Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0A017908.264ON43943923100.0
NCAS0B050308.264ON4334499871e-130
Kpol_543.408.264ON4144029821e-130
NDAI0B020008.264ON4334479791e-129
ZYRO0C01606g8.264ON4324599621e-126
TDEL0F039108.264ON4294258731e-113
SAKL0H16984g8.264ON4354568061e-103
Ecym_43068.264ON4344297743e-98
Suva_10.1748.264ON4564577572e-95
KLTH0G13640g8.264ON4144187411e-93
YLR090W (XDJ1)8.264ON4594387321e-91
Kwal_56.237828.264ON4144517272e-91
AGR084C8.264ON4274557239e-91
Skud_12.1588.264ON4554407232e-90
KNAG0G020508.264ON4324157063e-88
Smik_12.1498.264ON4604687068e-88
CAGL0L12276g8.264ON4524626935e-86
KLLA0F19184g8.264ON5124766785e-83
KLLA0F03333g2.243ON4093964091e-44
Ecym_32812.243ON4093783985e-43
ADL257C2.243ON4103793881e-41
KAFR0J009402.243ON4113783845e-41
ZYRO0A01496g2.243ON4123803811e-40
CAGL0J09966g2.243ON4073843774e-40
KNAG0I019002.243ON4094113758e-40
Smik_14.2632.243ON4094183732e-39
YNL064C (YDJ1)2.243ON4094183722e-39
Skud_14.2682.243ON4103793695e-39
NDAI0D010302.243ON4113803688e-39
TDEL0C046002.243ON4113783671e-38
TBLA0E038102.243ON4103983661e-38
TPHA0C031102.243ON4073783662e-38
Suva_14.2772.243ON4093783652e-38
NCAS0G030002.243ON4103813652e-38
SAKL0E08734g2.243ON4113793573e-37
KLTH0G08756g2.218ON4623963577e-37
KLTH0G09394g2.243ON4113783485e-36
Kwal_23.48302.243ON4113823486e-36
Kpol_1003.122.243ON4083853372e-34
KAFR0A041608.730ON3783843282e-33
KNAG0M020202.218ON4603943233e-32
Kwal_23.30612.218ON4583953129e-31
Suva_13.3978.730ON3753713081e-30
Ecym_62368.730ON3743813053e-30
AER427W2.218ON4704483084e-30
YMR214W (SCJ1)8.730ON3773773011e-29
KNAG0G028808.730ON3783842992e-29
NDAI0E008708.730ON3763772983e-29
KLLA0E07899g2.218ON4954493023e-29
Smik_13.4228.730ON3783742974e-29
SAKL0H05258g8.730ON3683772894e-28
ZYRO0A06226g8.730ON3773742895e-28
Skud_13.3838.730ON3753712808e-27
CAGL0F03729g8.730ON3613632781e-26
TDEL0C043502.218ON4624742803e-26
KLLA0C07260g8.730ON3683692754e-26
SAKL0E09306g2.218ON4613882784e-26
TBLA0E036602.218ON4484102768e-26
TDEL0B037908.730ON3733792692e-25
NCAS0B005308.730ON3753802666e-25
KLTH0D12496g8.730ON3753702641e-24
Kwal_26.90248.730ON3753692571e-23
Kpol_1002.1222.218ON5034622602e-23
NCAS0G028502.218ON4942652564e-23
Ecym_53842.218ON5032712531e-22
Kpol_1064.408.730ON3873912482e-22
CAGL0J10296g2.218ON4794112493e-22
ZYRO0C15048g2.218ON4912502485e-22
AER346W8.730ON3673742365e-21
Skud_14.2532.218ON5323542318e-20
YNL077W (APJ1)2.218ON5282722272e-19
Suva_14.2622.218ON5362532255e-19
Smik_14.2492.218ON5332542221e-18
TPHA0D005508.61ON4864012141e-17
TBLA0B034908.730ON3843872102e-17
TPHA0G006308.730ON3932492102e-17
NDAI0G032808.61ON5524102032e-16
Smik_6.638.61ON5104061863e-14
TPHA0C029802.218ON5542851846e-14
Kpol_1011.98.61ON4954011838e-14
YFL016C (MDJ1)8.61ON5114081838e-14
KAFR0C031608.61ON4984041783e-13
CAGL0J04224g8.61ON5224061783e-13
Suva_6.448.61ON5074061731e-12
NDAI0F024502.218ON5302991686e-12
NCAS0C039508.61ON5194051651e-11
Skud_6.568.61ON5174141596e-11
KLLA0D07656g8.61ON4712911597e-11
Skud_13.3232.350ON2241181537e-11
YMR161W (HLJ1)2.350ON2241181538e-11
Kwal_14.24521.297ON607961581e-10
TDEL0G028002.350ON225921511e-10
Kpol_457.151.398ON357701533e-10
KNAG0H016801.398ON363811514e-10
KLTH0H10032g1.297ON607931525e-10
ZYRO0F03652g8.61ON4623971516e-10
NCAS0C048901.398ON367701497e-10
Suva_6.1481.297ON6421161501e-09
TDEL0B059601.398ON369701471e-09
YJL073W (JEM1)1.297ON6451151492e-09
Smik_14.3211.398ON366701472e-09
KNAG0G011308.61ON500741482e-09
ZYRO0E04598g1.398ON357701462e-09
Suva_14.3411.398ON359701452e-09
Kwal_0.2071.398ON353701453e-09
Suva_13.3402.350ON225711413e-09
Skud_14.3201.398ON368701453e-09
NDAI0H031802.350ON229701404e-09
NDAI0G042501.398ON363701434e-09
Smik_13.3612.350ON224711404e-09
YNL007C (SIS1)1.398ON352701434e-09
CAGL0H03707g1.398ON349701434e-09
KLTH0H12100g1.398ON350701435e-09
SAKL0D06226g1.297ON615731446e-09
AAL008W1.398ON349701417e-09
KLLA0D04818g1.398ON354701418e-09
TBLA0C014801.398ON353701418e-09
SAKL0D08778g1.398ON348701409e-09
Smik_10.1681.297ON6491151421e-08
AFL190C2.350ON235701371e-08
KLTH0F09944g2.350ON233701371e-08
KAFR0H031501.398ON359701401e-08
NCAS0G036101.398ON327701381e-08
NCAS0D009602.350ON224701352e-08
TBLA0B093802.350ON227701352e-08
Kpol_529.212.15ON622731392e-08
Ecym_56262.350ON243701343e-08
TBLA0D026008.61ON5102231373e-08
KLTH0A02882g8.61ON4732451373e-08
Ecym_12921.398ON347701354e-08
Kpol_526.62.350ON228721315e-08
KNAG0I008602.350ON219711306e-08
Kwal_23.3578singletonOFF85671227e-08
TPHA0B037601.398ON355701338e-08
NDAI0C026101.398ON340701338e-08
SAKL0E06050g2.350ON2321071291e-07
TBLA0G001702.15ON659721321e-07
Kwal_47.179578.61ON4782571312e-07
ZYRO0A07502g2.350ON238701282e-07
KLLA0E01629g2.350ON231711272e-07
NCAS0G013602.15ON616721312e-07
KLLA0D06402g1.297ON631771302e-07
Skud_10.1691.297ON644801303e-07
TPHA0C045902.350ON233701263e-07
KAFR0H023108.698ON6551101293e-07
Smik_15.4378.698ON6631371294e-07
TBLA0C027201.297ON715791285e-07
NCAS0A093201.297ON635981276e-07
TDEL0D016401.297ON6041191268e-07
ADR124C1.297ON611981269e-07
TDEL0A064308.698ON6661421251e-06
AFR507W8.61ON474721251e-06
AFR659W1.92ON273791221e-06
Suva_8.3038.698ON6641251251e-06
TPHA0O019402.15ON598731241e-06
KLLA0E04423g7.217ON428691232e-06
YOR254C (SEC63)8.698ON6631311232e-06
Kpol_1072.48.698ON6611121232e-06
KNAG0B018901.92ON370871222e-06
Skud_15.4208.698ON6651241232e-06
KNAG0J018408.698ON6501071232e-06
KAFR0B048902.350ON220701182e-06
KLTH0B08338g2.15ON590731222e-06
Ecym_63181.297ON624871223e-06
KAFR0A079502.15ON551721223e-06
Suva_14.1162.15ON600721223e-06
YNL227C (JJJ1)2.15ON590721213e-06
Skud_14.1102.15ON596721213e-06
SAKL0E14234g2.15ON678731223e-06
TDEL0H022907.217ON387891203e-06
KLTH0D11770g8.698ON652901214e-06
NDAI0B006705.4ON431791204e-06
KLTH0B09570g5.4ON428841204e-06
CAGL0H04499g2.350ON232701174e-06
Kpol_2000.561.92ON290791184e-06
TBLA0E024907.217ON3661081194e-06
ABL194C2.15ON5521861204e-06
Smik_14.1062.15ON593721205e-06
KLLA0D19602g2.15ON620731205e-06
NDAI0F038002.15ON638721196e-06
KAFR0I026805.4ON433791186e-06
NDAI0C002001.92ON276751167e-06
Kwal_26.88798.698ON656891187e-06
Ecym_23748.698ON661891187e-06
TPHA0G014808.698ON660971187e-06
CAGL0J07370g2.15ON623721188e-06
Kwal_26.94955.4ON428841178e-06
NCAS0E029307.217ON387871178e-06
ZYRO0D10934g8.698ON663891189e-06
KAFR0G009101.113ON163691119e-06
NCAS0E041905.4ON431791179e-06
Kwal_23.44202.15ON592721171e-05
CAGL0C04565g1.113ON175911111e-05
Kpol_1027.131.297ON641771171e-05
TBLA0J018707.157ON470941161e-05
Ecym_43727.217ON579691161e-05
Ecym_10971.92ON270601141e-05
TDEL0E005002.15ON581721161e-05
KLTH0G18546gna 1ON283871141e-05
KAFR0A016201.297ON665881152e-05
KNAG0F008602.15ON626721152e-05
KNAG0B052401.297ON6681001152e-05
ZYRO0D16390g7.217ON398891132e-05
TBLA0A055601.92ON312781122e-05
TPHA0A028101.185ON492971133e-05
ZYRO0F15400g2.15ON525731124e-05
TBLA0B037308.698ON693891134e-05
KNAG0I007407.157ON425691115e-05
NCAS0I028301.185ON491711115e-05
