Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0A018008.263ON49849826520.0
Kpol_543.398.263ON49248917330.0
KLLA0F19162g8.263ON52849216850.0
TDEL0F039008.263ON55949016870.0
KNAG0G020408.263ON59149816670.0
YLR089C (ALT1)8.263ON59249016660.0
Skud_12.1578.263ON59249016660.0
Smik_12.1488.263ON59249016640.0
NCAS0B050208.263ON56849216590.0
NDAI0B019908.263ON58849016580.0
Suva_10.1738.263ON59249116470.0
ZYRO0C01628g8.263ON53448716400.0
Skud_4.3728.263ON50749116370.0
Suva_2.2718.263ON50749116300.0
NDAI0J013608.263ON50149016290.0
SAKL0H17006g8.263ON53148916300.0
YDR111C (ALT2)8.263ON50749116120.0
Smik_4.3578.263ON50749016100.0
CAGL0L12254g8.263ON57449116160.0
KAFR0B055308.263ON51449916050.0
NCAS0B038408.263ON49749116000.0
Kpol_392.58.263ON51249415920.0
KAFR0B027308.263ON53949615820.0
TBLA0E044408.263ON56248015610.0
KAFR0B05520singletonON51049215540.0
TPHA0J007508.263ON52249015460.0
Kwal_56.237918.263ON51848515360.0
Ecym_43078.263ON53448915320.0
KNAG0M012108.263ON52149015270.0
KLTH0G13662g8.263ON51948515260.0
AGR085W8.263ON52149214900.0
TBLA0F030608.263ON50049814640.0
TBLA0G01630singletonON50049914260.0
Kpol_1035.231.321ON4443511392e-08
Kwal_34.160181.472ON3791661364e-08
KLTH0G19646g1.472ON3791461349e-08
AEL170C1.321ON4583591341e-07
TPHA0O014501.321ON4431771331e-07
NCAS0A092001.321ON4453251293e-07
Suva_6.1361.321ON4441711284e-07
Skud_10.1561.321ON4601721223e-06
Ecym_6319singletonON3542901195e-06
Smik_10.1801.321ON4443531195e-06
KLLA0F01617g1.321ON4441811196e-06
SAKL0D11528g1.472ON3831521188e-06
TDEL0D019001.321ON4431701171e-05
KNAG0B053201.321ON4331681171e-05
CAGL0J05126g1.321ON4331701161e-05
YJL060W (BNA3)1.321ON4441701152e-05
SAKL0F02156g3.511ON4981531134e-05
NCAS0G040501.472ON3841371124e-05
Kpol_278.23.511ON4981861124e-05
KNAG0G005501.472ON3871651115e-05
KLTH0H10648g1.321ON4433681107e-05
NDAI0G057601.321ON4481271108e-05
KLLA0F10021g3.511ON4972631108e-05
Kwal_14.25741.321ON4431371091e-04
ZYRO0G20636g1.321ON4531591091e-04
CAGL0G01254g3.511ON5041891072e-04
NCAS0E006703.511ON4971761072e-04
KLLA0A04906gna 1ON4801811072e-04
Kwal_47.189823.511ON4961861053e-04
Ecym_62921.321ON4302761053e-04
KLLA0F03509g2.252ON3871701035e-04
Kpol_480.11.472ON3801971035e-04
KAFR0A017101.321ON4351271026e-04
Kpol_1039.222.252ON3861681018e-04
AFR548C3.511ON4971551000.001
AGR167Wna 1ON512196990.002
KLTH0G09614g2.252ON389124970.003
TPHA0D033703.511ON497153970.003
TPHA0F012602.252ON392175960.004
KNAG0B006603.511ON496155960.004
SAKL0H21824gna 1ON499189960.004
NDAI0I028303.511ON500153960.004
Skud_8.1982.102ON517163950.005
SAKL0D06886g1.321ON447368950.005
TBLA0B009902.102ON546130940.006
Suva_15.3342.102ON560163940.007
SAKL0E08492g2.252ON384127930.007
TDEL0A016008.204ON475163940.007
TBLA0B080808.204ON444202910.013
ZYRO0A01672g2.252ON386125880.030
KLTH0G02002g3.511ON496186880.033
Kwal_23.48882.252ON389132860.061
YGL202W (ARO8)3.511ON500153850.078
NCAS0B064402.252ON385123840.093
Skud_19.6singletonON40191840.094
Kwal_47.17462na 1ON492199840.098
Suva_17.6singletonON401100840.11
TDEL0D057903.511ON497189840.12
Ecym_32902.252ON386123830.14
Smik_7.693.511ON500154830.14
ZYRO0C06028g3.511ON496152830.15
KAFR0J015802.252ON383132820.16
TDEL0F009002.102ON493150820.17
YHR137W (ARO9)2.102ON513163820.19
KLTH0E07678gna 1ON492122800.30
Ecym_7228na 1ON488125790.46
YFR055W (IRC7)na 2ON340180780.46
KAFR0D014203.511ON492123780.51
KNAG0E018502.252ON384122780.53
Smik_7.375na 2ON40199780.61
KLTH0B00176g8.204ON448182770.73
KLTH0G19624gsingletonON468182760.88
Suva_7.613.511ON500153760.91
ADL249W2.252ON387124760.95
ZYRO0G05346g2.102ON504139761.1
CAGL0I06578g8.204ON436220751.2
KLLA0B04378g4.354ON68883751.4
Kpol_1032.398.204ON453188751.5
TDEL0C040902.252ON383147741.5
Smik_8.2182.102ON513173741.6
KAFR0B023808.204ON443181741.7
Ecym_71085.198ON28373722.1
NCAS0A102803.228ON379201722.5
Skud_9.552.252ON385122722.7
ZYRO0B10516g5.198ON243113703.5
TDEL0A019402.420ON420177713.5
NCAS0B040308.227ON60861723.6
ZYRO0B11088g8.204ON45033713.6
SAKL0H18612g8.204ON445180705.0
Skud_8.2734.385ON62370705.0
YHR206W (SKN7)4.385ON62270705.3
YJR130C (STR2)4.354ON63983705.9
Skud_7.693.511ON500122696.6
Suva_9.782.252ON386122696.9
YER152C8.204ON443139697.0
SAKL0G18172g4.354ON67383697.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0A01800
         (498 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...  1026   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   672   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   653   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   654   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   646   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   646   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   646   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   645   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   643   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   643   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   639   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   636   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   635   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   632   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   632   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   632   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   625   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   624   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   627   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            622   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   620   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   617   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   613   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   605   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   603   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   600   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   596   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   594   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   592   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   592   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   578   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   568   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              553   0.0  
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    58   2e-08
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    57   4e-08
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    56   9e-08
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    56   1e-07
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    56   1e-07
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    54   3e-07
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    54   4e-07
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    52   3e-06
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    50   5e-06
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    50   5e-06
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    50   6e-06
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    50   8e-06
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    50   1e-05
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    50   1e-05
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    49   1e-05
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    49   2e-05
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    48   4e-05
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    48   4e-05
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    48   4e-05
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       47   5e-05
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    47   7e-05
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    47   8e-05
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    47   8e-05
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    47   1e-04
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    47   1e-04
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    46   2e-04
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     46   2e-04
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    46   2e-04
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    45   3e-04
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    45   3e-04
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    44   5e-04
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    44   5e-04
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    44   6e-04
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    44   8e-04
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    43   0.001
AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-synte...    43   0.002
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    42   0.003
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    42   0.003
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    42   0.004
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    42   0.004
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    42   0.004
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    42   0.004
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    41   0.005
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    41   0.005
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    41   0.006
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    41   0.007
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    40   0.007
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    41   0.007
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    40   0.013
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    39   0.030
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    39   0.033
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    38   0.061
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    37   0.078
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    37   0.093
Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON} YF...    37   0.094
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    37   0.098
Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)    37   0.11 
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    37   0.12 
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    37   0.14 
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    37   0.14 
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    37   0.15 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    36   0.16 
TDEL0F00900 Chr6 complement(153488..154969) [1482 bp, 493 aa] {O...    36   0.17 
YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromat...    36   0.19 
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    35   0.30 
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    35   0.46 
YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}  IRC7Beta-l...    35   0.46 
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    35   0.51 
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    35   0.53 
Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W ...    35   0.61 
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    34   0.73 
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    34   0.88 
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    34   0.91 
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    34   0.95 
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    34   1.1  
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    33   1.2  
KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} simila...    33   1.4  
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    33   1.5  
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    33   1.5  
Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W ...    33   1.6  
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    33   1.7  
Ecym_7108 Chr7 complement(209729..210580) [852 bp, 283 aa] {ON} ...    32   2.1  
NCAS0A10280 Chr1 complement(2049779..2050918) [1140 bp, 379 aa] ...    32   2.5  
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    32   2.7  
ZYRO0B10516g Chr2 complement(829319..830050) [732 bp, 243 aa] {O...    32   3.5  
TDEL0A01940 Chr1 (355974..357236) [1263 bp, 420 aa] {ON} Anc_2.4...    32   3.5  
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    32   3.6  
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    32   3.6  
SAKL0H18612g Chr8 (1655787..1657124) [1338 bp, 445 aa] {ON} high...    32   5.0  
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    32   5.0  
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    32   5.3  
YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON} ...    32   5.9  
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    31   6.6  
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    31   6.9  
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    31   7.0  
SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]...    31   7.7  

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score = 1026 bits (2652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/498 (100%), Positives = 498/498 (100%)

Query: 1   MESEHFTDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIIN 60
           MESEHFTDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIIN
Sbjct: 1   MESEHFTDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIIN 60

Query: 61  ANIGNPQQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEI 120
           ANIGNPQQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEI
Sbjct: 61  ANIGNPQQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEI 120

Query: 121 GGSVGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPT 180
           GGSVGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPT
Sbjct: 121 GGSVGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPT 180

Query: 181 TGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIV 240
           TGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIV
Sbjct: 181 TGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIV 240

Query: 241 IINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRK 300
           IINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRK
Sbjct: 241 IINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRK 300

Query: 301 YLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQA 360
           YLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQA
Sbjct: 301 YLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQA 360

Query: 361 LIDMVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFP 420
           LIDMVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFP
Sbjct: 361 LIDMVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFP 420

Query: 421 KFIFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDS 480
           KFIFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDS
Sbjct: 421 KFIFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDS 480

Query: 481 WIDLWRKFHTEFCERYRS 498
           WIDLWRKFHTEFCERYRS
Sbjct: 481 WIDLWRKFHTEFCERYRS 498

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/489 (65%), Positives = 386/489 (78%), Gaps = 1/489 (0%)

Query: 9   FTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQ 68
           F P  K+++ DLN   +   YAVRG IP RAE+L  Q+  DP SLPF+KII ANIGNPQQ
Sbjct: 3   FVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQ 62

Query: 69  LGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYS 128
           +GQKPL+FIR+VLSIL+YP+IL D   L+ L++L VYQ+DV+ RARK+L  IGGSVGAYS
Sbjct: 63  VGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYS 122

Query: 129 LSQGVPGIQQTVADYITKRDS-GEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187
            SQGV G +QTVAD+I KRD   ++A P DIFLT GASSAV ++L + C+GP  GVLIPI
Sbjct: 123 ASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPI 182

Query: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247
           PQYPLYTAT+TL  +TAI YYL E  +WS NT E+E  I+ES+ +G+KP  IVIINPGNP
Sbjct: 183 PQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNP 242

Query: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307
           TG+IL+E D+A+IIRISAKYG+ IIADEVYQEN+F G EFHS++KVL  LQ ++ G Y+ 
Sbjct: 243 TGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDN 302

Query: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367
           VQLASLHSTSKG IGECGQRGGYMELIG  D+V   V+KL SISICSVVTGQAL+D+V  
Sbjct: 303 VQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTC 362

Query: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427
           PP+PGD SY++DQ ERN IK DL+ R+ +L+ LF SLEGVEC RPQGAMYLFPK I P K
Sbjct: 363 PPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDK 422

Query: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487
            I+ A +L    D  YC+ELL+ TGICTVPGSGFGQ P TYHLRTTFLVPG  WI+ WR+
Sbjct: 423 AIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWRE 482

Query: 488 FHTEFCERY 496
           FH +F ER+
Sbjct: 483 FHQQFYERF 491

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/492 (61%), Positives = 385/492 (78%), Gaps = 6/492 (1%)

Query: 7   TDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNP 66
           T   P  K++L D+N  ++K +YAVRG IP RAEEL+ QL+KDP SLPF+KII+ANIGNP
Sbjct: 41  TTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNP 100

Query: 67  QQLGQKPLSFIRKVLSILQYPDILED-ESKLQTLIELRVYQKDVVRRARKLLGEIGGSVG 125
           QQL QKPL+F R+VLS+LQ+P++LE+ +  LQTL     Y+ D ++RA++LL E+GGSVG
Sbjct: 101 QQLDQKPLTFYREVLSLLQHPELLEEADEALQTL-----YKTDSIKRAKRLLSEVGGSVG 155

Query: 126 AYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLI 185
           AYS SQGV GI++TVAD+ITKRD GE++YPEDI+LT GAS+AVS+IL + C GP TGVLI
Sbjct: 156 AYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLI 215

Query: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245
           PIPQYPLYTA++ L  +  + YYL EE NWS +  E+E  + ++I+ GIKPT +V+INPG
Sbjct: 216 PIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG 275

Query: 246 NPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFY 305
           NPTG+IL+E+ I  I  ++AKYG+++IADEVYQENVF G++F+S+KKVLR LQ+ Y G Y
Sbjct: 276 NPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQY 335

Query: 306 ETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMV 365
           + +QLASLHSTSKG+ GECGQRGGYMEL+G   D+R   +KL SIS+C VVTGQAL+D++
Sbjct: 336 DNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLM 395

Query: 366 VSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFP 425
           VSPP+PGDESYE DQ ER +I + L  R+ KL + F  LEG+EC +PQGAMYL+PK   P
Sbjct: 396 VSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLP 455

Query: 426 QKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLW 485
            K I  AQ L  E D  YCK LLE+TGICTVPGSGFGQ P TYHLRTTFL PG  W++ W
Sbjct: 456 YKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETW 515

Query: 486 RKFHTEFCERYR 497
            KFH  F ++YR
Sbjct: 516 EKFHKAFFDKYR 527

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/490 (61%), Positives = 385/490 (78%), Gaps = 2/490 (0%)

Query: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67
           DF P   +T++DLN  ++K +YAVRG IP RAEEL+ QL++DP SLPF+KI+NANIGNPQ
Sbjct: 71  DFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQ 130

Query: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127
           QL QKPLSF R+VLSILQYP++LE     + LI   V+++D + RA+++L ++GGSVGAY
Sbjct: 131 QLNQKPLSFYRQVLSILQYPEVLEQGE--EELISKGVFKRDAIERAKRILRDVGGSVGAY 188

Query: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187
           S SQGV GI++TVAD+IT+RDSGE AYPEDIFLT GAS+AVS++L + C G  TGVLIPI
Sbjct: 189 SSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPI 248

Query: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247
           PQYPLYTAT+ L  +  + YYL+EE  WS NT E+E  + ESI+SGI+P+ +V+INPGNP
Sbjct: 249 PQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNP 308

Query: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307
           TGS+L+ + I  I +++AKYG+++IADEVYQEN+F+G+EFHS+KKVLR+LQ+++ G Y+ 
Sbjct: 309 TGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDN 368

Query: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367
           VQL SLHSTSKG+ GECGQRGGYMEL G T ++R  V+KL SIS+C VVTGQAL+D++V 
Sbjct: 369 VQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVC 428

Query: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427
           PP+PGDESYE D+ ER  I  +L  R+  LH  F SLEG+EC +P+GAMYLFP+   P K
Sbjct: 429 PPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYK 488

Query: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487
            I  AQ L    D  YC++LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WI  W  
Sbjct: 489 AIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWED 548

Query: 488 FHTEFCERYR 497
           FH +F ++YR
Sbjct: 549 FHKKFYDQYR 558

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/498 (60%), Positives = 390/498 (78%), Gaps = 2/498 (0%)

Query: 1   MESEHFTDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIIN 60
           + S+    FTP A+V + DLN  ++K +YAVRG IP RAE+L+ QL++DP+SLPF+KIIN
Sbjct: 94  LHSKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIIN 153

Query: 61  ANIGNPQQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEI 120
           ANIGNPQQL QKPLSF R+VLS+LQ+P++L +  K        +Y+ D VRRA KLL +I
Sbjct: 154 ANIGNPQQLNQKPLSFYRQVLSLLQFPELL-NSLKENPAAATSLYKADAVRRAEKLLEDI 212

Query: 121 GGSVGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPT 180
           GGSVGAYS SQGV GI++TVAD+IT+RD+ E AYPEDIFLT GAS+AVS++L +FC G  
Sbjct: 213 GGSVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEK 272

Query: 181 TGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIV 240
           TGVLIPIPQYPLYTAT+ L  +  + YYL+E+  WS NT E+++ + ++I   IKP+ +V
Sbjct: 273 TGVLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLV 332

Query: 241 IINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGN-EFHSVKKVLRKLQR 299
           +INPGNPTG++L+EK IA I  I+AKYG+++IADEVYQEN+F  + +FHS+KKVLRKLQ+
Sbjct: 333 VINPGNPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQ 392

Query: 300 KYLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQ 359
           ++ G ++ VQLASLHSTSKG+ GECGQRGG+MEL G + ++R  ++KL SIS+C VVTGQ
Sbjct: 393 EHPGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQ 452

Query: 360 ALIDMVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLF 419
           AL+D++V PP+ G+ESYE+DQ ER++I ++L  R+ KL + F  LEG++C +PQGAMYLF
Sbjct: 453 ALVDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLF 512

Query: 420 PKFIFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGD 479
           P+   P K +  AQ +   AD  YCKELLE+TGICTVPGSGFGQ P TYHLRTTFL PG 
Sbjct: 513 PRLNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGT 572

Query: 480 SWIDLWRKFHTEFCERYR 497
            WIDLW KFH EF  +YR
Sbjct: 573 EWIDLWEKFHKEFYNKYR 590

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/490 (60%), Positives = 387/490 (78%), Gaps = 2/490 (0%)

Query: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67
           +F P  ++TL+D+N  ++K +YAVRG IP RAEELK QLEKDP+SLPF++IINANIGNPQ
Sbjct: 104 EFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQ 163

Query: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127
           QL QKPL++ R+VLS+LQYP++L      Q L++ ++++ D ++RA+ L+ +IGGSVGAY
Sbjct: 164 QLQQKPLTYYRQVLSLLQYPELLNQNE--QQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221

Query: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187
           S SQGV GI+++VA++ITKRD GE++YPEDIFLT GAS+AV+++L +FC GP TGVLIPI
Sbjct: 222 SSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281

Query: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247
           PQYPLYTAT+ L  + A+ YYL+E   WS N  E+E  ++E+I++ IKPT +V+INPGNP
Sbjct: 282 PQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341

Query: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307
           TG++L+ + IA I  ++AKYG ++IADEVYQEN+F G +FHS+KK+LR LQR++ G ++ 
Sbjct: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDN 401

Query: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367
           VQLASLHSTSKG+ GECGQRGGYMEL G + ++R  ++KL SIS+C VVTGQAL+D++V 
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427
           PP  G+ES+E DQ ERN+I   LI+R+  L++ F SLEG+EC +PQGAMYLFPK   P K
Sbjct: 462 PPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFK 521

Query: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487
            +  A+ L    D  YCK+LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WI  W  
Sbjct: 522 AVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWES 581

Query: 488 FHTEFCERYR 497
           FH EF ++YR
Sbjct: 582 FHKEFFDQYR 591

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/490 (60%), Positives = 387/490 (78%), Gaps = 2/490 (0%)

Query: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67
           DF P  ++TL+D+N  ++K +YAVRG IP RAEELK QLEKDP+SLPF+KIINANIGNPQ
Sbjct: 104 DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQ 163

Query: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127
           QL QKPL++ R+VLS+LQYP++L      Q L++ ++++ D ++RA+ L+ +IGGSVGAY
Sbjct: 164 QLQQKPLTYYRQVLSLLQYPELLNQNE--QQLVDSKLFKLDAIKRAKSLMEDIGGSVGAY 221

