262ON45745722930.0
KAFR0B055408.262ON5194045227e-60
ZYRO0C01650g8.262ON5863735136e-58
NCAS0B038508.262ON5883795083e-57
KNAG0H032408.262ON5193024973e-56
NDAI0J013808.262ON6243734991e-55
TDEL0F038908.262ON4763734649e-52
SAKL0H17028g8.262ON5503754626e-51
Kpol_543.388.262ON4424424541e-50
Suva_2.2708.262ON6323794613e-50
YDR110W (FOB1)8.262ON5663714488e-49
Skud_4.3718.262ON5803714453e-48
Smik_4.3568.262ON5763714443e-48
KLLA0F19140g8.262ON5273834311e-46
Kpol_392.68.262ON4573734244e-46
Kwal_56.237998.262ON4883784254e-46
Ecym_43088.262ON5293604117e-44
CAGL0B01771g8.262ON5363264101e-43
KLTH0G13684g8.262ON5083864038e-43
AGR086C8.262ON5343603951e-41
TBLA0F030708.262ON4453923463e-35
TBLA0E044308.262ON4813683244e-32
TPHA0J007408.262ON4082802191e-18
Kwal_15.2639singletonOFF9741750.22
YLR253W1.383ON569119741.8
NCAS0B049808.256ON120475732.4
AAR169C6.121ON54064722.9
TDEL0B05590na 1ON34648704.5
NCAS0F001806.7ON101863704.7
Suva_10.3491.383ON569158695.8
TDEL0E00260singletonON1248228697.0
KNAG0F016906.266ON973121697.2
KAFR0B036608.825ON425102679.7
Kpol_2002.1045.209ON709116689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0A01810
         (457 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   887   0.0  
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   205   7e-60
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   202   6e-58
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   200   3e-57
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   196   3e-56
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   196   1e-55
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   183   9e-52
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   182   6e-51
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   179   1e-50
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   182   3e-50
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   177   8e-49
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   176   3e-48
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   175   3e-48
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   170   1e-46
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   167   4e-46
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   168   4e-46
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   162   7e-44
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   162   1e-43
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   159   8e-43
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   156   1e-41
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   137   3e-35
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   129   4e-32
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....    89   1e-18
Kwal_15.2639 s15 complement(2..292) [291 bp, 97 aa] {OFF} [conti...    33   0.22 
YLR253W Chr12 (642627..644336) [1710 bp, 569 aa] {ON} Putative p...    33   1.8  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...    33   2.4  
AAR169C Chr1 complement(645880..647502) [1623 bp, 540 aa] {ON} S...    32   2.9  
TDEL0B05590 Chr2 (990659..991699) [1041 bp, 346 aa] {ON}               32   4.5  
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...    32   4.7  
Suva_10.349 Chr10 (609820..611529) [1710 bp, 569 aa] {ON} YLR253...    31   5.8  
TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,...    31   7.0  
KNAG0F01690 Chr6 complement(307857..310778) [2922 bp, 973 aa] {O...    31   7.2  
KAFR0B03660 Chr2 (764750..766027) [1278 bp, 425 aa] {ON} Anc_8.8...    30   9.7  
Kpol_2002.104 s2002 complement(246226..248355) [2130 bp, 709 aa]...    31   9.9  

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/457 (94%), Positives = 434/457 (94%)

Query: 1   MQDEKQASEPNPEKDRNEFKDPEHVLANIKYIIPRIGQKYDSLITPLLDKQLLQKGEIAV 60
           MQDEKQASEPNPEKDRNEFKDPEHVLANIKYIIPRIGQKYDSLITPLLDKQLLQKGEIAV
Sbjct: 1   MQDEKQASEPNPEKDRNEFKDPEHVLANIKYIIPRIGQKYDSLITPLLDKQLLQKGEIAV 60

Query: 61  ANSKTNYLSKELYDLVKNDDLTRKNVAVALNLDEKNAITRLIPLKHRYYRDSKLMVHDRS 120
           ANSKTNYLSKELYDLVKNDDLTRKNVAVALNLDEKNAITRLIPLKHRYYRDSKLMVHDRS
Sbjct: 61  ANSKTNYLSKELYDLVKNDDLTRKNVAVALNLDEKNAITRLIPLKHRYYRDSKLMVHDRS 120

Query: 121 KQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSN 180
           KQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSN
Sbjct: 121 KQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSN 180

Query: 181 KKNIRRKKEPQLSNSPDILFYERLILDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPL 240
           KKNIRRKKEPQLSNSPDILFYERLILDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPL
Sbjct: 181 KKNIRRKKEPQLSNSPDILFYERLILDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPL 240

Query: 241 KNLKLRTIISKVTEFIVALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQK 300
           KNLKLRTIISKVTEFIVALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQK
Sbjct: 241 KNLKLRTIISKVTEFIVALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQK 300

Query: 301 AYSKNPYVTRILNSHKTECLKSWFMCLKWLADRQSNSKFDIRPPNKNYGLFSGMTDFLKK 360
           AYSKNPYVTRILNSHKTECLKSWFMCLKWLADRQSNSKFDIRPPNKNYGLFSGMTDFLKK
Sbjct: 301 AYSKNPYVTRILNSHKTECLKSWFMCLKWLADRQSNSKFDIRPPNKNYGLFSGMTDFLKK 360

Query: 361 YEERSKMIIGRLPSENFINIDEGSHFIYSEDEFSFDNLVEKETPKKLXXXXXXXXXXXXX 420
           YEERSKMIIGRLPSENFINIDEGSHFIYSEDEFSFDNLVEKETPKKL             
Sbjct: 361 YEERSKMIIGRLPSENFINIDEGSHFIYSEDEFSFDNLVEKETPKKLSESVVNSSEDSDD 420

Query: 421 XXXXXXXXXXLAEGPNRDDTILDYNDTFTEAESGVLL 457
                     LAEGPNRDDTILDYNDTFTEAESGVLL
Sbjct: 421 NYEDNQEDNYLAEGPNRDDTILDYNDTFTEAESGVLL 457

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  205 bits (522), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 118/404 (29%), Positives = 221/404 (54%), Gaps = 28/404 (6%)

Query: 22  PEHVLANIKYIIPRIGQKYDSLITPLLDKQLLQKGEIAV---ANSKTNYLSKELYDLVKN 78
           PE+++    YI+PR+G+ Y S     ++ +LL++GE  V     S   +L++E YDL++ 
Sbjct: 38  PENIVIKESYIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRT 97

Query: 79  DDLTRKNVAVA-LNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVM 137
           D LT + +A       +  A  R + LK RYYRD+  ++HD  +++KIV +P + F M+M
Sbjct: 98  DSLTPETLASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIM 157