CAGL0J02750g7.217ON382891115e-05
SAKL0H00858g5.4ON432791105e-05
Suva_7.5825.4ON474791115e-05
TPHA0I011101.297ON666721116e-05
KAFR0L007407.217ON3641081096e-05
KNAG0L013307.217ON3961051097e-05
KLLA0F03124g5.4ON433791107e-05
Smik_16.235.4ON433791097e-05
Skud_7.6185.4ON433791097e-05
ZYRO0G21230g1.297ON584761108e-05
SAKL0H05984g8.698ON658861099e-05
CAGL0I09526g1.92ON296791079e-05
NDAI0A028207.157ON482731081e-04
NDAI0K012308.698ON6801091091e-04
Suva_12.1851.113ON168911031e-04
CAGL0L00957g7.217ON373711071e-04
YGR285C (ZUO1)5.4ON433791071e-04
SAKL0C02904g1.92ON281821061e-04
NDAI0D005001.113ON190961041e-04
CAGL0H02827g1.297ON656741081e-04
NCAS0C012208.698ON669891081e-04
YJR097W (JJJ3)1.113ON172911021e-04
KNAG0C024501.185ON544691072e-04
KNAG0E012205.4ON434801062e-04
SAKL0C03476g1.113ON165941022e-04
TDEL0G002705.4ON433841062e-04
CAGL0G00154g5.4ON433971053e-04
AAL103W8.698ON669861053e-04
TPHA0A056505.4ON433841053e-04
ADL327W3.350ON305741033e-04
CAGL0G07469g8.698ON6681091044e-04
TBLA0C071605.4ON430811034e-04
Smik_10.3851.113ON17292994e-04
CAGL0I06226g1.185ON455731035e-04
Kpol_499.307.157ON408711035e-04
NDAI0E045607.217ON3941021035e-04
KNAG0D013601.113ON18572995e-04
KLTH0A03740g7.217ON3951081026e-04
TBLA0A011007.157ON4341081027e-04
YJL162C (JJJ2)1.185ON583691027e-04
NCAS0H034801.92ON280921007e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0A01790
         (439 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   894   0.0  
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    384   e-130
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   382   e-130
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    381   e-129
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   375   e-126
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   340   e-113
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   315   e-103
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   302   3e-98
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   296   2e-95
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   290   1e-93
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   286   1e-91
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   284   2e-91
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   283   9e-91
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   283   2e-90
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   276   3e-88
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   276   8e-88
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   271   5e-86
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   265   5e-83
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   162   1e-44
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   157   5e-43
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   154   1e-41
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   152   5e-41
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   151   1e-40
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   149   4e-40
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   149   8e-40
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   148   2e-39
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   147   2e-39
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   146   5e-39
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   146   8e-39
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   145   1e-38
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   145   1e-38
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   145   2e-38
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   145   2e-38
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   145   2e-38
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   142   3e-37
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   142   7e-37
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   138   5e-36
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   138   6e-36
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   134   2e-34
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...   130   2e-33
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...   129   3e-32
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   124   9e-31
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...   123   1e-30
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...   122   3e-30
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   123   4e-30
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...   120   1e-29
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...   119   2e-29
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...   119   3e-29
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...   120   3e-29
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...   119   4e-29
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...   115   4e-28
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...   115   5e-28
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...   112   8e-27
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...   111   1e-26
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   112   3e-26
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...   110   4e-26
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   111   4e-26
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...   110   8e-26
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...   108   2e-25
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730      107   6e-25
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...   106   1e-24
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...   103   1e-23
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...   104   2e-23
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218    103   4e-23
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...   102   1e-22
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....   100   2e-22
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...   100   3e-22
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...   100   5e-22
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...    96   5e-21
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...    94   8e-20
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...    92   2e-19
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    91   5e-19
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    90   1e-18
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    87   1e-17
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...    86   2e-17
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...    86   2e-17
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    83   2e-16
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    76   3e-14
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    75   6e-14