Query: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187
           S SQGV GI+++VA++ITKRD GE++YPEDIFLT GAS+AV+++L +FC GP TGVLIPI
Sbjct: 222 SSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281

Query: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247
           PQYPLYTAT+ L  + A+ YYL+E+  WS N  E+E  ++E+I++ IKPT +V+INPGNP
Sbjct: 282 PQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNP 341

Query: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307
           TG++L+ + ++ I  ++AKYG ++IADEVYQEN+F G +FHS+KK+LR LQR++ G ++ 
Sbjct: 342 TGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDN 401

Query: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367
           VQLASLHSTSKG+ GECGQRGGYMEL G + ++R  ++KL SIS+C VVTGQAL+D++V 
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427
           PP  G+ES+E+DQ ERN+I   LI+R+  L+  F SLEG+EC +PQGAMYLFPK   P K
Sbjct: 462 PPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFK 521

Query: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487
            +  A+ L    D  YCK LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WI  W  
Sbjct: 522 AVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581

Query: 488 FHTEFCERYR 497
           FH EF ++YR
Sbjct: 582 FHKEFFDQYR 591

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/490 (60%), Positives = 384/490 (78%), Gaps = 2/490 (0%)

Query: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67
           +F P  ++TL D+N  ++K +YAVRG IP RAEELK QLEKDP+SLPFNKIINANIGNPQ
Sbjct: 104 EFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQ 163

Query: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127
           QL QKPL++ R+VLS+LQYP++L      Q L++ ++++ D ++RA+ L+ EIGGSVGAY
Sbjct: 164 QLQQKPLTYYRQVLSLLQYPELLNQNE--QQLVDSKLFKLDAIKRAKSLMEEIGGSVGAY 221

Query: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187
           S SQGV GI+++VA++ITKRD GE++YPEDIFLT GAS+AV+++L +FC GP TGVLIPI
Sbjct: 222 SSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPI 281

Query: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247
           PQYPLYTAT+ L  + A+ YYL+E   WS N  E+E  ++E+I++ IK T +V+INPGNP
Sbjct: 282 PQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNP 341

Query: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307
           TG++L+ + IA I  ++AKYG ++IADEVYQEN+F G +FHS+KK+LR LQR++ G ++ 
Sbjct: 342 TGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDN 401

Query: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367
           VQLASLHSTSKG+ GECGQRGGYMEL G + ++R  ++KL SIS+C VVTGQAL+D++V 
Sbjct: 402 VQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVR 461

Query: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427
           PP  G+ES+E DQ ERN+I   LI+R+  L++ F SLEG+EC +PQGAMYLFPK   P +
Sbjct: 462 PPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFR 521

Query: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487
            +  A+ L    D  YCK+LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WI  W  
Sbjct: 522 AVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWET 581

Query: 488 FHTEFCERYR 497
           FH EF + YR
Sbjct: 582 FHKEFFDHYR 591

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/492 (60%), Positives = 386/492 (78%), Gaps = 4/492 (0%)

Query: 7   TDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNP 66
            +F P  ++TL +LN  ++K +YAVRG IP RAEELK+QL++DP SLPF+ I+NANIGNP
Sbjct: 79  NNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNP 138

Query: 67  QQLGQKPLSFIRKVLSILQYPDIL-EDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVG 125
           QQL QKPLSF R+VLS+LQYP+IL +DESKL   +   +++KD + RA+ LL EIGG+VG
Sbjct: 139 QQLNQKPLSFYRQVLSLLQYPEILKQDESKL---VASGLFKKDALERAKTLLHEIGGTVG 195

Query: 126 AYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLI 185
           AYS SQGV GI++TVA++ITKRD+GE AYPEDIFLT GAS+AV ++L + C GP TGVLI
Sbjct: 196 AYSASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLI 255

Query: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245
           PIPQYPLYTA++ L  + A+ YYL+E+  WS N  E+E  +  +    I+P+ +V+INPG
Sbjct: 256 PIPQYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPG 315

Query: 246 NPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFY 305
           NPTG++L+EK I +I  I+AKYG+++IADEVYQENVF+  +FHS+KKVLR LQ+K+ G Y
Sbjct: 316 NPTGAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVY 375

Query: 306 ETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMV 365
           + VQLASLHSTSKG+ GECGQRGGYMEL G T +VR  ++KL SIS+C VVTGQAL+D++
Sbjct: 376 DMVQLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLM 435

Query: 366 VSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFP 425
           VSPP+ GDES+E DQ ER +IK++L +R+ +L++ F +LEG+EC +PQGAMYLFP+   P
Sbjct: 436 VSPPKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLP 495

Query: 426 QKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLW 485
            K +  AQ L    D  YCK LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WI+ W
Sbjct: 496 FKAVQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKW 555

Query: 486 RKFHTEFCERYR 497
           + FH +F   YR
Sbjct: 556 KIFHQDFYNTYR 567

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/490 (60%), Positives = 379/490 (77%), Gaps = 2/490 (0%)

Query: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67
           DF P  ++TL DLN  ++K +YAVRG IP RAEELK+QLE +P +LPF++I+NANIGNPQ
Sbjct: 100 DFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQ 159

Query: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127
           QL QKPLSF R+VLSILQYPDIL++    Q LI+ +VY++D + RA+ LL EIGGSVGAY
Sbjct: 160 QLKQKPLSFYRQVLSILQYPDILKENE--QNLIDAKVYKRDAIDRAKLLLSEIGGSVGAY 217

Query: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187
           S SQGV GI++TVA++IT+RD GE AYPEDIFLT        ++L + C GP TGVLIPI
Sbjct: 218 SASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPI 277

Query: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247
           PQYPLYTAT+ L  + A+ YYL+E+  WS N  E+E  +Q++++  I P+ +V+INPGNP
Sbjct: 278 PQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNP 337

Query: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307
           TG++LTE+ I +I  I+AKYG+++IADEVYQEN+  G +F+S+KKVLRKLQ+ + G ++ 
Sbjct: 338 TGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDN 397

Query: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367
           VQLASLHSTSKG+ GECGQRGGYMELIG T +VR  ++KL SIS+C VVTGQAL+D++VS
Sbjct: 398 VQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVS 457

Query: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427
           PP+ GD SYE DQ ER +IK++L  R+ +L++ F+ LEG+EC +PQGAMYLFPK   P K
Sbjct: 458 PPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFK 517

Query: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487
            +  AQ L    D  YCK LL+ TGICTVPGSGFGQ+P TYHLRTTFL PG  WI  W  
Sbjct: 518 AVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEA 577

Query: 488 FHTEFCERYR 497
           FH EF + YR
Sbjct: 578 FHKEFYDNYR 587

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/491 (60%), Positives = 380/491 (77%), Gaps = 2/491 (0%)

Query: 7   TDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNP 66
            +F P  ++TL D+N  ++K +YAVRG IP RAEELK QLEKDP+SLPFNKIINANIGNP
Sbjct: 103 NEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNP 162

Query: 67  QQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGA 126
           QQL QKPL++ R+VLS+LQYP++L      Q L+  ++++ D ++RA+ L+ +IGGSVGA
Sbjct: 163 QQLQQKPLTYYRQVLSLLQYPELLNHNE--QELVGSKLFKIDAIKRAKSLIKDIGGSVGA 220

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIP 186
           YS SQGV GI+++VAD+ITKRD GE AYPEDIFLT GAS+AV+++L +FC GP TGVLIP
Sbjct: 221 YSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIP 280

Query: 187 IPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGN 246
           IPQYPLYTAT+ L  +  + YYL+E   WS N  E+E  ++E+I++ IKPT +V+INPGN
Sbjct: 281 IPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340

Query: 247 PTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYE 306
           PTG++L+ + IA I  ++AKYG ++IADEVYQEN+F G EF+S+KKVLR LQR + G ++
Sbjct: 341 PTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFD 400

Query: 307 TVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVV 366
            VQLASLHSTSKG+ GECGQRGGYMEL G + ++R  ++KL SIS+C VVTGQAL+D++V
Sbjct: 401 NVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMV 460

Query: 367 SPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQ 426
            PP  G+ES+E DQ ERN+I   L +R+  L++ F SLEG+EC +PQGAMYLFPK   P 
Sbjct: 461 RPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPF 520

Query: 427 KFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWR 486
           K I  A  L    D  YCK+LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  W+  W 
Sbjct: 521 KAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWE 580

Query: 487 KFHTEFCERYR 497
            FH EF ++YR
Sbjct: 581 IFHKEFFDQYR 591

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/487 (59%), Positives = 373/487 (76%), Gaps = 2/487 (0%)

Query: 11  PVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQLG 70
           P  K+ L ++N  ++K +YAVRG IP  A EL  +L+KDP SLPF+ I++ANIGNPQ L 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 71  QKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYSLS 130
           QKPL+F R+VLS+LQYP +LE+    Q LI+ ++YQKD + RAR+LL +IG SVGAYS S
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEENE--QVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTS 166

Query: 131 QGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQY 190
           QG+ GI++TVA +IT+RD GE AY EDIFLT GASSAVS++L + C G  TGVLIPIPQY
Sbjct: 167 QGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQY 226

Query: 191 PLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGS 250
           PLYTA++ L  +  + YYL+E+  WS N  E+E+ +  +I+  IKP+ +V+INPGNPTG+
Sbjct: 227 PLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGA 286

Query: 251 ILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQL 310
           +L+E+DI+ I  I+AKYG+++IADEVYQENVF G EFHS+KK+LRKLQ+   G ++ VQL
Sbjct: 287 VLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQL 346

Query: 311 ASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSPPR 370
           ASLHSTSKG+ GECGQRGGYME+ G  +D+R  ++KL SIS+C VVTGQAL+D++VSPP+
Sbjct: 347 ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406

Query: 371 PGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQKFID 430
           PGDESYE+DQ ER +I   L  R+ KLH  F SLEG+EC +P+GAMYLFP+ + P K I 
Sbjct: 407 PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466

Query: 431 IAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRKFHT 490
            A+      D  YCK+LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WI+ W  FH 
Sbjct: 467 SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526

Query: 491 EFCERYR 497
            F E YR
Sbjct: 527 AFYEEYR 533

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/491 (60%), Positives = 378/491 (76%), Gaps = 4/491 (0%)

Query: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67
           DF P AK+T KDLN  + K +YAVRG IP RA+ELK +L+K+P  LPF+ IINANIGNPQ
Sbjct: 19  DFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQ 78

Query: 68  QLGQKPLSFIRKVLSILQYPDILE-DESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGA 126
           QL QKPL+F R+VLSIL+YP+IL+ D  KL +L    ++ KD ++RA  LL +IGGSVGA
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILQVDHEKLASL---NLFSKDALKRAECLLKDIGGSVGA 135

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIP 186
           YS SQGVPGI+QTVAD+IT RD GE A PEDI+LTTGASSA + +L + C    TG+LIP
Sbjct: 136 YSHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIP 195

Query: 187 IPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGN 246
           IPQYPLYTA+ +L  A  + YYL+EE NWS  + E+E  +Q++++ GI+P+ +++INPGN
Sbjct: 196 IPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGN 255

Query: 247 PTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYE 306
           PTG++LTE+ IA I  I+AKYG+ +I+DEVYQENVF+  +FHS+KKVLRKLQ  Y G ++
Sbjct: 256 PTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFD 315

Query: 307 TVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVV 366
            VQLASLHS SKG +GECGQRGGYME++G + D+R  + KLMSISICSVVTGQA++D++V
Sbjct: 316 NVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMV 375

Query: 367 SPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQ 426
           +PP+PGDESYE D+ ER+ I N++ +R+  L++ F  LEG+EC  PQGAMYLFP+ I P 
Sbjct: 376 NPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPD 435

Query: 427 KFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWR 486
           K    +++L  E D  YC  LLE TGICTVPGSGFGQKP TYH+RTTFL PG  WI  W+
Sbjct: 436 KAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWK 495

Query: 487 KFHTEFCERYR 497
            FH  F   YR
Sbjct: 496 NFHQSFFNEYR 506

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/491 (59%), Positives = 381/491 (77%), Gaps = 4/491 (0%)

Query: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67
           DF P AK+T KDLN+ + K +YAVRG IP RAEELK +L++   SLPFN IINANIGNPQ
Sbjct: 19  DFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQ 78

Query: 68  QLGQKPLSFIRKVLSILQYPDILE-DESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGA 126
           QL QKPL+F R+VLSIL+YP+IL  D  KL +L    ++ KD ++RA++LL +IGGSVGA
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILRVDHDKLASL---NLFAKDALKRAQRLLDDIGGSVGA 135

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIP 186
           YS SQGVPGI+QTVAD+IT+RD GE A PEDI+LTTGASSA + +L + C    TG+L+P
Sbjct: 136 YSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLLP 195

Query: 187 IPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGN 246
           IPQYPLYTA+ +L  A  + YYL+EE +WS  + E+E  + +++K GI+P+ +V+INPGN
Sbjct: 196 IPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGN 255

Query: 247 PTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYE 306
           PTG++LTE  IA I  I+AKYG+ II+DEVYQEN+F   +FHS+KK+LRKLQ  + G ++
Sbjct: 256 PTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFD 315

Query: 307 TVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVV 366
            VQLASLHS SKG +GECGQRGGYME++G + D+R  + KLMSISICSV TGQA+ID++V
Sbjct: 316 NVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMV 375

Query: 367 SPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQ 426
            PP+PGDESY+ D+ ER  I N++++R+  L++ F  LEG++C +PQGAMYLFPK   P+
Sbjct: 376 KPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPE 435

Query: 427 KFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWR 486
           K +  +++L+ E D LYC  LLE TGICTVPGSGFGQK  TYH+RTTFL PG  WI  WR
Sbjct: 436 KALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWR 495

Query: 487 KFHTEFCERYR 497
           +FH +F  +YR
Sbjct: 496 QFHQDFFNKYR 506

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/490 (59%), Positives = 378/490 (77%), Gaps = 2/490 (0%)

Query: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67
           DF P  K+++KDLN  +IK ++AVRG IP +A+EL+ QL K+P SLPFN+I  ANIGNPQ
Sbjct: 12  DFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQ 71

Query: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127
           +L QKPL+F R+V+SILQYP++L   ++L T     +Y  D   RA KLL EIGGSVGAY
Sbjct: 72  ELHQKPLTFARQVVSILQYPELLNRRNEL-TSTTPPIYNNDSFDRAEKLLNEIGGSVGAY 130

Query: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187
           S SQGV GI++T+A+YIT+RD GE A P DIF+TTGA++A S++L +  NGP TGVL+PI
Sbjct: 131 SASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190

Query: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQE-SIKSGIKPTTIVIINPGN 246
           PQYPLYTA + L  AT + YYL EE  WS++T E+E TI++ ++  GI+P  +VIINPGN
Sbjct: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250

Query: 247 PTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYE 306
           PTGSIL+E  +  I  I+AKYG++IIADEVYQEN+F+GN+FHS KKVLR LQ+++   Y 
Sbjct: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310

Query: 307 TVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVV 366
            VQLASLHSTSKGL GECGQRGGYME+IG  +DVR  ++KL  I +C VVTGQA++D+++
Sbjct: 311 NVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI 370

Query: 367 SPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQ 426
            PP+ GD+SY++D +ER  I ND+++R++KL+ +F  +EG++C +PQGAMYLFP+ +   
Sbjct: 371 LPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLST 430

Query: 427 KFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWR 486
           K ID A+K   E D  YC ELL  TGICTVPGSGFGQKPNTYHLRTTFL PGD WI+ W 
Sbjct: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWE 490

Query: 487 KFHTEFCERY 496
           KFH  F +RY
Sbjct: 491 KFHKAFLKRY 500

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/489 (60%), Positives = 373/489 (76%), Gaps = 3/489 (0%)

Query: 9   FTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQ 68
           F P  K++L+DLN  +++ +YAVRG IP +AEELK QL +DPKSLPF++IINANIGNPQQ
Sbjct: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 69  LGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYS 128
           L QKPL+F R+VLS+LQ PD+LE+  + Q     ++Y+ D + RA +LL  IGGSVGAYS
Sbjct: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLS---QIYKPDAIDRAARLLSNIGGSVGAYS 161

Query: 129 LSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIP 188
            SQGV G ++TVAD+ITKRD GE AY EDIFLT GAS+AVS+IL + C GP TGVLIPIP
Sbjct: 162 HSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIP 221

Query: 189 QYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPT 248
           QYPLYTA++ L  + A+ YYL+EE NWS N  E+E  +  SI  G++P  +V+INPGNPT
Sbjct: 222 QYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPT 281

Query: 249 GSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETV 308
           G+IL+ + I  I  ++AKYG+++IADEVYQENVF+G EFHS++KVL+ LQRK+ G ++ +
Sbjct: 282 GAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNI 341

Query: 309 QLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSP 368
           QLASLHSTSKG+ GECGQRGGYMEL+G + DVR   +KL SIS+C VVTGQAL+D++V P
Sbjct: 342 QLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCP 401

Query: 369 PRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQKF 428
           P+PGD SYE DQ ER+ I + L +R+  L++ F  LEG+EC +PQGAMYLFP+     K 
Sbjct: 402 PKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKA 461

Query: 429 IDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRKF 488
           +  A+ L    D  YC+ELLE TGICTVPGSGFGQ P TYHLRTTFL PG  WI  W +F
Sbjct: 462 VQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEF 521

Query: 489 HTEFCERYR 497
           H +F   YR
Sbjct: 522 HKKFYNEYR 530

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/491 (58%), Positives = 379/491 (77%), Gaps = 2/491 (0%)

Query: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67
           DF P  K+T KDLN+ + K +YAVRG IP RA+ELK +L+K+P+ LPF+ IINANIGNPQ
Sbjct: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78

Query: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127
           QL QKPL+F R+VL+IL+YP+IL        L  L ++ +D + RA +LL +IGGS+GAY
Sbjct: 79  QLDQKPLTFTRQVLAILEYPEILR--VGHNELASLNLFSRDALERAERLLNDIGGSIGAY 136

Query: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187
           S SQGVPGI+QTVAD+IT+RD GE A PEDI+LTTGASSA + +L + C    TG+LIPI
Sbjct: 137 SHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPI 196

Query: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247
           PQYPLYTA+ +L  A  + YYL+EE NWS N+ E+E  +Q+++K  I+P+ +++INPGNP
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNP 256

Query: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307
           TG++L+E+ IA I  I+AKYG+ II+DEVYQEN+F+  +FHS+KKVLRKLQ  Y G ++ 
Sbjct: 257 TGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDN 316

Query: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367
           VQLASLHS SKG + ECGQRGGYME+IG + ++R  + KLMSISICSVVTGQA++D++V 
Sbjct: 317 VQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVK 376

Query: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427
           PP+PGDESYE D  ER  I +++ +R+  L++ F  LEG+EC +PQGAMYLFP+ + P+K
Sbjct: 377 PPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKK 436

Query: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487
            +  +++L  E D  YC  LLE TGICTVPGSGFGQ+P TYH+RTTFL PG  WI  W++
Sbjct: 437 ALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKE 496

Query: 488 FHTEFCERYRS 498
           FH +F  +YR+
Sbjct: 497 FHQDFFSKYRN 507

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/490 (58%), Positives = 377/490 (76%), Gaps = 2/490 (0%)

Query: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67
           +F P AK+T KDLN+ + K +YAVRG IP RA+ELK +L++ P  LPF+ IINANIGNPQ
Sbjct: 19  NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQ 78

Query: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127
           QL QKPL+F R+VLSIL+YP+IL        L  L +++KD + RA  LL +IGGS+GAY
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILR--VGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAY 136

Query: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187
           S SQGVPGI+Q+VA++ITKRD GE A PE+I+LTTGASSA + +L + C    TG+LIPI
Sbjct: 137 SHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIPI 196

Query: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247
           PQYPLYTA+ +L  A  + YYL+E  NWS  + E+E  ++++++ GIKP+ +++INPGNP
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNP 256

Query: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307
           TG++L+E  IA I  I+AKYG+ II+DEVYQENVF+G +FHS+KKVLRKLQR Y G ++ 
Sbjct: 257 TGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDN 316