Query: 138 TTHLLNDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPD 197
             HL+N+H     I+ +LS  ++N++      ++++CS+CN  +K  + +K    +   +
Sbjct: 158 GCHLMNNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNE 217

Query: 198 ILFYERLILDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIV 257
           ++  ER+ +++  PF  +KI+K+Y+HIL   D+H++++W  PLKN K + ++  +    +
Sbjct: 218 LMPLERVHIEIFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFL 277

Query: 258 ALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPYVTRI-LNSHK 316
           +   +P+FI + +L   D+F++C  +A EY++ IGLGT      ++      +  L +H+
Sbjct: 278 SFIRQPIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHR 337

Query: 317 TECLKSWFMCLKWLADRQSNSKFDIRPPNKNYG-----LFSGMTDFLKKYEERSKMIIGR 371
            ECL SW +CLK+      +   +IR  ++  G     L S + +   K++E+   I+  
Sbjct: 338 EECLLSWNLCLKY-----GSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILEN 392

Query: 372 LPSENFINIDEGSHFI-------------YSEDEFSFDNLVEKE 402
             SE+ + +D G  F+             Y E +F  D  +++E
Sbjct: 393 AVSESVLRVDNGLIFLEVDEPHDEPHDEPYDEFQFEGDQSIDEE 436

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  202 bits (513), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 112/373 (30%), Positives = 213/373 (57%), Gaps = 11/373 (2%)

Query: 28  NIKYIIPRIGQKYDSLITPLLDKQLLQKG---EIAVANSKTNYLSKELYDLVKNDDLTRK 84
           N ++I+P + QK+ S +   ++  LL++G    +    +    L++++Y+L+++D L+  
Sbjct: 35  NGEFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIA 94

Query: 85  NVAVALNLDEKNAITRLIPLKHRYY-RDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLN 143
           N+        +++      L+ RY+  +   MV DR + ++IV +PA  F +VM +HL N
Sbjct: 95  NLERCHKWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQN 154

Query: 144 DHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYER 203
           +H+T   I+R L K +AN++  +I T+I YCS CN + K    +K+   +   ++L  ER
Sbjct: 155 NHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLER 214

Query: 204 LILDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKP 263
           + ++V  PF  +KIQ R++H+L   D+ ++++W  PL+N K + +I  ++ F++ LP  P
Sbjct: 215 VHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIP 274

Query: 264 VFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKN-PYVTRILNSHKTECLKS 322
           +F+ S T+    +F+LC  +A  Y++ +GLG +N Q+ ++     +  +L SHK ECL+ 
Sbjct: 275 IFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQD 334

Query: 323 WFMCLKWLA---DRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFIN 379
           W +CLK+     ++  N   D RP +    LF+ + D  +K+ ++   +I   PS+  ++
Sbjct: 335 WNLCLKYGPFHINQNINVSSDGRPGDL---LFTSVPDCNRKFVKKRNDVILDTPSQQVVH 391

Query: 380 IDEGSHFIYSEDE 392
           + EG  F+ +  E
Sbjct: 392 LGEGVLFLENNKE 404

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  200 bits (508), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 117/379 (30%), Positives = 203/379 (53%), Gaps = 9/379 (2%)

Query: 31  YIIPRIGQKYDSLITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRKNV- 86
           Y+IP IG+KY   +   +D   +Q+GE        +    L++  Y+L+K + LT++ + 
Sbjct: 82  YLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLS 141

Query: 87  AVALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHL 146
           A AL +D+  A +RL+ L  RY  D +  V D+ +QN++V +P   + M+MT HL+NDH 
Sbjct: 142 ATALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHG 201

Query: 147 TRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERLIL 206
                ++ L   ++N++  F++   ++CS+CN +K+ I  KK   ++    +L  ER+ +
Sbjct: 202 RPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQV 261

Query: 207 DVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVFI 266
           +V  PF  +K+  +Y  IL   D+ ++F+W  PL+N K   ++  +++ I ++   P+F 
Sbjct: 262 EVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFF 321

Query: 267 SSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKN-PYVTRILNSHKTECLKSWFM 325
            + T+   D F++   +  +Y I+IGLGT+   K  +   P + ++L  HK ECL  W M
Sbjct: 322 ETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEECLADWIM 381

Query: 326 CLKWLADRQSNSKFDIRPPNKNYGLFSG-MTDFLKKYEERSKMIIGRLPSENFINIDEGS 384
           CLK+      N+K + R       L +G + D   K  ++ + I+  LP+EN + I  G 
Sbjct: 382 CLKY-GPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKIGRGC 440

Query: 385 HFIYSEDEFSFDNLVEKET 403
             IY ED    D   E E 
Sbjct: 441 --IYLEDRNPEDPEAEYEA 457

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  196 bits (497), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 102/302 (33%), Positives = 172/302 (56%), Gaps = 5/302 (1%)

Query: 32  IIPRIGQKYDSLITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRKNVAV 88
           ++P IG K+ +     LD +  ++GE    A A ++   +S+ELY L KNDD+T++N+A 
Sbjct: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIAR 94

Query: 89  ALNLDEKNAITR-LIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLT 147
               D     +R ++ +  RYY+D+  M+ D +  N+IV DP H F ++M+ HL+N HL 
Sbjct: 95  LYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLG 154

Query: 148 RGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERLILD 207
              +YR L + +AN     IK ++EYCS+CN + K +  K +P+       L  ER+ ++
Sbjct: 155 SERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLK-LTPKVQPKPYLFEKALPLERITIE 213

Query: 208 VVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVFIS 267
           ++ PF  +K++ +Y++++ + DF  +F W  PLKN K + I+  V + I++ P  P+++ 
Sbjct: 214 IIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVE 273

Query: 268 SFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPYVTRILNSHKTECLKSWFMCL 327
           S TL  +D+F++   +  +Y I IGLG      A      + R LN H  ECL  +  CL
Sbjct: 274 SNTLDWSDLFDIFEMIVTKYGIKIGLGCTTRSSAAQATARINRDLNDHHDECLFDFNNCL 333

Query: 328 KW 329
           K+
Sbjct: 334 KY 335

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  196 bits (499), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 113/373 (30%), Positives = 201/373 (53%), Gaps = 10/373 (2%)

Query: 31  YIIPRIGQKYDSLITPLLDKQLLQKGEIAVAN---SKTNYLSKELYDLVKNDDLTRKNVA 87
           Y+IP +G+ Y   + P +D  LL++GE+   N   S    L + +Y+L++   LT + +A
Sbjct: 91  YLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLA 150

Query: 88  VALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLT 147
              N    +A TR    K RY  D++  V D+ + N+IV DP   + M+MT HL+NDH  
Sbjct: 151 A--NFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQ 208