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    75   8e-14
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    75   8e-14
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    73   3e-13
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    73   3e-13
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    71   1e-12
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    69   6e-12
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    68   1e-11
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    66   6e-11
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    66   7e-11
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    64   7e-11
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    64   8e-11
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    65   1e-10
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    63   1e-10
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    64   3e-10
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    63   4e-10
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    63   5e-10
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    63   6e-10
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     62   7e-10
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    62   1e-09
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    61   1e-09
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    62   2e-09
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    61   2e-09
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    62   2e-09
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    61   2e-09
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    60   2e-09
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    60   3e-09
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    59   3e-09
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    60   3e-09
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      59   4e-09
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    60   4e-09
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    59   4e-09
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    60   4e-09
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    60   4e-09
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    60   5e-09
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    60   6e-09
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    59   7e-09
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    59   8e-09
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    59   8e-09
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    59   9e-09
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    59   1e-08
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    57   1e-08
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    57   1e-08
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    59   1e-08
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      58   1e-08
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    57   2e-08
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    57   2e-08
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    58   2e-08
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    56   3e-08
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    57   3e-08
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    57   3e-08
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    57   4e-08
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    55   5e-08
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    55   6e-08
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    52   7e-08
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    56   8e-08
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               56   8e-08
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    54   1e-07
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    55   1e-07
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    55   2e-07
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    54   2e-07
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    54   2e-07
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    55   2e-07
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    55   2e-07
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    55   3e-07
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    53   3e-07
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    54   3e-07
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    54   4e-07
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    54   5e-07
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    54   6e-07
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    53   8e-07
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    53   9e-07
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    53   1e-06
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    53   1e-06
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    52   1e-06
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    53   1e-06
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    52   1e-06
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    52   2e-06
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    52   2e-06
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    52   2e-06
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    52   2e-06
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    52   2e-06
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    52   2e-06
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    50   2e-06
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    52   2e-06
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    52   3e-06
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    52   3e-06
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    52   3e-06
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    51   3e-06
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    51   3e-06
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    52   3e-06
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    51   3e-06
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    51   4e-06
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    51   4e-06
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    51   4e-06
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    50   4e-06
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    50   4e-06
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    50   4e-06
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    51   4e-06
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    51   5e-06
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    51   5e-06