Query: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367
           VQLASLHS SKG +GECGQRGGYME++G + D+R  + KLMSISICSVVTGQA++D++V 
Sbjct: 317 VQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVK 376

Query: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427
           PP+PGDESY+ D  ER  I +++ +R+  LH+ F  LEG+EC +PQGAMYLFP+ + P+K
Sbjct: 377 PPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEK 436

Query: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487
            +  +++L  E D  YC  LLE TGICTVPGSGFGQ+P TYH+RTTFL PG  WI  W+ 
Sbjct: 437 ALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKH 496

Query: 488 FHTEFCERYR 497
           FH +F  +YR
Sbjct: 497 FHQDFFNKYR 506

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/491 (60%), Positives = 373/491 (75%), Gaps = 6/491 (1%)

Query: 9   FTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQ 68
           F P  + TLKD+N  ++  +YAVRG IP RAEELK QL ++P SLPFN IINANIGNPQQ
Sbjct: 89  FLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQ 148

Query: 69  LGQKPLSFIRKVLSILQYPDILED-ESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127
           L QKPLSF R+VLS+LQYP+++   E+  QT+I     ++D + RA++LL +IGGSVGAY
Sbjct: 149 LKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI-----KQDAIDRAKRLLDDIGGSVGAY 203

Query: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187
           S SQGV GI++TVAD+IT RD G +AYPEDIFLT GASSAV ++L +FC G  TGVLIPI
Sbjct: 204 SSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPI 263

Query: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247
           PQYPLYTAT+ L  + A+ YYLNEE  WS +  E+E+ I +SI++ IKP+ +V+INPGNP
Sbjct: 264 PQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINPGNP 323

Query: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307
           TG++L+E+ I  I  ++AKYG+++IADEVYQENVF   +FHS+KKVLR+LQ K  G Y+ 
Sbjct: 324 TGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDN 383

Query: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367
           VQLASLHSTSKG+ GECGQRGGYMEL+G T D+R  V+KL SIS+C VVTGQAL+D++V 
Sbjct: 384 VQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVC 443

Query: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427
           PP+ G+ESYE DQ ER NI  +L  R+  LH  F+ L+G+ C +PQGAMYLFPK   P K
Sbjct: 444 PPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYK 503

Query: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487
            I  A       D  YCK LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WI+ W  
Sbjct: 504 AIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVD 563

Query: 488 FHTEFCERYRS 498
           FH EF  ++++
Sbjct: 564 FHQEFYNKFKN 574

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/499 (58%), Positives = 372/499 (74%), Gaps = 6/499 (1%)

Query: 1   MESEHFTDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQL--EKDPKSLPFNKI 58
           ++ +   +F P  K+TL DLN  ++K++YAVRG IP RAEEL+ +L       SL F  I
Sbjct: 20  LDDDTIHNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENI 79

Query: 59  INANIGNPQQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLG 118
           ++ANIGNPQQL QKPL+F R+V+SILQYP++L   ++   L+   +++ D + RA  LL 
Sbjct: 80  VHANIGNPQQLDQKPLTFSRQVISILQYPELL---NQRNILVSTGIFKSDAMERAETLLC 136

Query: 119 EIGGSVGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNG 178
            IGGSVGAYS SQGV GI++TVA+YIT RD+GE A P+DIFLT GAS A S++L + C  
Sbjct: 137 HIGGSVGAYSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKD 196

Query: 179 PTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTT 238
             TGVLIPIPQYPLYTATITL  A  + YYLNEE  WS NT E+E  + ++I   +KP+ 
Sbjct: 197 KNTGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSV 256

Query: 239 IVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQ 298
           +V+INPGNPTGS+L++ DI +II I AKYG+++IADEVYQEN+F G EFHS+KKVLR LQ
Sbjct: 257 MVVINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQ 315

Query: 299 RKYLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTG 358
           ++Y G Y+ VQLASLHSTSKG+ GECGQRGGYMEL+G  D++R  ++KL SIS+CSV+TG
Sbjct: 316 KQYPGKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITG 375

Query: 359 QALIDMVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYL 418
           QAL+D++V+PP+ GDESYE+D  ER NI   L  R++KL+ LF  L+GVEC +PQGAMYL
Sbjct: 376 QALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYL 435

Query: 419 FPKFIFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPG 478
           FPK  FPQ  I  A   +   D  YC  LLE TGICTVPGSGFGQK  TYHLRTTFL PG
Sbjct: 436 FPKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPG 495

Query: 479 DSWIDLWRKFHTEFCERYR 497
           + W + W+ FH EF  +Y+
Sbjct: 496 NQWTEKWKLFHEEFFSKYQ 514

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/491 (57%), Positives = 377/491 (76%), Gaps = 3/491 (0%)

Query: 7   TDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNP 66
            DF P  K++LKD+N  ++  ++A+RG I  +AE+L++QL K+P  LPF++I  ANIGNP
Sbjct: 9   NDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNP 68

Query: 67  QQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGA 126
           Q+L QKPL+F R+V+SILQYP++L +      L + +++  D   RA +LL +IGGSVGA
Sbjct: 69  QELNQKPLTFARQVVSILQYPELLNNRD---VLTKEKIFNSDSFDRAERLLRDIGGSVGA 125

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIP 186
           YS SQGV GI++T A+YITKRD GE +YPEDIFLTTGA+SA S++L + C GP TGVLIP
Sbjct: 126 YSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIP 185

Query: 187 IPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGN 246
           IPQYPLYTAT+ L  +T I YYL+EE  WS NT E+E  + +SIK GIKP+ IV+INPGN
Sbjct: 186 IPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGN 245

Query: 247 PTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYE 306
           PTG++L+E  IA I +I+AKYG++++ADEVYQEN+F G +FHS KKVLR LQ++Y G ++
Sbjct: 246 PTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFD 305

Query: 307 TVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVV 366
            +QLAS+HSTSKG+ GECGQRGGYMEL+G TD+VR  ++KL  +++CSVVTGQA++D+++
Sbjct: 306 NIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLML 365

Query: 367 SPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQ 426
            PP+ GD SYE+D+ ER  I + +  R++KL+ +F  L+G+EC +PQGAMYL+P  I  +
Sbjct: 366 LPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSK 425

Query: 427 KFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWR 486
           K I  A+ L+   D  YC ELL+ TGICTVPGSGFGQK  TYHLRTTFL PG  WI+ W 
Sbjct: 426 KAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWE 485

Query: 487 KFHTEFCERYR 497
           KFH  F E+Y+
Sbjct: 486 KFHKHFYEKYQ 496

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/494 (60%), Positives = 372/494 (75%), Gaps = 10/494 (2%)

Query: 4   EHFTDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANI 63
           EH  +  P  K+ + DLN  ++K +YAVRG IP RAEELKL LE   K LPF+ +INANI
Sbjct: 28  EHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAGQK-LPFDTVINANI 86

Query: 64  GNPQQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGS 123
           GNPQQL QKPL+F R+VLSILQYP++LE  S         +++KD + RARKLL EIG S
Sbjct: 87  GNPQQLKQKPLTFYRQVLSILQYPELLESGSN--------IFKKDAIERARKLLKEIG-S 137

Query: 124 VGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGV 183
           VG+YS SQG+P I++TVA++ITKRD GE++ P DIFLT GASSAV ++L + C    +GV
Sbjct: 138 VGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGV 197

Query: 184 LIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIIN 243
           LIPIPQYPLYTAT+ L  A A+ YYL+E   WS +  E+E  I +S+  GIKPT +VIIN
Sbjct: 198 LIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIIN 257

Query: 244 PGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLG 303
           PGNPTGSIL+ + +  II ++A +G++IIADEVYQENVF+  +FHS+KKVLR LQ+ + G
Sbjct: 258 PGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPG 317

Query: 304 FYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALID 363
            Y+TVQLASLHSTSKG+ GECGQRGGYMEL G   +++  ++KL SIS+C VVTGQAL+D
Sbjct: 318 EYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVD 377

Query: 364 MVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFI 423
           ++VSPP+ GDESYE DQLER+ I NDL +R+  L + F S+EGV C +P+GAMYLFPK  
Sbjct: 378 LMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKID 437

Query: 424 FPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWID 483
            P K +  +Q+L    D  YCK LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WID
Sbjct: 438 LPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWID 497

Query: 484 LWRKFHTEFCERYR 497
            W KFH EF ++YR
Sbjct: 498 RWNKFHAEFYDKYR 511

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/496 (59%), Positives = 387/496 (78%), Gaps = 4/496 (0%)

Query: 4   EHFTDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANI 63
           +H  +F P  ++T+ DLN  ++K +YAVRG IP RAEELK QL + P SLPF+KIINANI
Sbjct: 47  KHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANI 106

Query: 64  GNPQQLGQKPLSFIRKVLSILQYPDILED-ESKLQTLIELRVYQKDVVRRARKLLGEIGG 122
           GNPQQL Q+PLSF R+VLS+LQYP +L   E+K  +     VY+KD + RA+K+L +IGG
Sbjct: 107 GNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSA---VYKKDAILRAKKILKDIGG 163

Query: 123 SVGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTG 182
           SVGAYS SQGV GI++TVA++IT+RD GE AYPEDIFLT GAS+AV+++L + C G  TG
Sbjct: 164 SVGAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTG 223

Query: 183 VLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVII 242
           VLIPIPQYPLYTAT+ L  + A+ Y+L+E + WS+N +E+EN I+++++  IKP  +V+I
Sbjct: 224 VLIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVI 283

Query: 243 NPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYL 302
           NPGNPTG++L+++ I +I+ I+AKYG+++IADEVYQEN+F G +FHSVK VLR+LQR+  
Sbjct: 284 NPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIP 343

Query: 303 GFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALI 362
           G ++ VQLASLHSTSKG+ GECGQRGGYME+IG T +VR  ++KL SIS+C VVTGQAL+
Sbjct: 344 GKFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALV 403

Query: 363 DMVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKF 422
           D++VSPP+ G+ES+ +DQ +R  I + L  R++ L + F SL+G+EC +P GAMYLFPK 
Sbjct: 404 DLMVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKL 463

Query: 423 IFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWI 482
             P + I  AQ+L    D  YCKELLEHTGICTVPGSGFGQ   TYHLRTTFL PG  WI
Sbjct: 464 NLPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWI 523

Query: 483 DLWRKFHTEFCERYRS 498
           D W++FH EF E+Y S
Sbjct: 524 DSWKQFHIEFMEKYNS 539

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/480 (59%), Positives = 366/480 (76%), Gaps = 4/480 (0%)

Query: 18  KDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQLGQKPLSFI 77
           +DLN  ++K +YAVRG IP+ A++LK+QL K P +LPF  +IN+NIGNPQQLGQKPLSF 
Sbjct: 87  EDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQKPLSFG 146

Query: 78  RKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYSLSQGVPGIQ 137
           R+VLSIL+YP +L+ E   +TL++   Y  D + RA+ LL +IG S+GAYS SQGV GI+
Sbjct: 147 RQVLSILEYPALLDHE---RTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGVHGIR 202

Query: 138 QTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATI 197
           QTVAD+IT RD GEVAYP+DIFLT GASSAVS IL + C G  TGVLIPIPQYPLYTAT+
Sbjct: 203 QTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPLYTATL 262

Query: 198 TLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDI 257
           TL  ATA+ YYL+E + WS +  E+    Q+S+++GIKPT +V+INPGNPTGS+LT + I
Sbjct: 263 TLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAI 322

Query: 258 ANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLASLHSTS 317
            N+  ++AKYGL++IADEVYQ+N+F G+EFHS+KK+LR LQ++    Y+ +QLASLHS S
Sbjct: 323 KNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLHSCS 382

Query: 318 KGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSPPRPGDESYE 377
           KGL+GECG RGGY E IG T +V+  + KL SIS+CS V GQAL+D++  PP+ G+ SYE
Sbjct: 383 KGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEPSYE 442

Query: 378 MDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQKFIDIAQKLHT 437
           +DQ ER  I+ +   RS KL+++F SLEGV C +PQGAMY+FP    P   I +AQ L  
Sbjct: 443 LDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQNLDI 502

Query: 438 EADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRKFHTEFCERYR 497
             D  YC+ELL+ TGICTVPGSGFGQ+P TYH+RTTFL PG  W+  W KFH EF E+YR
Sbjct: 503 TPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFFEKYR 562

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/492 (57%), Positives = 374/492 (76%), Gaps = 6/492 (1%)

Query: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQL--EKDPKSLPFNKIINANIGN 65
           DF P  K+++ DLN KII  +YAVRG I  RAEEL+ +L  +  P S PF +II ANIGN
Sbjct: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82

Query: 66  PQQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVG 125
           PQQL QKPL+F R+V+SIL+YP +L+ +     L+   +Y+KD + RA  L  +IG SVG
Sbjct: 83  PQQLDQKPLTFSRQVMSILEYPGLLKFKD---VLLSQGIYKKDALERAELLQSQIGASVG 139

Query: 126 AYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLI 185
           AYSL+QGV GI++T A +I+KRD+ E A  +DIFLT GAS AV++++   C    TG+LI
Sbjct: 140 AYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILI 199

Query: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245
           PIPQYPLYTA+I +  A  + YYL+EE  WS    E+EN++  +I++GIKP+ +V+INPG
Sbjct: 200 PIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPG 259

Query: 246 NPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFY 305
           NPTG++L+   I  II ++AKYG+++IADEVYQ+N+F+G EFHS+KK+LR+LQ+KY G Y
Sbjct: 260 NPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKY 318

Query: 306 ETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMV 365
           + VQLASLHSTSKG+ GECGQRGGYME++G +D+VR  ++KL SI+ICSVVTGQAL+D++
Sbjct: 319 DNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLM 378

Query: 366 VSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFP 425
           V PP  GDESYE DQ ERN I + L  R+ KL+  F +LEG+EC +PQGAMYLFP+ I P
Sbjct: 379 VDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILP 438

Query: 426 QKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLW 485
            + I+ A+KL  EAD  YC +LLE+TGICTVPGSGFGQ+  TYH+RTTFL PG  WID W
Sbjct: 439 DRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDW 498

Query: 486 RKFHTEFCERYR 497
           +KFH +F + Y+
Sbjct: 499 KKFHEKFMKEYQ 510

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/490 (58%), Positives = 370/490 (75%), Gaps = 3/490 (0%)

Query: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67
           +F P  K+T+ DLN  ++K +YAVRG IPARAE LK QL  +P SLPF K+INANIGNPQ
Sbjct: 35  NFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQ 94

Query: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127
           QL QKPL+F R+VLS+LQYP +L++     T     +Y++D + RA+++L +IG SVG+Y
Sbjct: 95  QLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKT---LYKQDAIERAKRILNDIGSSVGSY 151

Query: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187
           S SQGV G+++TVA+YI++RD GE AY EDIFLT GASSAVS++L + C G  +GVLIPI
Sbjct: 152 SSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPI 211

Query: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247
           PQYPLYTAT+ L    A+ YYL E   WS N  E+EN +  +I+  I P  +V+INPGNP
Sbjct: 212 PQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNP 271

Query: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307
           TG+IL+ + I  I  ++A +G+++IADEVYQEN+F GNEFHS+KKVLR LQR+  G YE 
Sbjct: 272 TGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYEN 331

Query: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367
           VQLASLHSTSKG+ GECGQRGGYMEL G + +++ E++KL SIS+C VVTGQAL+D++  
Sbjct: 332 VQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTC 391

Query: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427
           PP+ G+ SYE DQ+ER+ I ++L  R+  L + F  +EGV C +PQG+MYLFPK   P K
Sbjct: 392 PPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHK 451

Query: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487
            ++ AQ+L    D LYC ELLE TGICTVPGSGFGQKP T+HLRTTFL PG SWID WR+
Sbjct: 452 ALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWRE 511

Query: 488 FHTEFCERYR 497
           FH  FC +YR
Sbjct: 512 FHQIFCNKYR 521

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/485 (59%), Positives = 367/485 (75%), Gaps = 4/485 (0%)

Query: 13  AKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQLGQK 72
           +K TL+D+N  ++  +YAVRG IP RAEELK +L ++P SLPF+KIINANIGNPQQL QK
Sbjct: 37  SKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQK 96

Query: 73  PLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYSLSQG 132
           PL+F R+VL++LQ PD++ D S  +     + ++ D V RA+K+L ++GGSVGAYS SQG
Sbjct: 97  PLTFYRQVLALLQNPDLISDLSSGELH---KFFKPDAVERAKKMLKQVGGSVGAYSNSQG 153

Query: 133 VPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPL 192
           V G +++VA++I +RD GE A  +DIFLTTGAS AVS+IL +FCNGP  G LIPIPQYPL
Sbjct: 154 VAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPL 212

Query: 193 YTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSIL 252
           YTA++ L  + A+ YYL+EE  WS++T ++E  +Q+SIK GI+PT +V+INPGNPTG++L
Sbjct: 213 YTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALL 272

Query: 253 TEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLAS 312
               I N+I+++AKY ++IIADEVYQEN F+  EF S+KKVLR LQ+   G Y+ VQLAS
Sbjct: 273 NTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLAS 332

Query: 313 LHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSPPRPG 372
           LHSTSKG+ GECGQRGGYMEL+G +++V+   +KL SIS+C VVTGQALID++V PP+ G
Sbjct: 333 LHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKG 392

Query: 373 DESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQKFIDIA 432
           D SYE D+ ER +I + L  RS  L+Q F S+EGV C  PQGAMYLFPK     K I  A
Sbjct: 393 DASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKA 452

Query: 433 QKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRKFHTEF 492
           +      D  YCKELLE TGICTVPGSGFGQ P T+HLRTTFL PG  WID W+KFH +F
Sbjct: 453 ESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKF 512

Query: 493 CERYR 497
            E +R
Sbjct: 513 TEDHR 517

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/489 (57%), Positives = 366/489 (74%), Gaps = 5/489 (1%)

Query: 9   FTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQ 68
           F P   + L+DLNS +++ +YAVRG IPARA EL+ QL +DP SLPF KII ANIGNPQQ
Sbjct: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQ 109

Query: 69  LGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYS 128
           LGQKPLSF R+VLS+L+ P++L+   ++  LI    Y+ D VRRA++++ ++  S+GAYS
Sbjct: 110 LGQKPLSFSREVLSLLESPNLLQMPMEVLNLI----YKPDAVRRAKRMMRDLQTSIGAYS 165

Query: 129 LSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIP 188
            SQGV G ++TVA+Y++ RD GE A  EDIFLTTGAS+  S ++ + C G  +GVLIPIP
Sbjct: 166 HSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIP 224

Query: 189 QYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPT 248
           QYPLYTATITL    A+ YYL+EE  WS+N  ++E  I ESI+ G+KP  +V+INPGNPT
Sbjct: 225 QYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPT 284

Query: 249 GSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETV 308
           G+IL  + +  I  I+AKY +++IADEVYQENVF G +F+S+KKVLR LQR+Y   +  V
Sbjct: 285 GAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNV 344

Query: 309 QLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSP 368
           QL SLHSTSKGL GECGQRGGYMEL+G +DD+R  ++K+ SI +CS V GQAL+D+++S 
Sbjct: 345 QLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSR 404

Query: 369 PRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQKF 428
           P+PGDESYE D  ER++I+N L  RS+ L + F +LEGVEC +PQG+MYLFP+ + PQK 
Sbjct: 405 PKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKA 464

Query: 429 IDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRKF 488
           I  A+ L  + D  YC ELL  TGICTVPGSGFGQ P+T HLRTTFL PG  WI+ W  F
Sbjct: 465 IKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELF 524

Query: 489 HTEFCERYR 497
           H  F ++YR
Sbjct: 525 HKSFYDKYR 533

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/490 (56%), Positives = 363/490 (74%), Gaps = 4/490 (0%)

Query: 9   FTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQ 68
           F P  K+   DLN  II  +YAVRG IP +AEEL++QL + P  LPFN I  ANIGNPQQ
Sbjct: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93

Query: 69  LGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYS 128
           L QKPL+F R+V+SILQYP +L+ E +L T      Y++D  +RA  LL +IGGSVGAYS
Sbjct: 94  LDQKPLTFSRQVVSILQYPPLLDYEEQLVTS---GAYKRDAFKRAAVLLEQIGGSVGAYS 150