Query: 148 RGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERLILD 207
               +  LS  +AN++  F+  ++++CS+CN +K      K   ++    +L  ER+ ++
Sbjct: 209 YRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIE 268

Query: 208 VVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVFIS 267
           +  PF  KKI+ +Y+H++   D+ ++++   PLKN K + ++S + + +  LP  P+FI 
Sbjct: 269 IFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIE 328

Query: 268 SFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPYVTRI-LNSHKTECLKSWFMC 326
           + +L+  D F++   +  +Y I++GLG +  ++ +++     +I L  H+ ECL  W MC
Sbjct: 329 TVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMC 388

Query: 327 LKWLADRQSNSKFDIRPPNKNYGLFS-GMTDFLKKYEERSKMIIGRLPSENFINIDEGSH 385
           LK+      N+K + R       L +  + D   K  E+ + II  LP +N + I  GS 
Sbjct: 389 LKY-GPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQIGNGS- 446

Query: 386 FIYSEDEFSFDNL 398
            IY E++    N+
Sbjct: 447 -IYLEEKVKDPNI 458

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  183 bits (464), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 106/373 (28%), Positives = 205/373 (54%), Gaps = 14/373 (3%)

Query: 30  KYIIPRIGQKYDSLITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRKNV 86
           +++ P +G+ Y       ++ +LL++GE   +    S    +   +Y+L++ + LT + +
Sbjct: 38  QFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETL 97

Query: 87  AVALN-LDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDH 145
           A   +  D+ +A ++ + L  RYY ++ + V DR K +KIV +P   F ++M  HL+NDH
Sbjct: 98  ASNSDKWDKDSAESKYMFLMRRYYAENGI-VRDRRKGDKIVCEPLCIFDLIMCAHLMNDH 156

Query: 146 LTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERLI 205
           +T   IY  L+K ++N++  F++ ++ YCS CN +      +K    +    +L  ER+ 
Sbjct: 157 MTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVH 216

Query: 206 LDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVF 265
           +++   F  + I  ++T++L   D+HT+F+W  PLKN K + ++S V   ++ +   P+F
Sbjct: 217 IEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIF 276

Query: 266 ISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKN-PYVTRILNSHKTECLKSWF 324
           + S TL   D+F++C  L  +YN+ +GLG  +  + +      + ++LN+ K +C+  W 
Sbjct: 277 MESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWN 336

Query: 325 MCLKWLA---DRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFINID 381
           MCL++     +R+ N+     P   N  L+       K +  + +MII  LP++N ++++
Sbjct: 337 MCLRYGPYHLNRRHNTLAGGIP---NDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVN 393

Query: 382 EGSHFIYSEDEFS 394
           +G   +Y EDE S
Sbjct: 394 KG--LLYLEDENS 404

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  182 bits (462), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 112/375 (29%), Positives = 207/375 (55%), Gaps = 9/375 (2%)

Query: 27  ANIKYIIPRIGQKYDSLITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTR 83
            N  Y+ P++G+   +  T L + +LL++G    I    S    L++  Y+L+K D LT 
Sbjct: 22  TNNDYVTPKLGESQVTYSTDL-NVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTL 80

Query: 84  KNV-AVALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLL 142
           + + AV   L   NA  + + LK RYY DS  +V D  + + IV +P   + ++++ HLL
Sbjct: 81  ETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLL 140

Query: 143 NDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYE 202
           N+HL    ++R L   ++N++  F++    YCS CN  ++     K    +    +L  E
Sbjct: 141 NNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLE 200

Query: 203 RLILDVVAPFGAKK-IQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPV 261
           R+ +++  PFG  + I+++Y+H+L   D+H++F+W  PL  +  + ++ ++TEF+++LP 
Sbjct: 201 RIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPR 260

Query: 262 KPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKN-PYVTRILNSHKTECL 320
            P+F+ + TL   D+F++C Y+AR+Y ++IGLG  N    Y      +  +L ++K +C 
Sbjct: 261 LPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCA 320

Query: 321 KSWFMCLKWLADRQSNSKFDIRPPN-KNYGLFSGMTDFLKKYEERSKMIIGRLPSENFIN 379
           K W MCLK+     +N+ ++ R     N  L + ++   KK++ + + II  L + N + 
Sbjct: 321 KDWGMCLKY-GSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVT 379

Query: 380 IDEGSHFIYSEDEFS 394
           + +    +Y E+E S
Sbjct: 380 LKDTGGMVYVENENS 394

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  179 bits (454), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 127/442 (28%), Positives = 206/442 (46%), Gaps = 37/442 (8%)

Query: 17  NEFKDPEHVLANIKYIIPRIGQKYDSLITPLLDKQLLQKGEIAVA---NSKTNYLSKELY 73
           +EFK+       + +  P++G      I        L+ G  A     +S    LS+ +Y
Sbjct: 30  SEFKEVNR-YGKVVFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVY 88

Query: 74  DLVKNDDLTRKNVAVALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRF 133
           +L+++D L    ++        NA  + + LK RY    K  V D +++NKIV +P  R+
Sbjct: 89  ELIRDDLLDVDTLSEKTRWSRINANAKCLYLKRRYKLTKKGTVIDLTRENKIVYEPDLRY 148

Query: 134 RMVMTTHLLNDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLS 193
             +++TH+LN HL    I++ L   ++NLS  +IK  +++CS CN +K     +K   ++
Sbjct: 149 DYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMN 208

Query: 194 NSPDILFYERLILDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVT 253
                L  ER+ LD+  PF  +KIQ RY+HI+ I D+ ++F+W +PLKN K +T+ S++ 
Sbjct: 209 IYEKYLPLERVQLDIFEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIG 268

Query: 254 EFIVALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKN-PYVTRIL 312
             ++ LP  P++I + T+   D+  +C  +A +Y IS+G+GT      YS     +  +L
Sbjct: 269 MLLLDLPRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLL 328

Query: 313 NSHKTECLKSWFMCLKWLADRQSNSKFDIRPPNKNYGLF-SGMTDFLKKYEERSKMIIGR 371
           N +K +CLK W MCLK L     N K           LF   M      +E +   II  
Sbjct: 329 NENKDKCLKDWNMCLK-LGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINS 387

Query: 372 LPSENFINIDEGSHFIYSEDEFSFDNLVEKETPKKLXXXXXXXXXXXXXXXXXXXXXXXL 431
           LP +N          +Y++DE                                       
Sbjct: 388 LPIQNSYKTSTNKGLVYAQDEI------------------------------LTTSKNKS 417

Query: 432 AEGPNRDDTILDYNDTFTEAES 453
           +   N DDT L+Y+DTF E  +
Sbjct: 418 SNMENGDDTFLEYDDTFIEGST 439

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  182 bits (461), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 111/379 (29%), Positives = 196/379 (51%), Gaps = 9/379 (2%)

Query: 32  IIPRIGQKYDSLITPLLDKQLLQKGEIAVA---NSKTNYLSKELYDLVKNDDLTRKNVA- 87
           I+P +G+ Y   +   L+ +LL++GE        S T  L++++Y+L+K   LT + +  
Sbjct: 100 ILPLMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQ 159

Query: 88  VALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLT 147
           ++   D   A  +L+ L+ +YY D++  V DR   +KI  +P H + MVM THL+N HL 
Sbjct: 160 ISDKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLR 219

Query: 148 RGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNK--KNIRRKKEPQLSNSPDILFYERLI 205
              ++  L   FAN S   I    ++CS CN     K ++  K P + +   +L  ER+ 
Sbjct: 220 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDK--LLPMERIH 277

Query: 206 LDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVF 265
           ++V  P+G K I+ +Y ++L   D+ + FMW  PLK+ K + +I  V+   ++    P+F
Sbjct: 278 IEVFEPYGGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIF 337

Query: 266 ISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPY-VTRILNSHKTECLKSWF 324
           ++S TL  +D++++C  +A +Y + IGLG ++  + ++     +   LNS+K ECL  W 
Sbjct: 338 VTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWG 397

Query: 325 MCLKWLADRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFINIDEGS 384
            CL++   R +  +           L S +     K+E + + +I    + N   +  G 
Sbjct: 398 KCLRYGPYRFNRRRNKRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGK 457

Query: 385 HFIYSEDEFSFDNLVEKET 403
             IY ED  +F  + E E+
Sbjct: 458 GLIYLEDVNTFALVNEGES 476

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  177 bits (448), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 108/371 (29%), Positives = 189/371 (50%), Gaps = 9/371 (2%)

Query: 32  IIPRIGQKYDSLITPLLDKQLLQKGEIAVA---NSKTNYLSKELYDLVKNDDLTRKNVA- 87
           I+P +G+ Y   +   L+ +LL++GE        S T  L++++Y+L+K   LT   +  
Sbjct: 47  ILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 106

Query: 88  VALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLT 147
           ++   D   A  +L+ L+ +YY D +  V D    +KI  +P H + MVM THL+N HL 
Sbjct: 107 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLR 166

Query: 148 RGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNK--KNIRRKKEPQLSNSPDILFYERLI 205
              ++  L   FAN+S   I    ++CS CN     K ++  K P + +   +L  ER+ 
Sbjct: 167 GKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDK--LLPMERIH 224

Query: 206 LDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVF 265
           ++V  PF  + I+ +Y+++L   D+ + FMW  PLK+ K + +I  V+   +     P+F
Sbjct: 225 IEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIF 284

Query: 266 ISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPY-VTRILNSHKTECLKSWF 324
           ++S TL  +D++++C  +A +Y + IGLG ++  + ++     +   LNS+K ECL  W 
Sbjct: 285 VTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWG 344

Query: 325 MCLKWLADRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFINIDEGS 384
            CL++   R +  +           L S +     K+E + + +I    S N   +  G 
Sbjct: 345 KCLRYGPYRFNRRRNKRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGK 404

Query: 385 HFIYSEDEFSF 395
             IY ED  +F
Sbjct: 405 GLIYLEDVNTF 415

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  176 bits (445), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 107/371 (28%), Positives = 189/371 (50%), Gaps = 9/371 (2%)

Query: 32  IIPRIGQKYDSLITPLLDKQLLQKGEIAVA---NSKTNYLSKELYDLVKNDDLTRKNVA- 87
           I+P +G+ Y + +   L+ +LL++GE        S T  L++++Y+L+K   LT   +  
Sbjct: 50  ILPSMGESYTAYVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQ 109

Query: 88  VALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLT 147
           ++   D   A  +L+ L+ +YY D++  V D    +KI  +P H + MVM THL+N HL 
Sbjct: 110 ISDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLR 169

Query: 148 RGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNK--KNIRRKKEPQLSNSPDILFYERLI 205
              ++  L   FAN S   I    ++CS CN     K ++  K P + +   +L  ER+ 
Sbjct: 170 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDK--LLPMERIH 227

Query: 206 LDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVF 265
           ++V  PF    I+ +Y ++L   D+ + FMW  PLK+ K + +I  ++   ++    P+F
Sbjct: 228 IEVFEPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIF 287

Query: 266 ISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPY-VTRILNSHKTECLKSWF 324
           ++S TL  +D++++C  +A +Y + IGLG ++  + ++     +   LNS+K ECL  W 
Sbjct: 288 VTSSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWG 347

Query: 325 MCLKWLADRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFINIDEGS 384
            CL++   R +  +           L S +     K+E + + +I    S N   +  G 
Sbjct: 348 KCLRYGPYRFNRRRNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGK 407

Query: 385 HFIYSEDEFSF 395
             IY ED  +F
Sbjct: 408 GLIYLEDVNTF 418

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  175 bits (444), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 107/371 (28%), Positives = 189/371 (50%), Gaps = 9/371 (2%)

Query: 32  IIPRIGQKYDSLITPLLDKQLLQKGEIAVA---NSKTNYLSKELYDLVKNDDLTRKNVA- 87
           I+P +G+ Y   +   L+ +LL++GE        S T  L++++Y+L+K   LT   +  
Sbjct: 49  ILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 108

Query: 88  VALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLT 147
           ++   D   A  +L+ L+ +YY D +  V D    +KI  +P H + MVM THL+N HL 
Sbjct: 109 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLR 168

Query: 148 RGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNK--KNIRRKKEPQLSNSPDILFYERLI 205
              ++  L   FAN+S   I    ++CS CN     K ++  K P + +   +L  ER+ 
Sbjct: 169 GKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDK--LLPMERIH 226

Query: 206 LDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVF 265
           ++V  PF  + I+ +Y+++L   D+ + FMW  PLK+ K + +I  ++   ++    P+F
Sbjct: 227 IEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIF 286

Query: 266 ISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPY-VTRILNSHKTECLKSWF 324
           ++S TL  +D++++C  +A +Y + IGLG ++  + ++     +   LNS+K ECL  W 
Sbjct: 287 VTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWG 346

Query: 325 MCLKWLADRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFINIDEGS 384
            CL++   R +  +           L S +     K+E + + +I    S N      G 
Sbjct: 347 KCLRYGPYRFNRRRNKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGK 406

Query: 385 HFIYSEDEFSF 395
             IY ED  +F
Sbjct: 407 GLIYLEDVNTF 417

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  170 bits (431), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 109/383 (28%), Positives = 195/383 (50%), Gaps = 19/383 (4%)