Query: 129 LSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIP 188
           L+QGV GI+++VAD+IT+RD GE A P+DIFLT GAS A +++L + C   +TG++IPIP
Sbjct: 151 LAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIP 210

Query: 189 QYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPT 248
           QYPLYTA+IT+  +  + YYL+EE  WS    E+E  + +SIK G+ P  IV+INPGNPT
Sbjct: 211 QYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPT 270

Query: 249 GSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKY-LGFYET 307
           G++L+   IA I+ I+AKYG++++ADEVYQ N++ G +FHS+KKVLR LQR +  G Y+ 
Sbjct: 271 GAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDN 330

Query: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367
           VQLAS+HSTSKG+ GECGQRGGYMEL+G +++VR  ++KL SISICSVVTGQAL+D++++
Sbjct: 331 VQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLN 390

Query: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427
           PPR GD+SYE+D  ER  I N++ +R   L+  F  LEG+EC  PQGAMYLFPK +  +K
Sbjct: 391 PPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKK 450

Query: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487
            I+ A+ L  + D  YC  LL+ TGICTVPGSGFGQK  TYH+RTTFL PG  WI  W  
Sbjct: 451 AIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWET 510

Query: 488 FHTEFCERYR 497
           FH  F ++YR
Sbjct: 511 FHKAFYDKYR 520

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/485 (58%), Positives = 365/485 (75%), Gaps = 4/485 (0%)

Query: 13  AKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQLGQK 72
           +K TL+D+N  ++  +YAVRGPIP RAEEL+ +L ++P SLPFNKIINANIGNPQQL QK
Sbjct: 38  SKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQK 97

Query: 73  PLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYSLSQG 132
           PL+F R+VLS+LQ P ++E    L T    ++++ D V RA+K+L ++GGSVGAYS SQG
Sbjct: 98  PLTFYRQVLSLLQNPALIES---LPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQG 154

Query: 133 VPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPL 192
           V G +Q+VA++I +RD GE A   DIFLT GASSAVS IL MFC G   G LIPIPQYPL
Sbjct: 155 VAGFRQSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPL 213

Query: 193 YTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSIL 252
           YTAT+ L  A A+ YYL+E   WS++T ++E  ++++I+ G++PT +V+INPGNPTG+IL
Sbjct: 214 YTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAIL 273

Query: 253 TEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLAS 312
           + + I  I+ ++AKY L++IADEVYQEN F   +F S+KKVLR LQ+   G Y+ VQLAS
Sbjct: 274 SPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLAS 333

Query: 313 LHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSPPRPG 372
           LHSTSKG+ GECGQRGGYMEL+G +++V+   +KL SIS+C VVTGQAL+D++V PP+ G
Sbjct: 334 LHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKG 393

Query: 373 DESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQKFIDIA 432
           D SYE+D+ ERN I N L  +S  L++ F SLEGV C +PQGAMYLFPK    +K I  A
Sbjct: 394 DASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKA 453

Query: 433 QKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRKFHTEF 492
           + L    D  YCKELLE TGICTVPGSGF Q P TYHLRTTFL PG  W+D W+KFH +F
Sbjct: 454 ESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKF 513

Query: 493 CERYR 497
            + +R
Sbjct: 514 VDEHR 518

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/492 (58%), Positives = 365/492 (74%), Gaps = 7/492 (1%)

Query: 7   TDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNP 66
           + F P   +TL D+N  ++K +YAVRG IP RAEEL+ +LE+ P SLPF+KII ANIGNP
Sbjct: 35  SRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGNP 94

Query: 67  QQLGQKPLSFIRKVLSILQYPDILEDESK-LQTLIELRVYQKDVVRRARKLLGEIGGSVG 125
           QQLGQKPL+F R+V+S++Q P +LE  ++ LQ     + ++ DVV RAR++L + GGSVG
Sbjct: 95  QQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQ-----QAFKADVVVRARRMLQDAGGSVG 149

Query: 126 AYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLI 185
           AYS SQGV G ++TVA +I +RD G  A P++++LT GASSAVS +L  FC GP TGVLI
Sbjct: 150 AYSASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLI 208

Query: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245
           PIPQYPLYTATIT   A A+ YYLNE D WS N  EME  I +S K  I P  +V+INPG
Sbjct: 209 PIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPG 268

Query: 246 NPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFY 305
           NPTGS+L+ KD+  I+ ++AKYG+++IADEVYQ+NVF   +FHS++KVL+ LQ +    Y
Sbjct: 269 NPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLY 328

Query: 306 ETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMV 365
           + VQLASLHS SKGL GECGQRGGYMELIG  +++R   VKL SIS+C VVTGQAL+D++
Sbjct: 329 KNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLM 388

Query: 366 VSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFP 425
           V PP  GD SYE    E  +I ++L  RSQ L + F SLEG+EC  PQGA+YLFPK   P
Sbjct: 389 VGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLP 448

Query: 426 QKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLW 485
           QK I+ AQKL   AD LYC ELL+ TGICTVPG+GFGQ P TYH+RTTFL PG  WI+ W
Sbjct: 449 QKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESW 508

Query: 486 RKFHTEFCERYR 497
           + FH +F ++YR
Sbjct: 509 KDFHKKFYDKYR 520

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/498 (56%), Positives = 368/498 (73%), Gaps = 14/498 (2%)

Query: 9   FTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQ 68
           F P  K +L D+N  I+K +YA+RG IP RAEEL +QL ++ KSLPF KI+ ANIGNPQQ
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67

Query: 69  LGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYS 128
           L Q+PL+F R+V+S++Q+PD+L+ +     L+  ++Y KD + RA KLL  IGGSVGAYS
Sbjct: 68  LDQQPLTFQRQVMSLVQFPDLLKSKD---ILLAQKIYSKDSIERATKLLNSIGGSVGAYS 124

Query: 129 LSQGVPGIQQTVADYITKRDS---------GEVAYPEDIFLTTGASSAVSFILPMFCNGP 179
            SQGV  I++ VA +I KRD           E A   ++FLT GAS+AV  ILP+F    
Sbjct: 125 SSQGVLDIRKNVARFILKRDLHHDPTQDLIDETA--SNVFLTAGASTAVDHILPLFAKDE 182

Query: 180 TTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTI 239
           + GVL+PIPQYPLYTA +TL  +  + YYLNE +NWS +  ++E  + ++IK  IKPTT+
Sbjct: 183 SCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTL 242

Query: 240 VIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQR 299
           V+INPGNPTG+ILT+  I +II I+A+YG++IIADEVYQENV+   EFHS KKVL +L++
Sbjct: 243 VVINPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRK 302

Query: 300 KYLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQ 359
            Y   Y+ VQLASLHS SKG+ GECGQRGGYME+ G ++DV+  ++K+ SISICSVVTGQ
Sbjct: 303 NYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQ 362

Query: 360 ALIDMVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLF 419
            L+D++V+PP+PGDESYE+DQLER+ I ++LI +S  L+ +F  L G+ C +PQGAMYLF
Sbjct: 363 ILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLF 422

Query: 420 PKFIFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGD 479
           P+    +  I+ A +L+ + D  YC +LLE+TGICTVPGSGFGQ P TYHLRTTFL PG 
Sbjct: 423 PRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGI 482

Query: 480 SWIDLWRKFHTEFCERYR 497
            WI+ W KFH EF E+Y+
Sbjct: 483 EWINSWEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/499 (53%), Positives = 357/499 (71%), Gaps = 12/499 (2%)

Query: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67
           D TP  K +L D++  I+ T+YA+RG IP RA+EL+ QL   P  LPF KII ANIGNPQ
Sbjct: 5   DCTPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQ 64

Query: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127
           QL Q+PL+F R+VLS+++YP+++  ++    L+E ++Y  D ++RA  +L  IGGSVGAY
Sbjct: 65  QLEQEPLTFQRQVLSLVEYPNLVNSKN---ILVENKIYAPDAIKRAETILNSIGGSVGAY 121

Query: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPE---------DIFLTTGASSAVSFILPMFCNG 178
           S SQG+  I++ VA  I +RD+ E+   +         +IFLT GA++AVS+ILP+F   
Sbjct: 122 SSSQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKD 181

Query: 179 PTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTT 238
              GVL+PIPQYPLYTA +TL  +  + YYLNE++NWS +  E+E  I+++I   IKPTT
Sbjct: 182 ENCGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTT 241

Query: 239 IVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQ 298
           +VIINPGNPTG+IL+ + I  II I+AKYG++IIADEVYQ N++   +FHS KK+L  L+
Sbjct: 242 LVIINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLK 301

Query: 299 RKYLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTG 358
            +Y   Y+ VQLASLHS SKG+ GECGQRGGY EL+G +D+++  ++KL SI ICSVVTG
Sbjct: 302 LQYPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTG 361

Query: 359 QALIDMVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYL 418
           Q L+D++  PP  GD SY++DQ ERNNI+++LI +S  L+ LF  L G+ C +PQGAMYL
Sbjct: 362 QILVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYL 421

Query: 419 FPKFIFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPG 478
           FP+       I+ A+  + E D  YC +LLE+TGICTVPGSGFGQK  TYH+RTTFL  G
Sbjct: 422 FPRLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSG 481

Query: 479 DSWIDLWRKFHTEFCERYR 497
             WI LW KFH EF  +Y+
Sbjct: 482 IEWIKLWEKFHLEFMNQYK 500

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 79/351 (22%), Positives = 144/351 (41%), Gaps = 42/351 (11%)

Query: 124 VGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGV 183
           V  YS ++G P +  ++ D  +     ++  PE++ +TTGA+  +   L    N P   V
Sbjct: 85  VNQYSPTRGRPRLINSLIDLYSPFYKKQLT-PENVLVTTGANEGILSCLMGIIN-PGDEV 142

Query: 184 LIPIPQYPLYTATITLVGATAISYYLN---EEDNWSVNTVEMENTIQESIKSGIKPTTIV 240
           ++  P +  Y   I L G   +   +N   E DN      E      E  ++    T  V
Sbjct: 143 IVFEPFFDQYIPNIELCGGKVVYVPINPPKELDNRVTKGTEWTVDFDEFTRAITPKTKAV 202

Query: 241 IIN-PGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQR 299
           IIN P NP G + T +++  +  I  +  ++IIADEVY E+++  +EF  +  +  ++ +
Sbjct: 203 IINTPHNPIGKVFTREELTKLGNICVENNVIIIADEVY-EHLYFVDEFPRIATLSEEIGQ 261

Query: 300 KYLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQ 359
             L         S+ S  K      G R G+  ++    D+ L+        IC      
Sbjct: 262 LTL---------SVGSAGKSF-AATGWRIGW--VVSQNPDL-LQYASKAHTRIC------ 302

Query: 360 ALIDMVVSPPRPGDE--SYEMDQLER----NNIKNDLISRSQKLHQLFISLEGVECLRPQ 413
                  + P P  E  SY +D   +     N++ + + + +    +F  L G+    P+
Sbjct: 303 ------FASPSPIQEACSYSIDHALKIDYFENMRQEYVKKFKIFTSVFDEL-GLPYTIPE 355

Query: 414 GAMYL---FPKFIFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGF 461
           G+ ++   F K   P  +    + +    D      L+   G+  +P + F
Sbjct: 356 GSYFVLADFSKVKIPDSYQFPEEIMSKGKDFRISNWLINELGVVAIPPTEF 406

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 76/166 (45%), Gaps = 15/166 (9%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIP 186
           Y   QG   +++ +A+  +  D       E++ LT GA +A +F+      G     +  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNEDV--TLSEENVILTNGAIAA-NFLTHYTLAGKGDHFICI 111

Query: 187 IPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGN 246
            P Y   ++   + GA     +L +E N+  N VE+E  I+ + K       IV+  P N
Sbjct: 112 SPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERMIKPNTK------CIVLNTPNN 165

Query: 247 PTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKK 292
           P  S++  + +  I  ++ K+G+++  DEVY         FHS +K
Sbjct: 166 PLSSVIPTETLREIAELADKHGIVVFCDEVYSP------LFHSCEK 205

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 69/146 (47%), Gaps = 9/146 (6%)

Query: 132 GVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYP 191
           G P ++  VA       S E+    D  L T  +   +F++     GP   ++   P Y 
Sbjct: 60  GTPVLRDLVAKI---HSSDEIQLTADNVLITNGAIGANFLVHYTAAGPGDHIICVDPTYQ 116

Query: 192 LYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSI 251
             ++  ++ GA     +L  ED ++ N  ++++ ++ + K       IV+ NP NP GS+
Sbjct: 117 QLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKVRANTK------YIVLNNPNNPLGSV 170

Query: 252 LTEKDIANIIRISAKYGLLIIADEVY 277
           ++ + +  II  + +  + I+ DEVY
Sbjct: 171 ISTEKMTEIIDYAERNEIFIVCDEVY 196

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 76/359 (21%), Positives = 146/359 (40%), Gaps = 65/359 (18%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIP 186
           Y+ ++G P + + +   + +   G++A  E++ +TTGA+  +   L    N P   V++ 
Sbjct: 103 YAPTRGRPALVEALLK-LYRPMYGDLA-AENVQVTTGANEGIFACLAGLVN-PGDEVIVF 159

Query: 187 IPQYPLYTATITLVGATA----------ISYYLNEEDNWSVNTVEMENTIQESIKSGIKP 236
            P +  Y   I L+G             +S  + E   W ++   +  TI E  K+    
Sbjct: 160 EPFFDQYIPNIELLGGVVRYVPIRPPAELSKRVTEGTEWVIDYDMLRQTINEKTKA---- 215

Query: 237 TTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRK 296
             ++I +P NP G + T +++  +  I  + G+ II+DEVY E+++  +EF  +  +  +
Sbjct: 216 --VIINSPHNPIGKVFTREELLKLGNICVEKGIYIISDEVY-EHLYFTDEFTRIATLSEE 272

Query: 297 LQRKYLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVV 356
           +              S H+ + G  G+     G+   IG       E++ L S       
Sbjct: 273 I--------------SQHTLTVGSAGKSFAATGWR--IGWVISRNKELLALAS------- 309

Query: 357 TGQALIDMVVSPPRPGDE--SYEMDQLERNNIKNDLISRSQKLHQLF---ISLEGVECLR 411
             +A + +  S P P  E  +  ++   +     D  +  QK ++ F       G+   R
Sbjct: 310 --KAHVRICFSSPAPLQEACAVAIEHALKTTYYADTRAAYQKKYERFQKPFDDLGLPYTR 367

Query: 412 PQGAMYLFPKFI---------FPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGF 461
            +G+ +L   F          FP++  D  +      D      L+   G+  +P S F
Sbjct: 368 AEGSYFLLVDFSRLPLPADYHFPEELADKGR------DFRVAYWLINELGLVAIPCSSF 420

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 83/177 (46%), Gaps = 19/177 (10%)

Query: 124 VGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGV 183
           V  YS ++G P + +++ D  +      +  PE++ +TTGA+  +   L    N     V
Sbjct: 84  VNQYSPTRGRPTLIKSLTDLYSPLYKLTLK-PENVLVTTGANEGILACLMGILNQ-NDEV 141

Query: 184 LIPIPQYPLYTATITLVGATAISYYLNEEDN----------WSVNTVEMENTIQESIKSG 233
           ++  P +  Y   I L G   +   +N   +          W+++  + EN I    K+ 
Sbjct: 142 IVFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITNKTKA- 200

Query: 234 IKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSV 290
                I+I  P NP G + T +++  I  I  K+ ++II+DEVY +N++  +EF  +
Sbjct: 201 -----IIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVY-DNLYFVDEFTRI 251

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 71/325 (21%), Positives = 132/325 (40%), Gaps = 53/325 (16%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLN----- 210
           E++ +TTGA+  +   L    N     V++  P +  Y + I L+G   +   +N     
Sbjct: 117 ENVTITTGANEGILSCLMGLLNAGDE-VIVFEPFFDQYISNIELMGGKIVYVPINPPKEL 175

Query: 211 -----EEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISA 265
                E   W+V+  + +N I    K+      ++I  P NP G + T +++  I  I  
Sbjct: 176 DQRVTEGTEWTVDMEQFKNAITSKTKA------VIINTPHNPIGKVFTREELLQIGNICV 229

Query: 266 KYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLASLHSTSKGLIGECG 325
           +  ++II+DEVY E+++  +EF  +  +            E  QL     ++       G
Sbjct: 230 EKNVIIISDEVY-EHLYFTDEFTRIATLSP----------EIGQLTLTVGSAGKTFAATG 278

Query: 326 QRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSPPRPGDESYE---MDQLE 382
            R G+  +I L  ++ L+ V      IC             + P P  E+      D LE
Sbjct: 279 WRIGW--VISLNSEL-LQYVSKAHTRIC------------FASPSPLQEACANSINDALE 323

Query: 383 RN---NIKNDLISRSQKLHQLFISLEGVECLRPQGAMYL---FPKFIFPQKFIDIAQKLH 436
            N    ++ + I + +    +F  L G+   +P+G  ++   F K   P+ +    + L+
Sbjct: 324 SNYFEKMRQEYIQKFKIFTSVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPYPKEILN 382

Query: 437 TEADTLYCKELLEHTGICTVPGSGF 461
              D      L+   G+  +P + F
Sbjct: 383 KGKDFRISHWLINELGVVAIPPTEF 407

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 80/171 (46%), Gaps = 20/171 (11%)

Query: 124 VGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAV-SFILPMFCNGPTTG 182
           V  YS ++G P +  ++ D  T   + E+   E++ +TTGA+  + S ++ +  +G    
Sbjct: 85  VNQYSPTRGRPSLINSLIDLYTPIYNKELK-AENVVVTTGANEGILSCLMGLLNSGDE-- 141

Query: 183 VLIPIPQYPLYTATITLVGATAISYYLN----------EEDNWSVNTVEMENTIQESIKS 232
           V++  P +  Y   I L G   +   +N            + W+++  + E  I    K+
Sbjct: 142 VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITSKTKA 201

Query: 233 GIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFS 283
                 ++I  P NP G + T  ++  +  I  K+ ++II+DEVY+   F+
Sbjct: 202 ------VIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVYEHLYFT 246

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 81/172 (47%), Gaps = 22/172 (12%)

Query: 124 VGAYSLSQGVPG-IQQTVADYITKRDSGEVAYPEDIFLTTGASSAV-SFILPMFCNGPTT 181
           V  YS ++G P  I   +  Y    D+   A  E++ +TTGA+  + S ++ +  +G   
Sbjct: 101 VNQYSPTRGRPSLINSLIKLYSPIYDTDLRA--ENVTVTTGANEGILSCLMGLLNSGDE- 157

Query: 182 GVLIPIPQYPLYTATITLVGATAISYYLN----------EEDNWSVNTVEMENTIQESIK 231
            V++  P +  Y   I L G   +   +N          + + W+++  + EN I    K
Sbjct: 158 -VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTKGEEWTIDFEQFENAITSKTK 216

Query: 232 SGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFS 283
           +      ++I  P NP G + T +++  +  I  K+ ++II+DEVY+   F+
Sbjct: 217 A------VIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLFFT 262

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 114/290 (39%), Gaps = 62/290 (21%)

Query: 155 PEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDN 214
           PE+I +TTGA+  + F   M    P   V++  P +  Y   I ++G       L    +
Sbjct: 99  PENIQVTTGANVGI-FACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKD 157

Query: 215 ----------WSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRIS 264
                     W+++  +  + I E  K+      ++I +P NPTG + T +++  +  I 
Sbjct: 158 LKTRRTKGSEWTLDFDQFRSAISEKTKA------VIINSPHNPTGKVFTREELLTLGNIC 211

Query: 265 AKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLASLHSTSKGLIGEC 324
            +  + II+DEVY+   F+                      E V+LASL      +    
Sbjct: 212 VEKNVYIISDEVYENLYFTP---------------------ECVKLASLSPEISNITLTI 250

Query: 325 GQRGGYMEL----IGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSPPRPG-------- 372
           G  G    +    IG      +E++KL S          A I +  S P P         
Sbjct: 251 GSAGKIFAVTGWRIGWIISENVELLKLAS---------SAHIKICFSSPSPPQLACAHAI 301