Query: 28  NIKYIIPRIGQKYDSLITPLLDKQLLQKGEIAVA---NSKTNYLSKELYDLVKNDDLTRK 84
           + K+++P  G    S    L D+ +L +G + +    N+    L++ +YDL+ +D LT++
Sbjct: 54  DFKFVLPVKGFDLGSFCGEL-DQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKE 112

Query: 85  NVAVALNLDEKNAI-TRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLN 143
           N+  A +    + +  + + LK RYY    L+ HD  +++ +V +P   F ++M+ H+LN
Sbjct: 113 NLLRASDKVTNSTVENKFVLLKRRYYVQENLL-HDVKRKDLVVYEPNELFDLIMSVHVLN 171

Query: 144 DHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYER 203
            H++   IY  LS  +AN++  F K    +CS CN +   I  KK    +   +++   R
Sbjct: 172 SHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGR 231

Query: 204 LILDVVAPFGAK----------KIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVT 253
             +++ APF +           KI+ +Y  +L   D++++++W  PLK++ L  ++  +T
Sbjct: 232 CHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMT 291

Query: 254 EFIVALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPY--VTRI 311
           + + ++   P+FI + TL   D+F++C  +AR Y I IGLG  N   ++ K     +  +
Sbjct: 292 KLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGM-NSSTSFQKTGIKRMKSL 350

Query: 312 LNSHKTECLKSWFMCLKWLADRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGR 371
              HK ECL  W MCLK +  R + +  D      +  L S   D  KK+    + +I R
Sbjct: 351 FLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISR 410

Query: 372 LPSENFINIDEGSHFIYSEDEFS 394
           L   + +  +E    IY EDE S
Sbjct: 411 LLGHHVVQFEEAGGMIYLEDENS 433

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  167 bits (424), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 113/373 (30%), Positives = 193/373 (51%), Gaps = 13/373 (3%)

Query: 32  IIPRIGQKYDSLIT-PLLDKQLLQKGEIAVANSKT---NYLSKELYDLVKNDDLTRKNVA 87
           ++P I +  D LI+   L+K+L  +G   +A  ++    YLS+ +YDL+  D LT K V+
Sbjct: 61  VLPEI-KNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVS 119

Query: 88  VALNLDEKNAITRLIPLKHRYY-RDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHL 146
                    +  +   LK+RYY  D    V DR   +KI+  P     +V+ THL+N+H 
Sbjct: 120 REKVKWANKSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHA 179

Query: 147 TRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERLIL 206
              +++R L K +AN+S    + S+ YCS CN ++     KK  +      +L +ER+ +
Sbjct: 180 AHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHI 239

Query: 207 DVVAPFGAKK-IQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVF 265
           ++  PFG +K I+  Y+HIL I D++++++W +PLK    + +   +  +   +   P++
Sbjct: 240 EIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIY 299

Query: 266 ISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQK-AYSKNPYVTRILNSHKTECLKSWF 324
           I S T++ ND+  +   +A +Y++ IG+G  N     Y+    + ++L  H+ ECL  W 
Sbjct: 300 IESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWG 359

Query: 325 MCLKW---LADRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFINID 381
           MCLK+   L +   N K    P   N  L SG+++   KY+ +   +I      N I +D
Sbjct: 360 MCLKYGKNLHNNLKNRKVLGMPI--NLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLD 417

Query: 382 EGSHFIYSEDEFS 394
            G   IY ED  +
Sbjct: 418 NGKSEIYLEDNLT 430

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  168 bits (425), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 110/378 (29%), Positives = 202/378 (53%), Gaps = 16/378 (4%)

Query: 28  NIKYIIPRIGQKYDSLITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRK 84
            +K+ +P++G+  +     L D +LL +G    I    S    L++E +DLV++  LT +
Sbjct: 16  GVKFRMPKVGETLEKYGNGLND-ELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAE 74

Query: 85  NV-AVALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLN 143
           N+ + +  L   N  T+ + LK R+Y D+   V D    + +V +P   F ++M  HL N
Sbjct: 75  NLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKN 134

Query: 144 DHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYER 203
            H+    ++  L + +AN +  F +  + YCS CN  +     +K    +    +L  ER
Sbjct: 135 GHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLER 194

Query: 204 LILDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKP 263
           + ++++APF  K I+  Y+H+L + D++++F+W  PL + ++  I      F+++LP  P
Sbjct: 195 VHVEIIAPF-PKLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVP 253

Query: 264 VFISSFTLSLNDIFELCCYLAREYNISIGLG-TRNMQKAYSKNPYVTRILNSHKTECLKS 322
           +F+ + TL   D+FE+C  +A +Y +SIGLG +R+     +    +  +L  ++  CLKS
Sbjct: 254 IFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKS 313

Query: 323 WFMCLKWLADRQS---NSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFIN 379
           W MCLK+     +   N++    P N    L S ++D+ +++E + + +I +L + N + 
Sbjct: 314 WHMCLKFGVTNHNMTYNARVLGLPGNL---LHSTVSDYGRQFELKREELIEKLFASNVVE 370

Query: 380 I-DEGSH--FIYSEDEFS 394
           + +EG     IY EDE S
Sbjct: 371 LRNEGRRRGMIYLEDESS 388

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  162 bits (411), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 99/360 (27%), Positives = 186/360 (51%), Gaps = 11/360 (3%)

Query: 44  ITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRKNVAVALNLDEKNAITR 100
           + P LD   L  G    I + N+    L++++Y+L+ ++ L+ + +    +      +  
Sbjct: 47  LAPELDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVEN 106

Query: 101 LIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFA 160
              L  R Y   +  V D  +++  VI+P   F ++M  HL+N HL    I++ L   +A
Sbjct: 107 KFVLLKRRYSILQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYA 166

Query: 161 NLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERLILDVVAPF---GAKKI 217
           N++  F      YCS CN+++   R  +    +    ++  ER  +++ APF   G +KI
Sbjct: 167 NVTRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKI 226

Query: 218 QKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVFISSFTLSLNDIF 277
           + +Y+H+L   D+H++F+W  PL+ +  R ++  +T+ + ++   P+F+ + TL   D+F
Sbjct: 227 EDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMF 286

Query: 278 ELCCYLAREYNISIGLGTRNMQKAYSKNPYVTRILN---SHKTECLKSWFMCLKWLADRQ 334
           ++C Y+AR+Y + IGLG  N    + +N  VTRI N    HK +C+K W MCL+ +  R 
Sbjct: 287 DVCEYIARKYKLKIGLGL-NSGTDFQRNG-VTRIKNLFAEHKEQCIKEWNMCLRLVLTRV 344

Query: 335 SNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFINIDEGSHFIYSEDEFS 394
           + +  D      +  L + +++   K++ + + II  L + + +   E    IY ED+ S
Sbjct: 345 NQNYSDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNS 404

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  162 bits (410), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/326 (29%), Positives = 177/326 (54%), Gaps = 31/326 (9%)

Query: 30  KYIIPRIGQKYDSLIT---PLLDKQLLQKGEIAV---ANSKTNYLSKELYDLVKNDDLTR 83
           K+++P + + Y+  +      +D   L++GE  +   A      L++E Y L+ N++LT 
Sbjct: 59  KFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTM 118

Query: 84  KNVAVALNLDEKNAI-TRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLL 142
           + V  A+N+   NA  T+   L  R+Y+D +  + D    N IV++P   F +++T HL 
Sbjct: 119 ETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLK 178

Query: 143 NDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNK--KNIRRKKEPQLSNSPDILF 200
           N HL    +++ L + +AN +  F++T++ YC+ CN ++  K I + +   ++   ++L 
Sbjct: 179 NGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINE--ELLP 236

Query: 201 YERLILDVVAPFGAK--------------KIQKRYTHILTITDFHTKFMWSFPLKNLKLR 246
            ER+ ++V APF  +              KI+ +Y+H+    DF T+++W FPLKN+K +
Sbjct: 237 LERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFK 296

Query: 247 TIISKV-TEFIVALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKN 305
           T++  + T F+  L   P+F+ S T+  +D+ E+   LA +Y + +GLG  N  K +++ 
Sbjct: 297 TLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQG 356

Query: 306 PYVTRI---LNSHKTECLKSWFMCLK 328
             + R    L+  K+EC   W MCLK
Sbjct: 357 --IKRFKTHLHRAKSECADDWLMCLK 380

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  159 bits (403), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 109/386 (28%), Positives = 203/386 (52%), Gaps = 18/386 (4%)

Query: 29  IKYIIPRIGQKYDSLITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRKN 85
           +++ +P +G+  +     L + +LL++G    I    S    L+++ +DLV++  LT  N
Sbjct: 17  VEFDMPAVGEPIEKYHNGL-NLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTEDN 75

Query: 86  VAVALN-LDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLND 144
           +    + L   N  T+ + LK RYY D+  +V D    + +V +P   F ++M  HL N 
Sbjct: 76  LMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNG 135

Query: 145 HLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERL 204
           HL    ++  L   +AN +  F +  ++YCS CN  ++    KK    +    +L  ER+
Sbjct: 136 HLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLERV 195

Query: 205 ILDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPV 264
            +++++PF ++ I+  Y+H+L   D++++F+W  PLK   +R I   +   ++ LP  P+
Sbjct: 196 HVEIISPF-SEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLATLLLLPRIPI 254

Query: 265 FISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPY--VTRILNSHKTECLKS 322
           FI + T+   D+FE C  +A +Y++ IGLG  +    + KN    +  +L  ++ +CL+S
Sbjct: 255 FIETSTIDRQDLFEACEDVAGQYSLYIGLGM-SQSSTFQKNGVERLRYLLQRNEEQCLRS 313

Query: 323 WFMCLKWLADRQS---NSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFIN 379
           W+MCLK+ A   +   N++    P N    L S + D+ +++E + + +I +L + N + 
Sbjct: 314 WYMCLKYGATNHNLNYNARILGVPGNL---LHSTVCDYGRQFELKREDLIEKLFARNVVE 370

Query: 380 IDEGSH---FIYSEDEFSFDNLVEKE 402
           I         IY EDE S   + ++E
Sbjct: 371 IKVSGRRRGIIYLEDETSAFKMPDEE 396

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  156 bits (395), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 100/360 (27%), Positives = 187/360 (51%), Gaps = 12/360 (3%)

Query: 55  KGEI-AVANSKTNYLSKELYDLVKNDDLTRKNVAVALNLDEKNAI-TRLIPLKHRYYRDS 112
           +GE+  +  +    L++E+YDL+ +D L+ + +    +    N +  + + LK RY    
Sbjct: 54  RGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKRRYVAKG 113

Query: 113 KLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANLSDPFIKTSIE 172
            +++ DR +++  VI+P   F M+M+ HL+NDH+    +Y+ +   +AN++         
Sbjct: 114 GIVI-DRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELTNMVTG 172

Query: 173 YCSICNSNKKNIRRKKEPQLSNSPDILFYERLILDVVAPF---GAKKIQKRYTHILTITD 229
           YCS CN ++   R  +    +    ++  ER  ++V APF   G +KIQ +Y+H L   D
Sbjct: 173 YCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRD 232

Query: 230 FHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVFISSFTLSLNDIFELCCYLAREYNI 289
           +H++F+W  PL+ +  R ++  + + +  +   P+F+ + TL   D+F++C  +AR Y  
Sbjct: 233 YHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIARRYKF 292

Query: 290 SIGLGTRNMQKAYSKNPY--VTRILNSHKTECLKSWFMCLKWLADRQSNSKFDIRPPNKN 347
            IGLG  N    + KN    V ++L+ +K EC   W MCL+ +  R + +  D      +
Sbjct: 293 KIGLGL-NSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVRGIPS 351

Query: 348 YGLFSGMTDFLKKYEERSKMIIGRLPSENFINIDEGSHFIYSEDE---FSFDNLVEKETP 404
             L + + +   K++++ K II +L + + ++  E    IY EDE   F  D+  +  TP
Sbjct: 352 DLLCNEIPNISMKFKQKQKKIIDQLYAHHVVHFKEAGGMIYLEDEESAFVMDDPDDDCTP 411

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  137 bits (346), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 100/392 (25%), Positives = 193/392 (49%), Gaps = 30/392 (7%)

Query: 31  YIIPRIGQKYDSLITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRKNVA 87
           +  P IG   +      +D  +L++GE   +   N+   +++ +LY  ++++ L   +  
Sbjct: 28  FFCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAP 87

Query: 88  VALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLT 147
           +  +L  K +    + +++    D  L+    +K NK++ +P + +++ M  H +N+H+ 
Sbjct: 88  IPASLKIKTSKKMYLQIRYSKNSDGDLI---ETKTNKLLCEPKYIYKLTMKAHFMNNHMR 144

Query: 148 RGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIR--RKKEPQLSNSPDILFYERLI 205
              +YR LS  + N+ +  +   ++YCS CN+  K IR  R    Q +   D L  ERL 
Sbjct: 145 SNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGK-IRDIRSNYGQRNQYIDYLPLERLQ 203

Query: 206 LDVVAPFGAK--KIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKP 263
           +D+  PF     KI  +Y+HIL I D+H+++ W FPLK+  ++ I +++ +F+V LP  P
Sbjct: 204 IDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTP 263

Query: 264 VFISSFTLSLNDIFELCCYLAREYNISIGLGTRN------MQKAYSKNPYVTRILNSHKT 317
           +F+ S  +  + + ++   +  EY I I +G         ++K  S+  Y+   L  +K 
Sbjct: 264 IFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLN-LKENKE 322