Query: 373 DESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKF 422
           D +   D  +R  ++ D I + + L  +F  L G+    P+G+ ++   F
Sbjct: 302 DIALNSDYFDR--MRKDYIEKVEILTSVFEEL-GMPYTVPEGSYFIVVDF 348

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 79/353 (22%), Positives = 144/353 (40%), Gaps = 46/353 (13%)

Query: 124 VGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGV 183
           V  YS ++G P +  ++    +   + ++   E++ +TTGA+  +   L    N     V
Sbjct: 85  VNQYSPTRGRPSLINSLIKLYSPIYNKDLT-TENVTVTTGANEGILSCLMGLLNAGDE-V 142

Query: 184 LIPIPQYPLYTATITLVGATAISYYLNEEDNWSV-NTVEMENTIQ-ESIKSGIKPTT-IV 240
           ++  P +  Y + I L G   +   +N      + NT   E TI  E  +  I P T  V
Sbjct: 143 IVFEPFFDQYISNIELCGGKVVYVPINPPKELDLRNTRGEEWTIDFEQFEKAITPKTKAV 202

Query: 241 IIN-PGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQR 299
           IIN P NP G + T +++  +  I  K+ ++II+DEVY E+++  + F  +  +      
Sbjct: 203 IINTPHNPIGKVFTREELTTLGNICVKHNVIIISDEVY-EHLYFTDSFTRIATISP---- 257

Query: 300 KYLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQ 359
                 E  QL     ++  L    G R G++  + L  D+ L  V      IC      
Sbjct: 258 ------EIGQLTLTVGSAGKLFAATGWRIGWV--VSLNADL-LSYVSKAHTRIC------ 302

Query: 360 ALIDMVVSPPRPG--------DESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLR 411
                  S P P         D+  ++   E+  ++ + I++ +    +F  L G+    
Sbjct: 303 ------FSSPSPLQEACANSIDDGLKIGYFEK--MRQEYITKFKIFTSIFDEL-GLPYTA 353

Query: 412 PQGAMYL---FPKFIFPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGF 461
           P+G  ++   F K   P+ +    +      D      L+   G+  +P + F
Sbjct: 354 PEGTYFVLVNFSKVKIPKDYSYPEEIRDKGKDFRISHWLINELGVVAIPPTEF 406

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 83/181 (45%), Gaps = 19/181 (10%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIP 186
           YS ++G P + +++ D+ +     E     ++ +TTGA+  +   L    N P   V++ 
Sbjct: 88  YSPTRGRPSLLKSLTDFYSPI-YNETLNESNVTITTGANEGILASLVGLLN-PGDEVIVF 145

Query: 187 IPQYPLYTATIT----------LVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKP 236
            P +  Y + I           LV    +S  +     W ++   +  TI E  K     
Sbjct: 146 EPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINERTK----- 200

Query: 237 TTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRK 296
             I++  P NP G + T +++  +  I  K  + II+DEVY E+++ G+EF  +  + ++
Sbjct: 201 -CIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYFGDEFTRIATISKE 258

Query: 297 L 297
           +
Sbjct: 259 I 259

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 70/152 (46%), Gaps = 9/152 (5%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIP 186
           Y   +G   ++  VA   + +   EV   +D  L T  +   +F++     GP   V+  
Sbjct: 55  YGAIKGSDELRSLVASLYSDK---EVKLDKDNVLITNGAIGANFLVSYTLAGPGDHVICV 111

Query: 187 IPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGN 246
            P Y   ++   + GA      LN E+++  +  ++++ I+ + K       IV+ NP N
Sbjct: 112 DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKGNTK------CIVLNNPNN 165

Query: 247 PTGSILTEKDIANIIRISAKYGLLIIADEVYQ 278
           P GS++    +  I  ++ K  + +I DEVY+
Sbjct: 166 PLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 78/170 (45%), Gaps = 18/170 (10%)

Query: 124 VGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGV 183
           V  YS ++G   + +++    +   + E+   E++ +TTGA+  +   L    N P   V
Sbjct: 84  VNQYSPTRGRVSLLESLIKLYSPLYNAELK-AENVTVTTGANEGILSCLMGILN-PGDEV 141

Query: 184 LIPIPQYPLYTATITLVGATAISYYLNEEDN----------WSVNTVEMENTIQESIKSG 233
           ++  P +  Y   I L+G   +   +N   +          W+V+  +  N I +  K+ 
Sbjct: 142 IVFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTVDYEQFANAITDKTKA- 200

Query: 234 IKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFS 283
                ++I  P NP G + T +++  I  I  K  ++II+DEVY+   F+
Sbjct: 201 -----VIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEHLYFT 245

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 83/168 (49%), Gaps = 13/168 (7%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAV-SFILPMFCNGPTTGVLI 185
           YS ++G P + + +AD  T    G+    ++I + TGA+ A+ S ++ +   G    V  
Sbjct: 77  YSPTRGRPNLIKALADLYTPL-YGQQLSADNITVHTGANEAIFSCLMGLLNKGDEVIVFE 135

Query: 186 PIPQYPLYTATITLVGATAISYYLN---EEDNWSVNTVEME---NTIQESIKSGIKPTTI 239
           P   +  Y + I L G       +N   E D+      E E   + ++++I S  K   +
Sbjct: 136 PF--FDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWEIDWDILEKTINSRTK--CV 191

Query: 240 VIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEF 287
           +I  P NP G + T +++  + +I     ++II+DEVY E+++  +EF
Sbjct: 192 IINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVY-EHLYFSDEF 238

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 79/170 (46%), Gaps = 18/170 (10%)

Query: 124 VGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGV 183
           V  YS ++G P + +++ + + K   G+    +++ +TTGA+  +   L    N     V
Sbjct: 74  VNQYSPTRGRPSLIKSLVE-LYKPVFGDFIDNQNVLVTTGANEGILSCLMGILNA-GDEV 131

Query: 184 LIPIPQYPLYTATITLVGATA--ISYYLNEE--------DNWSVNTVEMENTIQESIKSG 233
           ++  P +  Y   I L G     +  +  +E        D W ++   +E T     K+ 
Sbjct: 132 IVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEKTFNNKTKA- 190

Query: 234 IKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFS 283
                ++I  P NP G + TE+++  + ++  ++  ++I+DEVY+   F+
Sbjct: 191 -----VIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYEHLYFT 235

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 76/170 (44%), Gaps = 18/170 (10%)

Query: 124 VGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGV 183
           V  YS ++G P +  ++    +   + E+   E++ +TTGA+  +   L    N     V
Sbjct: 85  VNQYSPTRGRPSLINSLIKLYSPIYNTELK-AENVTVTTGANEGILSCLMGLLNA-GDEV 142

Query: 184 LIPIPQYPLYTATITLVGATAISYYLN----------EEDNWSVNTVEMENTIQESIKSG 233
           ++  P +  Y   I L G   +   +N            + W+++  + E  I    K+ 
Sbjct: 143 IVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITSKTKA- 201

Query: 234 IKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFS 283
                ++I  P NP G + T +++  +  I  K+ ++II+DEVY+   F+
Sbjct: 202 -----VIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFT 246

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 72/153 (47%), Gaps = 8/153 (5%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPE-DIFLTTGASSAVSFILPMFCNGPTTGVLI 185
           Y  SQG P + + V  + +     ++ Y + D+  T G ++A    L +FCN    G  I
Sbjct: 106 YGFSQGQPELMEFVRKHTSLVH--DIKYADWDVLATAGNTNAWESTLRVFCN---RGDTI 160

Query: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245
               Y  +++++    A  ++ +    D + +   ++E+ +        KP  +  I  G
Sbjct: 161 LAEAYS-FSSSLYAAEAQGVNVFPVPLDEFGIIPEKLESIMDNWNPETPKPKLLYTIPTG 219

Query: 246 -NPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
            NPTGS L++   A I RI+ K+  +II DE Y
Sbjct: 220 QNPTGSSLSDDRKAKIYRIAQKHNFIIIEDEPY 252

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 64/137 (46%), Gaps = 6/137 (4%)

Query: 154 YPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEED 213
           + +D  L T  + A +F++     GP   V+   P Y    +   + GA      L +ED
Sbjct: 76  FNKDNVLVTNGAIAANFLIYYTLVGPGDHVICVDPTYAQLYSVPKMFGAEVSLLKLQKED 135

Query: 214 NWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIA 273
            +  N      T+++ IKS  K   I+I NP NP GS ++ + + +I ++  +  + +  
Sbjct: 136 GFIPNI----ETLKKMIKSNTK--LIIINNPNNPLGSAISTETLNDICQLCEENNIYLHC 189

Query: 274 DEVYQENVFSGNEFHSV 290
           DEVY+    S  E  SV
Sbjct: 190 DEVYKPIFHSMPEGKSV 206

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 83/186 (44%), Gaps = 17/186 (9%)

Query: 127 YSLSQGVPGIQQTVADY---ITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGV 183
           Y  +QG P +   + ++   I K +  +     DI LTTG ++     L +FCN    G 
Sbjct: 103 YGFTQGHPDLLNFLKEHTGLIHKMNYSDW----DIILTTGNTNGWESTLRVFCN---KGD 155

Query: 184 LIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIIN 243
           +I + +   +++++    A  I+ +    D   +   ++E  +        KP  +  I 
Sbjct: 156 VI-LAEAHSFSSSLASAEAQGITTFPIPIDEHGIIPEKLEEILDNWTPGAPKPKLLYTIP 214

Query: 244 PG-NPTGSILTEKDIANIIRISAKYGLLIIADEVYQ-----ENVFSGNEFHSVKKVLRKL 297
            G NPTG+ L ++    I RI+ K+  LII DE Y      E +   +E   V+ V +  
Sbjct: 215 TGQNPTGTSLADERKVEIYRIACKHDFLIIEDEPYYFLQMGEYIADLDERKKVQDVPKPT 274

Query: 298 QRKYLG 303
             ++LG
Sbjct: 275 HDQFLG 280

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 73/165 (44%), Gaps = 22/165 (13%)

Query: 114 RKLLGEIGGSVGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILP 173
           R   G I GS    +L  G+ G+Q                +  D  L T  +   +F+L 
Sbjct: 53  RLTYGAIKGSKDLRTLIAGLYGVQ----------------FSADNVLVTNGAIGANFLLY 96

Query: 174 MFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSG 233
               G    V+   P Y    +   + GA      L+E+D++  N     +T++++IKS 
Sbjct: 97  YTLVGKGDHVICVHPTYSQLYSVPKMFGAEVTLLELSEKDSFLPNL----DTLKKAIKSN 152

Query: 234 IKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQ 278
            K   I+I NP NP G +++++ + +I  +  +  + +  DEVY+
Sbjct: 153 TK--LIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDEVYR 195

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 83/368 (22%), Positives = 155/368 (42%), Gaps = 48/368 (13%)

Query: 109 VVRRARKLLGEIGGSVGAYSLSQG-VPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSA 167
           VV  A+K L +    V  YS ++G +  I   +  Y    ++   A   +I +TTGA+  
Sbjct: 71  VVEEAQKALDD--AMVNQYSPTKGRMSLINSLIKQYSPLYNTQLQA--NNIQVTTGANEG 126

Query: 168 VSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVE-MENTI 226
           +   L    N P   V++  P +  Y + I + G       L+     SV   E  E T+
Sbjct: 127 ILACLVGLLN-PGDEVIVFEPFFDQYISNIQIPGGKVTYVPLHPPKEMSVRPTEGTEWTV 185

Query: 227 Q-ESIKSGIKPTTIVII--NPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFS 283
             + +++ I P T  +I   P NP G + T +++  I +I  +  ++II+DEVY E+++ 
Sbjct: 186 DYDELRAAITPKTKALILNTPHNPVGKVFTREELLQIGQICVENNVVIISDEVY-EHLYF 244

Query: 284 GNEFHSVKKVLRKLQRKYLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLE 343
             EF  V  +  ++ +  L         ++ S  K      G R G+  ++ L  ++ LE
Sbjct: 245 TPEFTRVATLSPEIGQITL---------TIGSAGKSF-AATGWRIGW--IVSLNPEL-LE 291

Query: 344 VVKLMSISICSVVTGQALIDMVVSPPRPGDES------YEMDQLERNNIKNDLISRSQKL 397
              +    IC             + P P  E+        +D      ++ + I +    
Sbjct: 292 YASMAHTRIC------------FASPSPLQEACANALPIALDNGYFKKMREEYIHKFNIF 339

Query: 398 HQLFISLEGVECLRPQGAMYL---FPKFIFPQKFIDIAQKLHTEA-DTLYCKELLEHTGI 453
            ++F  L G+   +P+G  ++   F K   P+ +    ++L ++A D      L+   G+
Sbjct: 340 TRVFDEL-GLPYTKPEGTYFVLVDFSKVKIPEDY-PFPEELRSKAKDFRISYWLINELGV 397

Query: 454 CTVPGSGF 461
             +P + F
Sbjct: 398 VAIPPTEF 405

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 64/127 (50%), Gaps = 5/127 (3%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNW 215
           E+I +TTGA+  +   L    N     V++  P +  Y + I L+G   +   +N   + 
Sbjct: 120 ENITITTGANEGILSCLMGLLNAGDE-VIVFEPFFDQYISNIELMGGKVVYVPINPPKDL 178

Query: 216 SVNTVE-MENTIQ-ESIKSGIKPTT--IVIINPGNPTGSILTEKDIANIIRISAKYGLLI 271
                E  E TI  E  ++ I P T  +++ +P NP G + T++++  +  I  +  ++I
Sbjct: 179 DQRITEGTEWTIDFEQFRNAITPKTKAVIVNSPHNPIGKVFTKEELTKLGEICVENNVII 238

Query: 272 IADEVYQ 278
           I+DEVY+
Sbjct: 239 ISDEVYE 245

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 119/263 (45%), Gaps = 26/263 (9%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPE-DIFLTTGASSAVSFILPMFCNGPTTGVLI 185
           Y  SQG P I +   ++ +     ++ Y   D+  T G + A   +L +FCN    G  I
Sbjct: 105 YGYSQGQPEITKFFKEHHSLIH--DMKYENWDVLATIGNTGAWESVLRIFCN---RGDTI 159

Query: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245
              Q+  ++++I+   A  ++ +    D   +   ++E  +    +   KP  +  +  G
Sbjct: 160 LAEQF-AFSSSISAAEAQGVNVFPIPLDEHGIIPSKLETILDNWTEGAAKPKLLYTVPTG 218

Query: 246 -NPTGSILTEKDIANIIRISAKYGLLIIADEVY---QENVFSGNEFHSV-------KKVL 294
            NPTGS L+      I RI+ K+  +II DE Y   Q   +  +  + V       K+ +
Sbjct: 219 QNPTGSSLSFDRKEEIYRIAQKHDFIIIEDEPYYFLQMEKYEKDPANRVVKSYADHKEFI 278

Query: 295 RKLQRKYLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDV-RLEVVKLMSISIC 353
           + L++ ++      ++  L S SK L    G R G+  ++G  D + R+  ++ M+I   
Sbjct: 279 QNLEKSFVSIDTEGRVLRLDSLSKVLA--PGTRFGW--IVGAKDILARILSLQEMTIQAP 334

Query: 354 SVVTGQALIDMVVSPPRPGDESY 376
           +  T Q++I   ++  R G E Y
Sbjct: 335 AGFT-QSIIAGTMN--RWGQEGY 354

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 66/137 (48%), Gaps = 17/137 (12%)

Query: 157 DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGA--TAISYYLNEEDN 214
           ++ +TTGA+  +   L    N P   V++  P +  Y + I + G   T +  +  +E N
Sbjct: 116 NVQVTTGANEGILSCLVGLLN-PGDEVIVFEPFFDQYISNIQIPGGKVTYVPMHPPKEMN 174

Query: 215 --------WSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAK 266
                   W+VN  E+E  I    K+      +++  P NP G + T +++  I  I  K
Sbjct: 175 VRNTKGTEWTVNYDELEAAITPKTKA------LILNTPHNPVGKVFTREELLRIGEICVK 228

Query: 267 YGLLIIADEVYQENVFS 283
           + ++II+DEVY+   F+
Sbjct: 229 HNVVIISDEVYEHLYFT 245

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 76/159 (47%), Gaps = 6/159 (3%)

Query: 124 VGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGV 183
           V  YS ++G P +  ++    +     E+   E++ +TTGA+  +   L    N P   V
Sbjct: 92  VNQYSPTKGRPSVINSLKKLYSPLYGQELK-DENVTITTGANEGILSSLMGILN-PGDEV 149

Query: 184 LIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMEN---TIQESIKSGIKPTTIV 240
           ++  P +  Y   I L+G   +   +N   +     VE ++     +E  K+    T  +
Sbjct: 150 IVFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRIVEGKDWTIDYEELAKAFTSKTKAL 209

Query: 241 IIN-PGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQ 278
           I+N P NP G + T++++  I  +  +  ++II+DEVY+
Sbjct: 210 ILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYE 248

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 85/189 (44%), Gaps = 18/189 (9%)

Query: 91  EDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYSLSQGVPGIQQTVADYITKRDSG 150
           ED SK     E +V++ D+   AR L  + G S+G   L+  +    + + D        
Sbjct: 77  EDTSKFSVKKESKVHEGDIPL-ARSL--QYGKSMGQPELTDFLKEHTKMIHD-------- 125

Query: 151 EVAYPE-DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYL 209
            + Y + D+  TTG ++A    L +FCN    G +I + +   +++++    A  I  + 
Sbjct: 126 -MKYSDWDVVATTGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSSLASAEAQGIITFP 180

Query: 210 NEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG-NPTGSILTEKDIANIIRISAKYG 268
              D   +   ++E  +    +   KP  +  I  G NPTGS L  +    I RI+ K+ 
Sbjct: 181 VPIDAHGIIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHD 240

Query: 269 LLIIADEVY 277
            LII DE Y
Sbjct: 241 FLIIEDEPY 249

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 79/176 (44%), Gaps = 16/176 (9%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPE-DIFLTTGASSAVSFILPMFCNGPTTGVLI 185
           Y  SQG P + + + ++   +   ++ Y + D+  T G ++A    L +FCN    G +I
Sbjct: 104 YGFSQGQPELLEFIREH--NKLIHDMQYEDWDVVATAGNTNAWESTLRVFCN---RGDVI 158

Query: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245
            + +   +++ +    A  I+ +    D+  +   ++E  +        KP  +  I  G
Sbjct: 159 -LAEAHSFSSCLAAAQAQGITTFPVPIDDKGIIPAKLEAILDNWTPGAPKPKLLYTIPTG 217

Query: 246 -NPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRK 300
            NPTG+ L ++    I RI+ K+  LII D  Y         F  + K  R LQ++
Sbjct: 218 QNPTGTSLADERKPEIFRIAQKHDFLIIEDAPYY--------FLQMDKYERDLQKR 265

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 73/181 (40%), Gaps = 14/181 (7%)

Query: 157 DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWS 216
           D+  T G++ A    L +FCN   T VL+    Y          G   ++  ++++    
Sbjct: 128 DLITTAGSTQAWDACLRLFCNRGET-VLMEEYTYSSSLEAAVAQGLNCVAMKMDKDGIKV 186

Query: 217 VNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEV 276
               EM      +++         I N  NPTG  L E+    ++R++++Y  +II D+ 
Sbjct: 187 DKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDP 246

Query: 277 Y---QENVFSG---------NEFHSVKK-VLRKLQRKYLGFYETVQLASLHSTSKGLIGE 323
           Y   Q N F           NE    K+  + KL R  L + +  ++  L S SK     
Sbjct: 247 YYFLQMNEFGAPELNVPGDVNEMQWFKENFVNKLGRSLLEWDDVGRIIRLESVSKTFAPG 306

Query: 324 C 324
           C
Sbjct: 307 C 307

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 81/186 (43%), Gaps = 17/186 (9%)

Query: 157 DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWS 216
           ++  TTG + +    L +FCN    G  I   QY  +++++    A  I+ +    D   
Sbjct: 135 NVLATTGNTGSWESTLRIFCN---RGDTILAEQY-TFSSSVYAAEAQGINVFPVPLDADG 190