Query: 318 ECLKSWFMCLKWLADRQSNSKFDIRPPNKNYGLFSGM------TDFLKKYEERSKMIIGR 371
           +C   W+ C++    ++ N +FD     +N G F+         +  K +E +   ++  
Sbjct: 323 KCKSDWYQCIRNTTFKE-NRRFD-----RNTGSFANFLIGKQKAELNKVFENKRDALLSD 376

Query: 372 LPSENFINIDEGSHFIYSEDEFSFDNLVEKET 403
           L  EN + I E    IY ++  S   L EK+ 
Sbjct: 377 LLEENVLKIGECGSIIYFDNNNSGKELDEKDV 408

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  129 bits (324), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 103/368 (27%), Positives = 190/368 (51%), Gaps = 37/368 (10%)

Query: 51  QLLQKG--EIAVANS-KTNYLSKELYDLVKNDDLTRKNVAVALNLDEK-----NAITRLI 102
           +LL+KG  ++   +S K   L++E  D++    L+ +N+   +  D K      A+ +  
Sbjct: 53  ELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENI---IKYDTKLTNHSKALEKYN 109

Query: 103 PLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANL 162
               RYY +    + D+ K  +I+ +P + + +V+  HL     +  A+   L K F+N+
Sbjct: 110 FTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL--KLHSSYAVSERLKKFFSNV 167

Query: 163 SDPFIKTSIEYCSICNSNK-------------KNIRRKKEPQLSNSPDILFYERLILDVV 209
              +I    +YCS C  ++             KNIR      + + P +   ER+ +++ 
Sbjct: 168 GRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRN----NIIDRP-LFPMERIHIEIF 222

Query: 210 APFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVK-PVFISS 268
            PF   KI+ +Y  IL I D+ T+++W+F LK LKL+ I + +TEF +++    P+F+ S
Sbjct: 223 NPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQS 282

Query: 269 FTLSLNDIFELCCYLAREYNISIGLGTRNMQKAY--SKNPYVTRILNSHKTECLKSWFMC 326
            T+   D+F++C  ++REY+IS+GLGT N    +  S      +++N +K++CLKSW   
Sbjct: 283 STIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNF 342

Query: 327 LKWLADRQSNSKFDIRPPNKNYGLF--SGMTDFLKKYEERSKMIIGRLPSENFINIDEGS 384
           L +      N+KF+ R  +K   +   + +    KK+ +R   II +  ++N++ +   +
Sbjct: 343 LVF-GSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVA 401

Query: 385 HFIYSEDE 392
             I+ EDE
Sbjct: 402 SIIFIEDE 409

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/280 (21%), Positives = 145/280 (51%), Gaps = 16/280 (5%)

Query: 29  IKYIIPRIGQKYDSLITPLLDKQLLQKG---EIAVANSKTNYLSKELYDLVKNDDLTRKN 85
           IK  IP +   Y   +   +D + +  G    + + +  +++L++++Y L++  +   + 
Sbjct: 20  IKVDIPELDILYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYET 79

Query: 86  VAVALNLDEKN-------AITRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMT 138
              A+     +       A  + + ++ RY  +    + D+    K+++ P   + ++M 
Sbjct: 80  FEEAMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMH 139

Query: 139 THLLNDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDI 198
            H LNDHL    I+ +L + ++N+S   ++ S++ CS CN   K+  +  E     S D 
Sbjct: 140 CHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNP--KSTYKHIEYTRHFSCDK 197

Query: 199 LF-YERLILDVVAPF-GAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKV-TEF 255
            F +E++ +++  PF        +++H++ I D+ T+++W +PL+ + ++ + + + T  
Sbjct: 198 NFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHL 257

Query: 256 IVALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGT 295
           +++L + P++I S TL  +++ ++   +++  N+ +G+GT
Sbjct: 258 LLSLRI-PIYIESLTLDESNLLKILKRISKTTNLILGVGT 296

>Kwal_15.2639 s15 complement(2..292) [291 bp, 97 aa] {OFF} [contig
           347] PARTIAL
          Length = 97

 Score = 33.5 bits (75), Expect = 0.22,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 167 IKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERLILD 207
           I  +I YCS+CNS    IR    PQ  +   +   +RL+ D
Sbjct: 46  ISATISYCSVCNSRLPAIRLSSMPQYLSYTSLFGLQRLVDD 86

>YLR253W Chr12 (642627..644336) [1710 bp, 569 aa] {ON} Putative
           protein of unknown function; the authentic, non-tagged
           protein is detected in highly purified mitochondria in
           high-throughput studies; transcription is periodic
           during the metabolic cycle; YLR253W is not an essential
           gene
          Length = 569

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 53/119 (44%), Gaps = 13/119 (10%)

Query: 45  TPLLDKQLLQKGEIAVANSKTNYLSKELYDLVKNDDLTRKNVAVALNLDEKNAITRLIPL 104
           +P   K LL  G IA A    N+ +   +D VK+  LT K +AV        A TR    
Sbjct: 29  SPRTRKSLLVGGTIASAVVLYNF-NDTFHDSVKHTALTTKRIAVV-----TQATTRCF-- 80

Query: 105 KHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANLS 163
              +Y+ +    ++  K+ ++ ++  H+   ++T H L    + G IY  L +    ++
Sbjct: 81  --YHYKRALNKSYENKKEREVALNKCHKMCALITLHALR---SNGGIYIKLGQHIGAMT 134

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
           Anc_8.256 YLR084C
          Length = 1204

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 10/75 (13%)

Query: 9   EPNPEKDRNEFK---DPEHVLANIKYIIPRIGQ-KYDSLITPLLDKQLLQKGEIAVANSK 64
            P+P+ + + F+   DP   + N+ YI P +GQ K+     PL  KQ+L+     V    
Sbjct: 301 SPDPDNEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVT--- 357

Query: 65  TNYLSKELYDLVKND 79
              LS E+ +L+ ++
Sbjct: 358 ---LSSEMIELLNDN 369

>AAR169C Chr1 complement(645880..647502) [1623 bp, 540 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR223C
           (TDP1)
          Length = 540

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 327 LKWLADRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFINIDE-GSH 385
           + W+  + ++S+   + P++     SG+ D+L+ Y E  + ++ RL   +F  +D  G+ 
Sbjct: 191 MMWMTPQLAHSRAAEQQPSR---FRSGLQDYLQMYPEPDRELLQRLRKIDFAPVDATGAA 247

Query: 386 FIYS 389
           F+YS
Sbjct: 248 FVYS 251

>TDEL0B05590 Chr2 (990659..991699) [1041 bp, 346 aa] {ON} 
          Length = 346