Query: 217 VNTVEMENTIQESIKSGIKPTTIVIINPG-NPTGSILTEKDIANIIRISAKYGLLIIADE 275
           +    +E  +        KP  +  I  G NPTGS L++     I RI+ K+ LLII DE
Sbjct: 191 LIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIEDE 250

Query: 276 --------VYQENVFSGNEFH--SVKKVLRKLQRKYLGFYETVQLASLHSTSKGLIGECG 325
                    YQ++V    E H  S +  +  L + ++      ++  L S SK L    G
Sbjct: 251 PYYFLQMDAYQKDVSQRKETHFASQEDFVNSLAKSFISLDTEGRVLRLDSFSKVL--GPG 308

Query: 326 QRGGYM 331
            R G++
Sbjct: 309 TRLGWI 314

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/276 (22%), Positives = 110/276 (39%), Gaps = 35/276 (12%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNW 215
           E+I +TTGA  A+   L M    P   V++  P +  Y   I + G       L   +  
Sbjct: 99  ENILVTTGAIQALLESL-MALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQG 157

Query: 216 SVNTVEMENTI--QESIKSGIKPTT--IVIINPGNPTGSILTEKDIANIIRISAKYGLLI 271
               +E  + I  +E++++     T  ++I NP NP G +    ++  +  +    G  I
Sbjct: 158 KKRILEANDWILDRETLRAAFTDKTKLMIINNPNNPLGKVFNRDELLEMATLCVNNGAYI 217

Query: 272 IADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLASLHSTSKGLIGECGQRGGYM 331
           IADEVY+   F+ N    +  +   + +K      T+ + S    +  +    G R G+M
Sbjct: 218 IADEVYEFLQFTPNPLSRISNLSEAIAQK------TITIGS----AGKIFRVTGWRVGWM 267

Query: 332 -----ELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSPPRPGDESYEMDQLERNNI 386
                EL+     V +  +   S SI  V +G  +        R  +  Y +      + 
Sbjct: 268 ISKNRELVEKVTAVHVR-MGFCSPSISQVASGLGI-------QRALECGYFLSMPNEFDR 319

Query: 387 KNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKF 422
           K  +I ++       +   GV   +PQGA ++   F
Sbjct: 320 KFSIIYKA-------LDYLGVSYTKPQGAHFIITDF 348

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 80/170 (47%), Gaps = 19/170 (11%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYT--ATITLVGATAISYYLNEED 213
           +++ L  G+  ++  ++   C      +LI    Y +YT  + +  V    +   L+EED
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEED 147

Query: 214 NWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGL-LII 272
            + ++    E  I E++++      + I +PGNPTG+ +   D+  I +I +++   L++
Sbjct: 148 KFQID----EEKILETLQNDPSIKLVFITSPGNPTGTFI---DVNRIEKILSQWQTGLVV 200

Query: 273 ADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLASLHSTSKGLIG 322
            DE Y + V  G++  S+  +  K        YE + +    S S GL G
Sbjct: 201 VDEAYIDFV-EGSDKGSLAPLATK--------YENIAVLQTLSKSFGLAG 241

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 85/197 (43%), Gaps = 25/197 (12%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNW 215
           +DI LT GA  A +F+      G    V+   P Y    +   + GA      L +ED++
Sbjct: 79  DDILLTNGAIGA-NFLAFYTLVGAGDHVICVEPTYSQLYSVPEMFGAEVDLLTLKKEDDF 137

Query: 216 SVNTVEMENTIQESIKSGIKPTT--IVIINPGNPTGSILTEKDIANIIRISAKYGLLIIA 273
             N         +++KS IK  T  I+I NP NP GS++ +  +  I ++  +  + + +
Sbjct: 138 LPNL--------QTLKSMIKNNTKLIIINNPNNPLGSVIKKDLLKQICKLCEENDIYLHS 189

Query: 274 DEVYQENVF----------SGNEFHSVKKVLRKLQRKYLGFYETVQLASLHSTSKGLIGE 323
           DEVY+  +F          S  E +S   V   + + Y      ++L  L S  K  + +
Sbjct: 190 DEVYRP-IFHSLEDEMVPPSACELYSKAIVSGSMSKAYS--VAGIRLGWLVSKDKQFLRD 246

Query: 324 CGQRGGY-MELIGLTDD 339
              R  Y M  + + DD
Sbjct: 247 AASRRDYNMISVSMIDD 263

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 58/127 (45%), Gaps = 9/127 (7%)

Query: 162 TGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVE 221
           TGA+ A+  IL    N P   V++  P +  Y   I L G   +   +    N      +
Sbjct: 113 TGANEAIFSILIGLLN-PGDEVIVFEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRVTK 171

Query: 222 ME------NTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADE 275
            E      +++Q ++ S  K   I+I  P NP G + TE ++  +  I  K  ++II+DE
Sbjct: 172 GEEWQIDWDSLQAAMNSKTK--AIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDE 229

Query: 276 VYQENVF 282
           VY+   F
Sbjct: 230 VYEHLYF 236

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 77/168 (45%), Gaps = 15/168 (8%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDN- 214
           +++ L  G+   +  ++   C      +L   P Y +Y+    +     +   L  EDN 
Sbjct: 85  DNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIVECPLITEDNS 144

Query: 215 WSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIAD 274
           + +N  E+ +T+    K+  K   + I +PGNPTG ++ +KDI  I+  +   GL+++ D
Sbjct: 145 FQMNVPEVLSTL----KNDPKIKLLFITSPGNPTGKLVNKKDIEFILE-NWTNGLVVV-D 198

Query: 275 EVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLASLHSTSKGLIG 322
           E Y +   +    +S+ K++ K        Y  + +    S S GL G
Sbjct: 199 EAYIDFADAEGTTYSMAKLVTK--------YPNLTVLQTLSKSFGLAG 238

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 68/155 (43%), Gaps = 9/155 (5%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIP 186
           Y  SQG P +   V ++  +    + A   D+  T G +SA    L +FCN    G  I 
Sbjct: 103 YGFSQGQPELMDFVREHTRRLHRMQYA-DWDVLATVGNTSAWESTLRVFCN---RGDTIL 158

Query: 187 IPQYPLYTATITLVGATAISYY---LNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIIN 243
             +Y  +++++    A  +  Y   L+E         E+ +  +       +P  +  + 
Sbjct: 159 AEEY-TFSSSLVAAEAQGVRAYPVPLDENGMVPERLGELLDNWERWHDGVPRPKLLYTVP 217

Query: 244 PG-NPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
            G NPTG+ L+      + R++ ++ LLI+ DE Y
Sbjct: 218 TGQNPTGTCLSNDRRQAVYRLAQQHDLLIVEDEPY 252

>AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL202W (ARO8)
          Length = 512

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 82/196 (41%), Gaps = 27/196 (13%)

Query: 157 DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWS 216
           D+ +T G++ A    + +FCN   + V+        Y++++    A  +     E D+  
Sbjct: 127 DVLVTAGSTQAWDATMRLFCNEGDSVVMEAF----TYSSSVEAAEAQGLYCVGMEVDSEG 182

Query: 217 VNTVEMENTIQE--SIKSG-IKPTTIVIINPG-NPTGSILTEKDIANIIRISAKYGLLII 272
           +    +   + E  +  +G  +P  +  I  G NP GS L +   A I R++ +Y +LI+
Sbjct: 183 IVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIV 242

Query: 273 ADEVY---QENVFSG------NEFHSVKKVLR--------KLQRKYLGFYETVQLASLHS 315
            D+ Y   Q + +          +   +  LR         L R +L +    ++  L S
Sbjct: 243 EDDPYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTDGRVVRLES 302

Query: 316 TSKGLIGECGQRGGYM 331
           TSK     C  R G++
Sbjct: 303 TSKVFAPGC--RTGWI 316

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 64/124 (51%), Gaps = 9/124 (7%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDN- 214
           +++ L  G+  ++  ++   C      +LI  P Y +Y+    +     I   L  EDN 
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDNS 147

Query: 215 WSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIA- 273
           + +NT ++  T+Q    S IK     + +PGNPTG+++   DIA+I +I +++   I+A 
Sbjct: 148 FQMNTDKVIETLQGD--SNIK--IAFVTSPGNPTGALI---DIASIEKILSQWQSGIVAI 200

Query: 274 DEVY 277
           DE Y
Sbjct: 201 DEAY 204

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 73/153 (47%), Gaps = 8/153 (5%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPE-DIFLTTGASSAVSFILPMFCNGPTTGVLI 185
           Y  +QG P I + + ++   +   E  Y + D  LTTG ++     L +FCN    G +I
Sbjct: 103 YGATQGQPEILEFLREH--NKLVHEFNYSDWDSILTTGNTNGWESTLRIFCN---KGDVI 157

Query: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245
            + +   +++++    A  +  +    D+  +   ++E+ +        KP  +  I  G
Sbjct: 158 -LAEAHSFSSSLASAEAQGVITFPVPIDSDGIIPEKLESILDNWTPGSPKPKLLYTIPTG 216

Query: 246 -NPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
            NPTGS L+++    I +I+ K+  +II DE Y
Sbjct: 217 QNPTGSSLSDERKEAIYKIACKHDFIIIEDEPY 249

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 79/175 (45%), Gaps = 23/175 (13%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNW 215
           +++ L  G+   +  ++   C      +++  P Y +Y+    +     ++  L  EDN 
Sbjct: 85  KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNS 144

Query: 216 SVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADE 275
               ++++ T+ E++K       + I +PGNPTG I+  KDI  ++    K GL+++ DE
Sbjct: 145 F--QMDVKRTL-ETLKKDDLIRLLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV-DE 199

Query: 276 VYQENVFS--------GNEFHSVKKVLRKLQRKYLGFYETVQLASLHSTSKGLIG 322
            Y +  FS          E+ SV K++ K        Y  + +    S S GL G
Sbjct: 200 AYVD--FSTYFNEETKKTEYFSVAKLVTK--------YPNLTVLQTLSKSFGLAG 244

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 69/155 (44%), Gaps = 12/155 (7%)

Query: 127 YSLSQGVPGIQQTVADY---ITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGV 183
           Y  SQG P +   + D+   I K    +     D+  TTG ++A    L +FC+    G 
Sbjct: 103 YGFSQGQPELMDYLRDHTNIIHKMQYSDW----DVVATTGNTNAWESTLRVFCD---KGD 155

Query: 184 LIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIIN 243
           +I + +   +++ +    A  I  +    D   +   ++E  +    +   KP  +  I 
Sbjct: 156 VI-LAEAHSFSSCLAAAQAQGIITFPIPIDEHGIIPEKLEQILDNWTEGAPKPKLLYTIP 214

Query: 244 PG-NPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
            G NPTGS L++     I +++ K+  +II DE Y
Sbjct: 215 TGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDEPY 249

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 77/189 (40%), Gaps = 25/189 (13%)

Query: 157 DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWS 216
           DI  TTG++ A    L +FCN   T +L        Y++++    A  ++      DN  
Sbjct: 133 DIITTTGSTQAWDASLRIFCNKGDTVLLEEF----TYSSSVEAADAQGLNCIPVPMDNQG 188

Query: 217 VNTVEMENTIQESIKS--GIK-PTTIVIINPG-NPTGSILTEKDIANIIRISAKYGLLII 272
           +   ++E  +        GI  P  +  I  G NPTG  L+E     I R++ KY +LI+
Sbjct: 189 IIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIV 248

Query: 273 ADEVY-----------------QENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLASLHS 315
            D+ Y                 ++++ +     +  + ++ L R +L      ++  L S
Sbjct: 249 EDDPYYFLQMGTYVSPDKRETDEQDIVTQELKQNHGEFVKSLSRSFLDLDRDGRVVRLDS 308

Query: 316 TSKGLIGEC 324
            SK     C
Sbjct: 309 MSKTFAPGC 317

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 69/153 (45%), Gaps = 8/153 (5%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPE-DIFLTTGASSAVSFILPMFCNGPTTGVLI 185
           Y  SQG P +   + ++   +   ++ Y + DI  T G ++A    L +FCN    G +I
Sbjct: 104 YGFSQGQPELLDFLREHT--KLIHDIKYQDWDIIATAGNTNAWESTLRVFCN---RGDVI 158

Query: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245
            + +   +++ +    A  I+ +    D+  +   ++E  +        KP  +  I  G
Sbjct: 159 -LAEAHSFSSCLAAAQAQGITTFPIPIDDNGIIPEKLEKILDNWTPGAPKPKLLYTIPTG 217

Query: 246 -NPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
            NPTG+ L    +  I RI+ K+  LI+ D  Y
Sbjct: 218 QNPTGTSLPAHRMEEIYRIAQKHDFLIVEDAPY 250

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 75/163 (46%), Gaps = 13/163 (7%)

Query: 127 YSLSQGVPGIQQTVADYITKRD----SGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTG 182
           Y+ S+G P + + V D +++ +    S E+    D+ L+ G++ ++  +    C+  TT 
Sbjct: 102 YAESKGTPPLLRFVKDMVSRINRPVFSDEMQSNWDVILSGGSNDSMFKVFETICDESTT- 160

Query: 183 VLIPIPQYPLYTATITLVGATAISYYLN---EEDNWSVN----TVEMENTIQESIKSGIK 235
           VLI    +    + +   GA  +   +N   + D+  ++    T  ++N      K   K
Sbjct: 161 VLIEEFTFTPAMSNVEATGAKVVPIKINLTLDRDSQGIDVDHLTQLLDNWSTGPYKHLAK 220

Query: 236 PTTIVIINPG-NPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
           P  +  I  G NPTG  + +     I R++ K+  LI+ D+ Y
Sbjct: 221 PRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHDFLIVEDDPY 263

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 79/368 (21%), Positives = 155/368 (42%), Gaps = 48/368 (13%)

Query: 109 VVRRARKLLGEIGGSVGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAV 168
            VR A+K L E+  +   YS ++G P +   +    +      +  P ++ +TTGA+ A+
Sbjct: 75  AVREAQKAL-EVALN-NQYSPTKGRPSLINELIKLYSPFYKTRLG-PSNVQVTTGANEAI 131

Query: 169 -SFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLN---EEDNWSVNTVEMEN 224
            S ++ +   G    V++  P +  Y + I + G       L+   E +N   +  E   
Sbjct: 132 LSCLVGLLNQG--DEVIVFEPFFDQYISNIEIPGGKVTYVPLHPPKELENRVTHGTEWTV 189

Query: 225 TIQESIKSGIKPTTIVII--NPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVF 282
              E +++ I P T  +I   P NP G + T +++  I  I  +  ++II+DEVY E+++
Sbjct: 190 DYDE-LRAAITPKTKALILNTPHNPIGKVFTREELLEIGNICVENNVVIISDEVY-EHLY 247

Query: 283 SGNEFHSVKKVLRKLQRKYLGFYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRL 342
             +EF  +  +             + ++ +L + S G  G+     G+   IG       
Sbjct: 248 FTSEFTRIATL-------------SPEIGNL-TLSVGSAGKTFAATGWR--IGWIVSQNA 291

Query: 343 EVVKLMSISICSVVTGQALIDMVVSPPRPGDESYEMD---QLERN---NIKNDLISRSQK 396
           E++K  S+         A   +  + P P  E+        L+ N    ++ + I++   
Sbjct: 292 ELLKYASM---------AHTRICFASPSPFQEACAKSIEIALQNNYFEKMRQEYINKFDI 342

Query: 397 LHQLFISLEGVECLRPQGAMYL---FPKFIFPQKFIDIAQKLHTEADTLYCKELLEHTGI 453
             ++F  L G+   +P+G  ++   F K   P+ +    + L    D      L+   G+
Sbjct: 343 FTRVFDEL-GLPYTQPEGTYFVLVDFSKVKIPEDYPFPEELLSKAKDFRISYWLINELGV 401

Query: 454 CTVPGSGF 461
             +P + F
Sbjct: 402 VAIPPTEF 409

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 66/130 (50%), Gaps = 11/130 (8%)

Query: 157 DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWS 216
           D+ L  G+S ++ F L       TT VL+    +    + IT  GA+ +   LN   N S
Sbjct: 141 DLLLANGSSDSM-FKLFDTLTDETTTVLVEEFTFSPVLSNITATGASCVPLQLNFTSNPS 199

Query: 217 ---VNTVEMENTIQESIKSG-----IKPTTIVIINPG-NPTGSILTEKDIANIIRISAKY 267
              +N   +++ + E+ +SG      +P+ +  I+ G NPTG  ++ ++ A I +++ KY
Sbjct: 200 NQGINVTYLQHLL-ENWQSGPYKHLNRPSILYTISTGQNPTGLTISMENRARIYKLAQKY 258

Query: 268 GLLIIADEVY 277
             LI+ D+ Y
Sbjct: 259 NFLIVEDDPY 268

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 75/163 (46%), Gaps = 13/163 (7%)

Query: 127 YSLSQGVPGIQQTVADYITKRD----SGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTG 182
           Y+ ++G+P + Q   D + + +    S E     D+ L+ G++ ++  +   FC+  TT 
Sbjct: 150 YAETKGMPPLLQFTKDMVARINRPAFSDETDSNWDVILSGGSNDSMYKVFETFCDESTT- 208

Query: 183 VLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQ--ESIKSGI-----K 235
           V+I    +    + +   GAT +   +N   +    +V+++   Q  E+  +G      K
Sbjct: 209 VMIEEFTFTPAVSNVEATGATVVPIKINLSADRETQSVDVDYLSQLLENWSTGPYRHLNK 268

Query: 236 PTTIVIINPG-NPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
           P  +  I  G NPTG  + +     I  ++ ++  LI+ D+ Y
Sbjct: 269 PRVLYTIATGQNPTGMSVPQWKREKIYELAQRHDFLIVEDDPY 311

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 65/127 (51%), Gaps = 15/127 (11%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYT--ATITLVGATAISYYLNEED 213
           E+I L  G+  ++  ++ + C      ++I  P Y +Y+  A I  VG   +   + E++
Sbjct: 88  ENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVP-LVAEDN 146

Query: 214 NWSVNTVEMENTIQESIKSGIKPTT--IVIINPGNPTGSILTEKDIANIIRISAKY-GLL 270
           ++ ++T ++  T+ +       PT   I I +PGNPT +++   D A I ++   + G L
Sbjct: 147 SFQMDTSKVLETLAQD------PTIKLIFITSPGNPTAALI---DTAEIEKVLNNWTGGL 197

Query: 271 IIADEVY 277
           ++ DE Y
Sbjct: 198 VVVDEAY 204

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 66/163 (40%), Gaps = 26/163 (15%)

Query: 147 RDSGEVAYPEDIFLTTGASSAVSFIL---PMFCNGPTTGVLIPIPQYPLYTATITLVGAT 203
           RD    + PE + L++GAS  V  IL    +   G T    I  P Y L        G  
Sbjct: 77  RDDKARSRPEFLNLSSGASYGVLSILLQATLAHTGYTRQAFIVSPTYFLINDCFIDAGFG 136

Query: 204 AISYYLNEEDNWSVNTVEMENTIQE------------SIKSGIKPTTIV----------- 240
           +    ++E+   S++   +E  +QE             +++   P   V           
Sbjct: 137 SKITAIDEDGQGSIDLALLERKLQEFEDKFTEEEDQEKLQAITDPAKAVPKKIYKYVIYC 196

Query: 241 IINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFS 283
           I    NPTG+  + +    +I I+ KY +LIIAD+VY    FS
Sbjct: 197 IPTYSNPTGTTYSTETKLKLIEIARKYDMLIIADDVYDMLDFS 239

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 85/202 (42%), Gaps = 32/202 (15%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFIL---PMFCNGPTTGV 183
           Y   +G   ++Q V + I +  S   + PE I LT+GAS  +  IL    +   G T   
Sbjct: 51  YGSDEGALWVRQEVCNMINQIGSDINSKPEYINLTSGASYGILNILLQTTLPHTGYTKQA 110

Query: 184 LIPIPQYPL---------YTATITLV---GATAISY-YLNEEDNW-----------SVNT 219
            I  P Y L         + + +T +   G T+I   YL E+  +           S + 
Sbjct: 111 FIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIPDVPQNSTDI 170

Query: 220 VEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQ- 278
           ++ +N +Q+ I    K     I    NP+G     +    +I+I+ KY +LII D+VY  
Sbjct: 171 IQNKNNLQKKI---YKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVYDL 227