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 244 KLRTIISKVTEFIVALPVKPVFISSFTLSLND---IFELCCYLAREYN 288
           KL T+ S++ EFI    +KPV IS++   ++D   + EL C + +E++
Sbjct: 101 KLATVESELREFIRVNKLKPVTISTWACDISDATQVEELICAIPQEHD 148

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
           YEL055C
          Length = 1018

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 13  EKDRNEFKDPEHVLANIKYII--PRIGQKYDSLITPLLDKQLLQKGEIAVANSKTNYLSK 70
           EK  N+ K+  +VL  + +I+   + G +YD+++TPLLD  L+Q    A  N   N L+K
Sbjct: 475 EKSENKQKN-RYVLDTLLHIVRTHKTGLEYDAIVTPLLDP-LIQWAFFAKENEPLNELAK 532

Query: 71  ELY 73
           E +
Sbjct: 533 ERF 535

>Suva_10.349 Chr10 (609820..611529) [1710 bp, 569 aa] {ON} YLR253W
           (REAL)
          Length = 569

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 67/158 (42%), Gaps = 18/158 (11%)

Query: 50  KQLLQKGEIAVANSKTNYLSKELYDLVKNDDLTRKNVAVALNLDEKNAITRLIPLKHRYY 109
           + LL  G I  A +  N+ +   +D VK+  LT K VAV        A TR       +Y
Sbjct: 34  RALLMGGSITSAVALYNF-NDTFHDSVKHTALTTKRVAVV-----TQATTRCF----YHY 83

Query: 110 RDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANLS----DP 165
           + +    ++  K+ ++ ++  H+   ++T H L    + G IY  L +    ++      
Sbjct: 84  KRALNKNYESKKEREVALNDCHKMCALITLHALR---SNGGIYIKLGQHIGAMTYLLPKE 140

Query: 166 FIKTSIEYCSIC-NSNKKNIRRKKEPQLSNSPDILFYE 202
           +  T I     C  S  + I +  E  L  S + +F+E
Sbjct: 141 WTDTMIPLQDHCPESTFEEINQLFEEDLGTSIENMFWE 178

>TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,
           1248 aa] {ON} 
          Length = 1248

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 91/228 (39%), Gaps = 34/228 (14%)

Query: 39  KYDSLITPLLDKQLLQKGEIAVANSKTNYLSKELYDLVKNDDLTRKNVAVALNLDEKNAI 98
           K D+L +P     LL  GE+       NY +K + +        +  V VA         
Sbjct: 441 KVDALSSPAAKTNLLSVGELLREGFYVNYRNKTIEN--------KHGVPVA--------- 483

Query: 99  TRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTT----HLLNDHLTRGAIYRT 154
            ++I     ++  SK ++    K  K +I  A+    V  +    H L  H+   +I  +
Sbjct: 484 -KMIQKGPYFWLSSKYLI----KPQKTIIQKANNVNKVKYSVDYLHRLFGHVNVKSIKDS 538

Query: 155 L-SKCFANLS-DPFIKTSIE--YCSICNSNKKNIRRK-KEPQLSNSPDILFYERLILDVV 209
           +  +  A +  D    T++E   C IC   K    R     +L    +   ++ +  D+ 
Sbjct: 539 IKDRSIAGIEVDEVDWTNLEKFQCEICMMGKSTKGRHLMNSRLKYQKEYKPFQFIHTDLF 598

Query: 210 APFGAKKIQ-KRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFI 256
            P     +   RY  +L  TD  T++ W FPL+    ++I ++ +E +
Sbjct: 599 GPVQVTAVNVPRY--LLAFTDECTRYKWVFPLREKDSQSITARFSELV 644

>KNAG0F01690 Chr6 complement(307857..310778) [2922 bp, 973 aa] {ON}
           Anc_6.266 YMR185W
          Length = 973

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 55/121 (45%), Gaps = 18/121 (14%)

Query: 51  QLLQKGEIAVANSKTNYLSKELYDLVKNDDLTRKNVAVALNLDEKNAITRLIPLKHRYYR 110
           QLL K E+A+   K++ L   L+D+        K +A+ +NL   + I   +P   R   
Sbjct: 73  QLLAKNEVALQKQKSDLLPISLHDM--------KYLALLINLIIVHGIDANVPQTMRIPF 124

Query: 111 DSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANLSDPFIKTS 170
           +S+ + + +   ++  I P+H            ++ T  ++  TLS       + ++K++
Sbjct: 125 ESRRLSNFKKNDSRYAIPPSHTL----------ENSTLSSVVDTLSNILLTTENSYLKST 174

Query: 171 I 171
           I
Sbjct: 175 I 175

>KAFR0B03660 Chr2 (764750..766027) [1278 bp, 425 aa] {ON} Anc_8.825
           YMR270C
          Length = 425

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 7/102 (6%)

Query: 103 PLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANL 162
           P K +  +D   M+      N I+    H  R  ++ HL +  L +  +Y+  SK  A  
Sbjct: 32  PTKKKLSKDDMTMI---DSANDILDSLEHNHRNDLSLHLYSSFLLKKLLYKANSKKHAYE 88

Query: 163 SDPFIKTSIEYCSICNSNKKNIRRKKEPQLSN-SPDILFYER 203
           ++ FIKT I+   +   N   I    +PQ +N   DI F E+
Sbjct: 89  TNQFIKTQIKDNWVSWPNPNAII---DPQTNNIYEDIQFGEK 127

>Kpol_2002.104 s2002 complement(246226..248355) [2130 bp, 709 aa]
           {ON} complement(246226..248355) [2130 nt, 710 aa]
          Length = 709

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 21/116 (18%)

Query: 248 IISKVTEFIVALPVKPVFISSFTLSLNDIFELCCYLAR-EYNISIGLGTRNMQKAYSKNP 306
           I+  + ++ V     P  +SS  ++ ++IFE C  LA  +Y I I L  + +   +    
Sbjct: 134 ILFHLIDYSVVETASPALLSSVLVATSNIFECCAILANYDYKIGIVLVLKILFYYFD--- 190

Query: 307 YVTRILNSHKTECLKSWFMCLKWLADRQSNSKFDIRPPNKNYGLFSGMTDFLKKYE 362
                LN H  E + + F           + K D     K  G FSG+   L+K++
Sbjct: 191 -----LNGH--ELISAIF----------ESKKLDDHILKKTAGCFSGIITVLRKFK 229

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,780,005
Number of extensions: 2282926
Number of successful extensions: 6949
Number of sequences better than 10.0: 54
Number of HSP's gapped: 7122
Number of HSP's successfully gapped: 54
Length of query: 457
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 344
Effective length of database: 40,524,141
Effective search space: 13940304504
Effective search space used: 13940304504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)