Query: 279 -ENVFSGNEFHSVKKVLRKLQR 299
            +  F  N   +V   L  L R
Sbjct: 228 LDYNFDSNATSNVAPRLVHLDR 249

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 58/125 (46%), Gaps = 11/125 (8%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDN- 214
           E++ L  G+  ++  I+   C      +L+  P Y +Y+    +     +   L   DN 
Sbjct: 87  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSDNS 146

Query: 215 WSVNTVEMENTIQE--SIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLII 272
           +  NT E+  T Q   SIK       I I +PGNPTG+ +    I  I++ +   G++++
Sbjct: 147 FQANTDEVIKTAQNDPSIK------LIFITSPGNPTGAKVETSRIEKILQ-NWDRGMVVV 199

Query: 273 ADEVY 277
            DE Y
Sbjct: 200 -DEAY 203

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 79/186 (42%), Gaps = 17/186 (9%)

Query: 157 DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWS 216
           D+  T G + +    L +FCN    G  I   +Y  +++++    A  ++ +    D   
Sbjct: 135 DVLATIGNTGSWESTLRIFCN---RGDTILAEKY-TFSSSVYAAEAQGVNVFPVPLDADG 190

Query: 217 VNTVEMENTIQESIKSGIKPTTIVIINPG-NPTGSILTEKDIANIIRISAKYGLLIIADE 275
           +    +E  +        KP  +  I  G NPTGS L++     I RI+ K+  +II DE
Sbjct: 191 LIPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIEDE 250

Query: 276 VY---QENVFSGN-------EFHSVKKVLRKLQRKYLGFYETVQLASLHSTSKGLIGECG 325
            Y   Q + +  +       EF S  + +  L + ++      ++  + S SK L    G
Sbjct: 251 PYYFLQMDAYEKDPSKRKAIEFASHDEFVNSLAKSFISLDTEGRVIRMDSFSKVL--GPG 308

Query: 326 QRGGYM 331
            R G++
Sbjct: 309 TRLGWL 314

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 37.7 bits (86), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 62/132 (46%), Gaps = 11/132 (8%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDN- 214
           E++ L  G+   +  ++   C      +LI  P Y +Y+    +     +   L  EDN 
Sbjct: 88  ENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVEDNS 147

Query: 215 WSVNTVEMENTIQE--SIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLII 272
           + ++T ++  T+Q   SIK       + I +PGNPTG+++  ++I  +  +S      ++
Sbjct: 148 FQMDTEKVIETLQNDPSIK------LVFITSPGNPTGALIKPENIEKL--LSQWQSGFVV 199

Query: 273 ADEVYQENVFSG 284
            DE Y +   +G
Sbjct: 200 VDEAYIDFCTTG 211

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 68/153 (44%), Gaps = 8/153 (5%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPE-DIFLTTGASSAVSFILPMFCNGPTTGVLI 185
           Y  S G P +   + D+   +   ++ Y + D+  T G ++A    L +FCN    G +I
Sbjct: 105 YGFSAGQPELLNFIRDHT--KIIHDLKYKDWDVLATAGNTNAWESTLRVFCN---RGDVI 159

Query: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245
            +  +  +++++    A  +  +    D   +   ++   ++       KP  +  I  G
Sbjct: 160 LVEAHS-FSSSLASAEAQGVITFPVPIDADGIIPEKLAKVMENWTPGAPKPKLLYTIPTG 218

Query: 246 -NPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
            NPTG+ + +     I +I+ KY  LI+ DE Y
Sbjct: 219 QNPTGTSIADHRKEAIYKIAQKYDFLIVEDEPY 251

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 37.0 bits (84), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 59/123 (47%), Gaps = 7/123 (5%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDN- 214
           E++ L  G+  ++  I+   C      +L+  P Y +Y+    +     +   L  EDN 
Sbjct: 88  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNS 147

Query: 215 WSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIAD 274
           + +N+    + + + +K+      + I +PGNPTG  +  K I  +++ +   GL+++ D
Sbjct: 148 FQLNS----DKVLDILKNDPLIKLVFITSPGNPTGVKIETKRIEKVLQ-NWDNGLVVV-D 201

Query: 275 EVY 277
           E Y
Sbjct: 202 EAY 204

>Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON}
           YFR055W (REAL)
          Length = 401

 Score = 37.0 bits (84), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 6/91 (6%)

Query: 215 WSVNTVEMENTIQESIKSGIKPTTIVII--NPGNPTGSILTEKDIANIIRISAKYGLLII 272
           + + T   + ++ E IK  IKP T VI   +PG+ T  I   +DI  ++ ++ K+G+  I
Sbjct: 126 FGIETEYYDPSVGEDIKKLIKPNTTVIFLESPGSGTMEI---QDIPALVSVAKKHGIKTI 182

Query: 273 ADEVYQENVFSGNEFHSVKKVLRKLQRKYLG 303
            D  +   +F     H +   L     KYLG
Sbjct: 183 LDNTWATPLFFDAHGHGIDISLEA-GTKYLG 212

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 37.0 bits (84), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 77/199 (38%), Gaps = 30/199 (15%)

Query: 157 DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWS 216
           DI  TTG++      L +FCN   T VL+    Y          G   I   L+ E    
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDT-VLLEEYTYSSSVEAADAQGLNCIPMPLDGEGIIP 190

Query: 217 VNTVEMENTIQESIKSGIKPTTIVIINPG-NPTGSILTEKDIANIIRISAKYGLLIIADE 275
               EM     +       P  +  I  G NPTG  L++     I  ++ KY ++II DE
Sbjct: 191 EKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDE 250

Query: 276 VY---QENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLASLHSTSKGLIGECGQRGGYME 332
            Y   Q + +   E        R+L+          Q AS   T    IG  G+   ++E
Sbjct: 251 PYYFLQMDQYEPEE--------RRLE----------QPASRAMTHAEFIGSLGK--SFLE 290

Query: 333 LIGLTDDVRLEVVKLMSIS 351
           L     DV   VV+L S+S
Sbjct: 291 L-----DVEGRVVRLDSVS 304

>Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)
          Length = 401

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 6/100 (6%)

Query: 214 NWSVNTVEMENTIQESIKSGIKPTTIVII--NPGNPTGSILTEKDIANIIRISAKYGLLI 271
            + + T   + T+ E I+  +KP T VI   +PG+ T  I   +DI  ++ I+ K+G+  
Sbjct: 125 KFGIQTEYYDPTVGEDIEKLVKPNTSVIFLESPGSGTMEI---QDIPALVSIAKKHGIRT 181

Query: 272 IADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLA 311
           I D  +   +F     H +   L     KYLG +    L 
Sbjct: 182 ILDNTWATPLFFDAHGHGIDISLEA-GTKYLGGHSDFLLG 220

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 82/189 (43%), Gaps = 20/189 (10%)

Query: 157 DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWS 216
           ++  TTG ++A    L +FCN    G +I + +   ++++++   A  +  +    D   
Sbjct: 131 NVVATTGNTNAWESTLRVFCN---RGDVI-LAEAHSFSSSLSSAEAQGVIVFPIPIDADG 186

Query: 217 VNTVEMENTIQESIKSGIKPTTIVIINPG-NPTGSILTEKDIANIIRISAKYGLLIIADE 275
           +   ++E  + E      +P  +  I  G NPTG+ L +     I RI+ K+  LII DE
Sbjct: 187 IIPEKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDE 246

Query: 276 VYQ--------ENVFSGNEFHSVKK-----VLRKLQRKYLGFYETVQLASLHSTSKGLIG 322
            Y         E+V    E  +  K      L+ L R +L      ++  + S SK L  
Sbjct: 247 PYYFLQMDPYVEDVGKREELRNKPKQTHDEFLKSLARTFLSVDTEGRVIRMDSFSKVL-- 304

Query: 323 ECGQRGGYM 331
             G R G++
Sbjct: 305 APGTRLGWL 313

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 59/123 (47%), Gaps = 7/123 (5%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNW 215
           ++I L  G+   V  ++   C   T  VL+  P Y +Y+    +     +   L  ED  
Sbjct: 88  KNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLITED-- 145

Query: 216 SVNTVEME-NTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIAD 274
             N+ +M+ + + E++ +      + I  PGNPTG+ ++ + I  ++  +   G++++ D
Sbjct: 146 --NSFDMDLDNVLETLSNDDSIKLLFITTPGNPTGASISTQKIEMLLN-NWSAGIVVV-D 201

Query: 275 EVY 277
           E Y
Sbjct: 202 EAY 204

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 69/154 (44%), Gaps = 8/154 (5%)

Query: 128 SLSQGVPGIQQTVADYITKRDS--GEVAYPE-DIFLTTGASSAVSFILPMFCNGPTTGVL 184
           +L  G  G Q  + D++ +      ++ Y + D+F T G ++A    L +FCN    G +
Sbjct: 102 ALQYGHSGGQPELLDFLREHTKIIHDLKYKDWDVFATAGNTNAWESTLRLFCN---RGDV 158

Query: 185 IPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINP 244
           I + +   +++++    A  +  +    D   +   ++   +     +  KP  +  I  
Sbjct: 159 I-LAEAHSFSSSLASAEAQGVITFPVPIDADGIIPEKLAKIMDNWTPNAPKPKLLYTIPT 217

Query: 245 G-NPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
           G NPTG+ +       I +I+ K+  LI+ DE Y
Sbjct: 218 GQNPTGTSIANHRKEAIYKIAQKHDFLIVEDEPY 251

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 67/152 (44%), Gaps = 6/152 (3%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIP 186
           Y  S G P +   +  + T+    + A  E +  + G ++A    L +FC+    G ++ 
Sbjct: 102 YGHSNGQPELLDFLRGHTTEIHDMKYADWE-VIASVGNTNAWESTLRIFCD---RGDVVL 157

Query: 187 IPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG- 245
             +Y  +++ +    A  ++      D + +   ++E+ +     +  KP  +  I  G 
Sbjct: 158 FEEYS-FSSCLAACEAQGVTTIPIPIDAFGIVPEKLEDLLDNWTPNAPKPKLLYTIPTGQ 216

Query: 246 NPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
           NPTG+ L       I RI+ K+  LI+ DE Y
Sbjct: 217 NPTGTSLPNDRREAIYRIAQKHDFLIVEDEPY 248

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 13/132 (9%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDN- 214
           E+  L  G+  ++  I+   C      +L+  P Y +Y+    +     ++  L  EDN 
Sbjct: 87  ENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITEDNS 146

Query: 215 WSVNTVEMENTIQES--IKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLII 272
           + ++  E+ N +     IK       + I +PGNPTG+ +    I  +++ +   GL+I+
Sbjct: 147 FQIDATEILNILANDPLIK------LVFITSPGNPTGAKIEIDRIEYLLK-NWDQGLVIV 199

Query: 273 ADEVYQENVFSG 284
            DE Y +  FSG
Sbjct: 200 -DEAYID--FSG 208

>TDEL0F00900 Chr6 complement(153488..154969) [1482 bp, 493 aa] {ON}
           Anc_2.102 YHR137W
          Length = 493

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 65/150 (43%), Gaps = 29/150 (19%)

Query: 153 AYPE-DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATA------- 204
           AY E D+ L+ G+S ++  I   FC+  TT ++      P+  + +   GAT        
Sbjct: 114 AYDEWDVLLSNGSSDSMFKIFETFCDESTTVLMEEFTFSPV-ISNVQNTGATCVPIKMEL 172

Query: 205 ----------ISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG-NPTGSILT 253
                     I+Y  +  +NW+  T+   + +        KP  I  I  G NPTG  L+
Sbjct: 173 TTDPAKQGIDIAYLTHLLENWT--TIPQYSHLN-------KPKMIYTIATGQNPTGMTLS 223

Query: 254 EKDIANIIRISAKYGLLIIADEVYQENVFS 283
            +    I  ++ K+ LLI+ D+ Y    FS
Sbjct: 224 MEKRRQIYALAQKHDLLILEDDPYGYLRFS 253

>YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromatic
           aminotransferase II, catalyzes the first step of
           tryptophan, phenylalanine, and tyrosine catabolism
          Length = 513

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 75/163 (46%), Gaps = 13/163 (7%)

Query: 127 YSLSQGVPGIQQTVADYITKRD----SGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTG 182
           Y+ ++G+P +   V D++++ +    S E     D+ L+ G++ ++  +    C+  TT 
Sbjct: 102 YAETKGLPPLLHFVKDFVSRINRPAFSDETESNWDVILSGGSNDSMFKVFETICDESTT- 160

Query: 183 VLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQ--ESIKSGI-----K 235
           V+I    +    + +   GA  I   +N   +     +++E   Q  ++  +G      K
Sbjct: 161 VMIEEFTFTPAMSNVEATGAKVIPIKMNLTFDRESQGIDVEYLTQLLDNWSTGPYKDLNK 220

Query: 236 PTTIVIINPG-NPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
           P  +  I  G NPTG  + +     I +++ ++  LI+ D+ Y
Sbjct: 221 PRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPY 263

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 49/122 (40%), Gaps = 2/122 (1%)

Query: 157 DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWS 216
           DI  TTG++      L +FCN   T VL+    Y          G   +   L+ E    
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDT-VLLEDYTYSSSVEAADAQGLNCVPMPLDGEGIVP 190

Query: 217 VNTVEMENTIQESIKSGIKPTTIVIINPG-NPTGSILTEKDIANIIRISAKYGLLIIADE 275
               EM             P  +  I  G NPTG  L++    +I R++ +Y ++II D+
Sbjct: 191 SKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIIIEDD 250

Query: 276 VY 277
            Y
Sbjct: 251 PY 252

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 58/125 (46%), Gaps = 8/125 (6%)

Query: 157 DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWS 216
           D+ +T G++ A    L +FCN P   VL+   +   Y++++    A  +     E D   
Sbjct: 129 DVLITAGSTQAWDASLRLFCN-PGDSVLL---ESWTYSSSVEAAEAQGMYCVGVEIDGHG 184

Query: 217 VNTVEMENTIQ--ESIKSGIK-PTTIVIINPG-NPTGSILTEKDIANIIRISAKYGLLII 272
           V   ++E  +Q  + +  G   P  + +I  G NP G  L ++    I  I  KY +++I
Sbjct: 185 VVPEKLEWLLQNWDDLHPGRSLPKLLYVIPTGQNPMGVTLADERKPLIYNIIQKYDMVLI 244

Query: 273 ADEVY 277
            D+ Y
Sbjct: 245 EDDPY 249

>YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}
           IRC7Beta-lyase involved in the production of thiols;
           null mutant displays increased levels of spontaneous
           Rad52p foci; expression induced by nitrogen limitation
           in a GLN3, GAT1-dependent manner and by copper levels in
           a Mac1-dependent manner
          Length = 340

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 81/180 (45%), Gaps = 20/180 (11%)

Query: 216 SVNTVEMENTIQESIKSGIKPTTIVII--NPGNPTGSILTEKDIANIIRISAKYGLLIIA 273
            V T   + +I + I+  +KP T VI   +PG+ T  +   +DI  ++ ++ K+G+  I 
Sbjct: 126 GVETDYYDPSIGKDIEKLVKPNTTVIFLESPGSGTMEV---QDIPALVSVAKKHGIKTIL 182

Query: 274 DEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET--VQLAS--------LHSTSKGLIGE 323
           D  +   +F     H +  +  +   KYLG +    + LAS        L ST   +   
Sbjct: 183 DNTWATPLFFDAHAHGI-DISVEAGTKYLGGHSDLLIGLASANEECWPLLRSTYDAMAML 241

Query: 324 CGQRGGYMELIGL-TDDVRLEVVKLMSISICSVVTGQALIDMVVSPPR---PGDESYEMD 379
            G     + L G+ T  +RL+ V+  ++ + + +  +  ++ V+ P     PG E +  D
Sbjct: 242 PGAEDCQLALRGMRTLHLRLKEVERKALDLAAWLGNRDEVEKVLHPAFEDCPGHEYWVRD 301

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 57/123 (46%), Gaps = 7/123 (5%)

Query: 157 DIFLTTGASSAVSFILPMFCN-GPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNW 215
           ++ +T G +SA    L +FCN G T      + +   ++++++   A  I  +    D+ 
Sbjct: 132 ELLVTAGNTSAWESTLRIFCNRGDTI-----LAEAHSFSSSLSAAQAQGIITFPVPIDDK 186

Query: 216 SVNTVEMENTIQESIKSGIKPTTIVIINPG-NPTGSILTEKDIANIIRISAKYGLLIIAD 274
            +   ++   +        KP  +  I  G NPTGS L  +  + + +I+ K+  LI+ D
Sbjct: 187 GIIPEKLAAIMDNWNPETPKPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVED 246

Query: 275 EVY 277
           E Y
Sbjct: 247 EPY 249

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 59/122 (48%), Gaps = 7/122 (5%)

Query: 157 DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWS 216
           +I L  G+  ++  I+   C      +L+  P Y +Y+    +     ++  L  ED   
Sbjct: 89  NICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITED--- 145

Query: 217 VNTVEME-NTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADE 275
            N+ +M+ + + + + +  +   + I +PGNPTG+ +    I  +++ +   GL+++ DE
Sbjct: 146 -NSFQMDSDKVLDILNNDQEIKLLFITSPGNPTGAQIETARIEKVLQ-NWDRGLVVV-DE 202

Query: 276 VY 277
            Y
Sbjct: 203 AY 204

>Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W
           (REAL)
          Length = 401

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 6/99 (6%)

Query: 215 WSVNTVEMENTIQESIKSGIKPTTIVII--NPGNPTGSILTEKDIANIIRISAKYGLLII 272
           + + T   + +I E I+  +KP T VI   +PG+ T  I   ++I  ++ ++ K+G+  I
Sbjct: 126 FGIETEYYDPSIGEDIEKLVKPNTTVIFLESPGSGTMEI---QNIPALVSVAKKHGIKTI 182

Query: 273 ADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETVQLA 311
            D  +   +F     H +   L     KYLG +  + L 
Sbjct: 183 LDNTWATPLFFDAHGHGIDISLEA-GTKYLGGHSDLLLG 220

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 72/182 (39%), Gaps = 31/182 (17%)

Query: 127 YSLSQGVPGIQQTVADYITKR-----DSGEVAYPEDIFLTTGASSAVSFIL---PMFCNG 178
           Y    G   ++  +A++  K       S     P+ + LT+GAS  +  IL    +   G
Sbjct: 49  YGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNILVQTTLPHTG 108

Query: 179 PTTGVLIPIPQYPLYTATITLVGATA-ISYYLNEEDNWSVNTVEMENTIQESIKSGIKPT 237
            T    I  P Y L        G T  I+    + D   +  +E +  + E+  +G +  
Sbjct: 109 YTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKLFENSANGEREQ 168

Query: 238 ----TIVIINP------------------GNPTGSILTEKDIANIIRISAKYGLLIIADE 275
               ++ IIN                    NPTG+I +      ++ ++ KY +LII+D+
Sbjct: 169 KTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDD 228

Query: 276 VY 277
           VY
Sbjct: 229 VY 230

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 70/182 (38%), Gaps = 31/182 (17%)

Query: 127 YSLSQGVPGIQQTVADYITKR-----DSGEVAYPEDIFLTTGASSAVSFIL---PMFCNG 178
           Y    G   ++  +A++  +       S     PE + LT+GAS  +  IL    +   G
Sbjct: 48  YGSDNGSAWVRACIAEFSNRAFKLPVSSNAATRPEHLNLTSGASYGIMNILLQTTLPHTG 107

Query: 179 PTTGVLIPIPQYPLYTATITLVGATA-ISYYLNEEDNWSVNTVEMENTIQESIKSG---- 233
            T    I  P Y L        G T  I+    + D   +  +E +    E+  +G    
Sbjct: 108 YTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKSCENSSNGESGQ 167

Query: 234 IKPTTIVIINP------------------GNPTGSILTEKDIANIIRISAKYGLLIIADE 275
               ++ IIN                    NPTG+I +      ++ ++ KY +LII+D+
Sbjct: 168 KAEESLRIINAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDD 227

Query: 276 VY 277
           VY
Sbjct: 228 VY 229

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 33.9 bits (76), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 68/153 (44%), Gaps = 8/153 (5%)

Query: 127 YSLSQGVPGIQQTVADYITKRDSGEVAYPE-DIFLTTGASSAVSFILPMFCNGPTTGVLI 185
           Y  S G P + + + ++   +   ++ Y + D+  T G ++A    L +FCN    G +I
Sbjct: 105 YGFSAGQPELLEFIREHT--KLIHDIKYKDWDVVATAGNTNAWESTLRVFCN---RGDVI 159

Query: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245
            + +   +++++    A  I  +    D   +   ++   +        KP  +  I  G
Sbjct: 160 -LAEAHSFSSSLAAAEAQGIIAFPVPIDADGIIPEKLAKIMDNWTPGAPKPKLLYTIPTG 218

Query: 246 -NPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
            NPTG+ + +     I +I+ K+  LI+ DE Y
Sbjct: 219 QNPTGTSIADHRKEAIYKIAQKHDFLIVEDEPY 251

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 61/124 (49%), Gaps = 9/124 (7%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLY--TATITLVGATAISYYLNEED 213
           ++I L  G+  ++  I+   C+     V++  P Y +Y   A I  VG   +   ++ ++
Sbjct: 88  KNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVGYVEVPL-ISSDN 146

Query: 214 NWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIA 273
           ++ ++    E+ I E +        + I +PGNPTG+ +    +  ++R +   G++++ 
Sbjct: 147 SFQID----EDRILEQLNLDKSIKVVFITSPGNPTGACIEVGRVEKLLR-NWTAGIVVV- 200

Query: 274 DEVY 277
           DE Y
Sbjct: 201 DEAY 204

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 55/139 (39%), Gaps = 29/139 (20%)

Query: 157 DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEE---- 212
           ++ +  G+S A+  +  + C+  +T +L      P+  + I L GA+ +   +       
Sbjct: 123 NVCMANGSSDAMYKVFEVLCDEDSTVMLEEFTFSPV-ISNIKLQGASVVPVKMQLSADPE 181

Query: 213 -------------DNWSVNTVEMENTIQESIKSGIKPTTIVIINPG-NPTGSILTEKDIA 258
                        DNWSV   +  N          KP  +  +  G NPTG  L+     
Sbjct: 182 QQGIDVDRLADLLDNWSVGPYKHLN----------KPKALYTVATGQNPTGMTLSPTKRR 231

Query: 259 NIIRISAKYGLLIIADEVY 277
            I  I+ K+  LI+ D+ Y
Sbjct: 232 RIYEIAQKHDFLIVEDDPY 250

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 86/220 (39%), Gaps = 37/220 (16%)

Query: 83  ILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYSLSQGVPGIQQTVAD 142
           +L   +I+E   +L T  E R Y  D   R R  L         Y   +G   ++Q + D
Sbjct: 20  LLPNEEIVEATRQLLT-SETRDYDDDT--RNRHPL--------TYGPDEGALWVRQQICD 68

Query: 143 YITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTG----VLIPIPQYPLYTATIT 198
           +   R  G  + PE + L++G+S     +L +    P T       I  P Y L      
Sbjct: 69  F-NNRLFGSDSKPEFLNLSSGSSYGCLSVL-LHTTLPHTNFTRQAFIISPTYFLINDCFI 126

Query: 199 LVGATAISYYLNEEDNWSVNTVEMENTIQ--ESIKSGIKPTTIVIINP------------ 244
             G  +    ++EE   S+N  ++ + ++  E +         +I NP            
Sbjct: 127 DAGFGSKLTAIDEEGEDSINFEQLLSKLRHFEELYGNSNGDVSIIQNPNKPTKKVYKYVM 186

Query: 245 ------GNPTGSILTEKDIANIIRISAKYGLLIIADEVYQ 278
                  NP+G   + +    +I I+ +Y +LII D+VY 
Sbjct: 187 YCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVYD 226

>KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 688

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 43/83 (51%), Gaps = 9/83 (10%)

Query: 193 YTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSIL 252
           YT T++++     +++L + D+ ++N       ++E +  G +   + I +P NP   +L
Sbjct: 391 YTDTLSILRKFNHTHFLGQGDSQAMNE------LKEILHGGEQILAVFIESPSNP---LL 441

Query: 253 TEKDIANIIRISAKYGLLIIADE 275
              D+  + R+S  YG  I+ DE
Sbjct: 442 KMGDLVELKRLSDLYGFYIVIDE 464

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 73/188 (38%), Gaps = 37/188 (19%)

Query: 127 YSLSQGVPGIQQTVADYITK------RDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPT 180
           Y  ++G   ++  + +++ +      RD    + PE + LT+GAS  V  IL +    P 
Sbjct: 51  YGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGVLNIL-LQATLPH 109

Query: 181 TGV----LIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEME-----------NT 225
           TGV     I  P Y L        G       ++E+   S++   +E           N 
Sbjct: 110 TGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESIDPNP 169

Query: 226 IQES---------------IKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLL 270
           + E+               +K   K    VI    NP+G     +    +I ++ KY +L
Sbjct: 170 VNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYDML 229

Query: 271 IIADEVYQ 278
           II D+VY 
Sbjct: 230 IITDDVYD 237

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 69/147 (46%), Gaps = 14/147 (9%)

Query: 137 QQTVADYITKRDSGEVAYP---EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLY 193
           +  +A+Y  +  S +   P   E++ L  G+  ++  I+   C      ++   P Y +Y
Sbjct: 63  KTAMANYRNRTSSFKDITPLTAENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMY 122

Query: 194 TATITLVGATAISYYLNEEDN-WSVNTVEMENTIQES--IKSGIKPTTIVIINPGNPTGS 250
           +   ++     +   L   DN + V+T  + +T+++   IK       + I +PGNPTG+
Sbjct: 123 SVCASVNDVEIVKCPLVTSDNSFQVDTEAVLDTLKKDPLIK------LVFITSPGNPTGA 176

Query: 251 ILTEKDIANIIRISAKYGLLIIADEVY 277
            +    I  I++ +   G+L++ DE Y
Sbjct: 177 KIETSRIEKILQ-NWDQGILVV-DEAY 201

>Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W
           (REAL)
          Length = 513

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 70/173 (40%), Gaps = 33/173 (19%)

Query: 127 YSLSQGVPGIQQTVADYITKRD----SGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTG 182
           Y+ ++G+P +   V D + + +    S E     D+ L+ G++ ++  +    C+  TT 
Sbjct: 102 YAETKGLPPLLHFVKDMVCRINRPVFSDETESNWDVILSGGSNDSMFKVFETICDESTT- 160

Query: 183 VLIPIPQYPLYTATITLVGATAISYYLN------------EE-----DNWSVNTVEMENT 225
           V+I    +    + +   GA  I   ++            E+     DNWS    +  N 
Sbjct: 161 VMIEEFTFTPAMSNVEATGAKVIPIKMDLTFDRERQGIDVEDLTRLLDNWSTGPYKHLN- 219

Query: 226 IQESIKSGIKPTTIVIINPG-NPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
                    KP  +  I  G NPTG  +       I +++ K+  LI+ D+ Y
Sbjct: 220 ---------KPKVLYTIATGQNPTGMSVPRWKREKIYQLAQKHDFLIVEDDPY 263

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 71/181 (39%), Gaps = 30/181 (16%)

Query: 127 YSLSQGVPGIQQTVADYITKR------DSGEVAYPEDIFLTTGASSAVSFILPMFCNGP- 179
           Y  ++G   ++ T+  +  +       + G  + PE + LT+GAS  V  IL + C  P 
Sbjct: 53  YGSNEGAHWVRSTICKFNNEEIFKFGENYGARSAPECLNLTSGASYGVLNIL-LQCTLPH 111

Query: 180 ---TTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQE--SIKSGI 234
              T    I  P Y L        G       +NE    S++   +E+ + E  SIK+ +
Sbjct: 112 NNYTRQAFIISPTYFLINDCFIDAGFHGKLTAINEMGTDSIDFDTLESNLAELDSIKADV 171

Query: 235 KPTTIV-----------------IINPGNPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
               I                  +    NP+G   +      ++ ++ KY +LII D+VY
Sbjct: 172 GTQCITKNENSKGKKIYRYVLYCVPTYSNPSGHTYSLTTKLRLLELARKYDILIITDDVY 231

Query: 278 Q 278
            
Sbjct: 232 D 232

>Ecym_7108 Chr7 complement(209729..210580) [852 bp, 283 aa] {ON}
           similar to Ashbya gossypii AAL154C
          Length = 283

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 32  RGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQLGQKPLSFIRKVLSILQYPDILE 91
           RG IP   +E +L LEK    +    +++A   NP+   + P + I K L+ L++  ++ 
Sbjct: 120 RGEIPLSEKERQLMLEKLTNEIL--TMVSAKCINPKSKKRYPPTMINKALTELKFGIVVN 177

Query: 92  DESKLQTLIELRV 104
             +KLQ L  ++V
Sbjct: 178 KPAKLQALEAIKV 190

>NCAS0A10280 Chr1 complement(2049779..2050918) [1140 bp, 379 aa]
           {ON} Anc_3.228 YBR026C
          Length = 379

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 92/201 (45%), Gaps = 32/201 (15%)

Query: 131 QGV-PGIQQTVADYITKRDSGEVAYPEDIF----LTTGASSAV--SFILPMFCNGPT--- 180
           QGV P + +   DY TK  S  +A  E +F    +  G +  V   +++P+  N  T   
Sbjct: 69  QGVYPSLPEKTLDYSTKAPSA-IAGNEGVFEVVSIPEGETDLVQGDWVIPLEANQGTWSD 127

Query: 181 ------TGVLIPIPQYPLYT-ATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSG 233
                 +  LI +    LYT ATI++ G TA     N   NW V ++  E  +Q +  SG
Sbjct: 128 YRVFANSSDLIKVNDLDLYTAATISVNGCTAYQLVKNYV-NWDVQSLGNEWLVQNAGTSG 186

Query: 234 I-KPTTIVIINPGNPTGSILTEKDIANIIR--ISAKYGLLIIADEVYQENVFSGNEFHSV 290
           + K  + +    G  T S++ ++D  + +   +  KYG    A +V  E   +  +F+  
Sbjct: 187 VSKMVSQIAKANGIKTLSVIRDRDDFDEVASTLEKKYG----ATKVISETQNNDKQFN-- 240

Query: 291 KKVLRKLQRKYLGFYETVQLA 311
           K+ L K+    LG +  V+LA
Sbjct: 241 KEELPKI----LGSHARVRLA 257

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 55/122 (45%), Gaps = 5/122 (4%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNW 215
           +++ L  G+  ++  I+   C      +L+  P Y +Y+    +     +   L   DN 
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 216 SVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADE 275
                E   TI   +K+      I + +PGNPTG+ +    I  I++ + + GL+++ DE
Sbjct: 148 FQMDTEAALTI---LKNDPLIKLIFVTSPGNPTGAKIKTCLIEKILQ-NWENGLVVV-DE 202

Query: 276 VY 277
            Y
Sbjct: 203 AY 204

>ZYRO0B10516g Chr2 complement(829319..830050) [732 bp, 243 aa] {ON}
           highly similar to uniprot|Q07953 Saccharomyces
           cerevisiae YLR022C SDO1 Protein required for cell
           viability
          Length = 243

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 50/113 (44%), Gaps = 13/113 (11%)

Query: 43  KLQLEKDPKSLPFNKI-------INANIGNPQQLGQKPLSFIRKVLSILQYPDILEDESK 95
           ++QL +  + L  NKI       I+A   NP+   + P S I K L  L++  +L   +K
Sbjct: 92  EIQLSEKERQLEINKINNEMLTIISAKCINPKSKKRYPPSMIHKALVELKFSPVLNKPAK 151

Query: 96  LQTLIELRVYQKDV---VRRAR---KLLGEIGGSVGAYSLSQGVPGIQQTVAD 142
           LQ L  ++V  +     + RAR   K+            L   V G ++T +D
Sbjct: 152 LQALEAIKVLTRTQLIPITRARMKVKVTMNANKPETIEQLKNHVKGTEETSSD 204

>TDEL0A01940 Chr1 (355974..357236) [1263 bp, 420 aa] {ON} Anc_2.420
           YLR027C
          Length = 420

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 68/177 (38%), Gaps = 17/177 (9%)

Query: 110 VRRARKLLGEIGGSVGAYSLSQGVPGIQQTVADYITKRDS-----GEVAYPEDIFLTTGA 164
           VR A KL+ E       Y    G P +    A  +   DS     G +A  + +  T   
Sbjct: 53  VRSAEKLIHEDPNYNHEYLGINGSPELSSAAAKIVFGEDSKALQQGRIASVQSLSGTGAL 112

Query: 165 SSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMEN 224
             A  FI       P   + I  P +  + A     G    +Y   +    S  T++ME 
Sbjct: 113 HIAAKFISSFL---PGRSLYISEPTWANHNAIFKSQGVQTATYPYWQA---STKTLDMEG 166

Query: 225 TIQESIKSGIKPTTIVII---NPGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQ 278
            ++ +IK    PT  VI+      NPTG   T+   ++II   A    +++ D  YQ
Sbjct: 167 FLK-TIKDA--PTGSVILLHACAHNPTGLDPTQDQWSDIIDAVASKDHIVLFDSAYQ 220

>NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.227
           YDR091C
          Length = 608

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 13/61 (21%)

Query: 17  LKDLNSKIIKTQY------AVRGPIPARAEELKLQLEKDP-------KSLPFNKIINANI 63
           L+D    IIK QY      A++GP+    E LKL++EKD        K+L    ++N  I
Sbjct: 160 LEDNIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREI 219

Query: 64  G 64
           G
Sbjct: 220 G 220

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 245 GNPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
            NP+G   T +    +I I+ KY +LI+AD+VY
Sbjct: 204 ANPSGQTYTLETRRRLIEIARKYDMLILADDVY 236

>SAKL0H18612g Chr8 (1655787..1657124) [1338 bp, 445 aa] {ON} highly
           similar to gnl|GLV|KLLA0E00935g Kluyveromyces lactis
           KLLA0E00935g and similar to YER152C uniprot|P10356
           Saccharomyces cerevisiae YER152C Hypothetical ORF
          Length = 445

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 72/180 (40%), Gaps = 30/180 (16%)

Query: 127 YSLSQGVPGIQQTVADYITK----RDSGEVAYPEDIFLTTGASSAVSFIL---PMFCNGP 179
           Y   +G   ++Q + D+        DS + + PE I LT GAS  V  IL    +   G 
Sbjct: 51  YGSDEGALWVRQAICDFSNHVFGLSDSVK-SKPEFINLTGGASYGVMNILEQTTLAHTGY 109

Query: 180 TTGVLIPIPQYPLYTATITLVGATAISYYLNE-EDNWSVNTVEMENTIQESIKSGI---- 234
           T    I  P Y L   T    G       +NE  D+    T++ +    +SI  GI    
Sbjct: 110 TRQAFIVSPTYFLINETFIDAGFNGKLTAINELGDSIDFETLKSKLEHFDSIDDGIDHSK 169

Query: 235 ------KPTT---------IVIINP--GNPTGSILTEKDIANIIRISAKYGLLIIADEVY 277
                  P+T         ++   P   NP G     +    +I ++ K+ +LII+D+VY
Sbjct: 170 DLDLINSPSTAHPKKIYKYVLYFVPTYSNPGGKTYNLETRLKLIDLARKHDMLIISDDVY 229

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
           (REAL)
          Length = 623

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 243 NPGNPTGSILTEKD----IANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQ 298
           NP NP+GS+L E      ++N +   A   L    D++ +E   S  E ++ K  L+KL 
Sbjct: 213 NPNNPSGSLLNESTTELLLSNTVSKDAFGNLRRRVDKLQKELDMSKMESYATKVELQKLN 272

Query: 299 RKYLGFYETV 308
            KY    E++
Sbjct: 273 SKYNTVIESL 282

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
           response regulator and transcription factor; physically
           interacts with the Tup1-Cyc8 complex and recruits Tup1p
           to its targets; part of a branched two-component
           signaling system; required for optimal induction of
           heat-shock genes in response to oxidative stress;
           involved in osmoregulation
          Length = 622

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 243 NPGNPTGSILTEKD----IANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQ 298
           NP NP+GS+L E      ++N +   A   L    D++ +E   S  E ++ K  L+KL 
Sbjct: 213 NPNNPSGSLLNESTTELLLSNTVSKDAFGNLRRRVDKLQKELDMSKMESYATKVELQKLN 272

Query: 299 RKYLGFYETV 308
            KY    E++
Sbjct: 273 SKYNTVIESL 282

>YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON}
           STR2Cystathionine gamma-synthase, converts cysteine into
           cystathionine
          Length = 639

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 9/83 (10%)

Query: 193 YTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSIL 252
           YT T++++     +++L + D+ S+N       ++  + SG +   + I  P NP   +L
Sbjct: 347 YTDTLSILRKFNHTHFLGQGDSTSMNA------LKNILHSGEQILAVFIEAPSNP---LL 397

Query: 253 TEKDIANIIRISAKYGLLIIADE 275
              D+  + R+S  Y   I+ DE
Sbjct: 398 KMGDLQELKRLSDLYSFYIVVDE 420

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 53/122 (43%), Gaps = 5/122 (4%)

Query: 157 DIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWS 216
           D+  T G ++     L +FCN    G +I + +   +++++    A  +  +    D   
Sbjct: 134 DVLATAGNTNGWESTLRVFCN---RGDVI-LAEAHSFSSSLASAEAQGVITFPIPIDAGG 189

Query: 217 VNTVEMENTIQESIKSGIKPTTIVIINPG-NPTGSILTEKDIANIIRISAKYGLLIIADE 275
           +   ++   +        KP  +  I  G NPTG+ + +     I +I+ K+  +I+ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 276 VY 277
            Y
Sbjct: 250 PY 251

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query: 156 EDIFLTTGASSAVSFILPMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNW 215
           +++ L  G+  ++  I+   C      +L+  P Y +Y+    +     +   L   DN 
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSDNS 147

Query: 216 SVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSILTEKDIANIIRISAKYGLLIIADE 275
               VE   TI E+    IK   + + +PGNPTG+ +    I  +++ + + GL+++ DE
Sbjct: 148 FQMDVEAVLTILEN-DPLIK--LVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLVVV-DE 202

Query: 276 VY 277
            Y
Sbjct: 203 AY 204

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 57/139 (41%), Gaps = 21/139 (15%)

Query: 160 LTTGASSAVSFIL---PMFCNGPTTGVLIPIPQYPLYTATITLVGATAISYYLNEEDNWS 216
           L +GAS  +  IL    +  NG T    I  P Y L     T  G       +NE+ + S
Sbjct: 89  LNSGASYGMLNILLQTTLPHNGYTRQAFIITPTYFLINNCFTDAGFKGKMTAINEQGHDS 148

Query: 217 VNTVEMENTI-QESIKSGIKPTTIVIINP-----------------GNPTGSILTEKDIA 258
           ++   + + + Q   +     TT +I  P                  NP+G+  + +   
Sbjct: 149 IDFESLISALEQHEAEPQPHSTTEMIQGPKLTKKVYRYVMYCIPTFANPSGNTYSLETRR 208

Query: 259 NIIRISAKYGLLIIADEVY 277
            +I I+ KY +LII D+VY
Sbjct: 209 RLIDIARKYDMLIITDDVY 227

>SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]
           {ON} similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 673

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 43/83 (51%), Gaps = 9/83 (10%)

Query: 193 YTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPTGSIL 252
           YT T++++     +++L   D+ +++T      ++E + SG +   + +  P NP   +L
Sbjct: 379 YTDTLSILSKFNHTHFLGMGDSTAMDT------LKEILHSGEQILAVFMETPSNP---LL 429

Query: 253 TEKDIANIIRISAKYGLLIIADE 275
              D+  + R++  YG  ++ DE
Sbjct: 430 KMGDLLELKRLADIYGFYVVVDE 452

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,357,896
Number of extensions: 2355958
Number of successful extensions: 6721
Number of sequences better than 10.0: 159
Number of HSP's gapped: 6836
Number of HSP's successfully gapped: 159
Length of query: 498
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 384
Effective length of database: 40,409,475
Effective search space: 15517238400
Effective search space used: 15517238400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)