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      50   6e-06
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    50   6e-06
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         49   7e-06
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    50   7e-06
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    50   7e-06
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    50   7e-06
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    50   8e-06
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    50   8e-06
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     50   8e-06
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    50   9e-06
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    47   9e-06
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    50   9e-06
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    50   1e-05
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    47   1e-05
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    50   1e-05
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    49   1e-05
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    49   1e-05
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    49   1e-05
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    49   1e-05
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    49   1e-05
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    49   2e-05
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    49   2e-05
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    49   2e-05
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    48   2e-05
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    48   2e-05
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    48   3e-05
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    48   4e-05
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    48   4e-05
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    47   5e-05
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    47   5e-05
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    47   5e-05
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    47   5e-05
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    47   5e-05
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    47   6e-05
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    47   6e-05
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    47   7e-05
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    47   7e-05
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    47   7e-05
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    47   7e-05
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    47   8e-05
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    47   9e-05
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    46   9e-05
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    46   1e-04
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    47   1e-04
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    44   1e-04
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    46   1e-04
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    46   1e-04
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    45   1e-04
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    45   1e-04
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    46   1e-04
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     46   1e-04
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    44   1e-04
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    46   2e-04
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    45   2e-04
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    44   2e-04
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    45   2e-04
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    45   3e-04
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    45   3e-04
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    45   3e-04
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    44   3e-04
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    45   4e-04
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    44   4e-04
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    43   4e-04
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    44   5e-04
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    44   5e-04
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             44   5e-04
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    43   5e-04
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    44   6e-04
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    44   7e-04
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    44   7e-04
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    43   7e-04
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    44   7e-04
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    44   7e-04
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    42   8e-04
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    44   9e-04
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    43   9e-04
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    43   0.001
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    43   0.001
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    43   0.001
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    41   0.001
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    42   0.001
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    43   0.001
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    43   0.001
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    42   0.001
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    43   0.001
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    42   0.002
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    42   0.002
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    43   0.002
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    42   0.002
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    43   0.002
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    42   0.002
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    42   0.002
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    42   0.002
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    42   0.002
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    42   0.002
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    42   0.003
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    41   0.003
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    42   0.003
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    41   0.003
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    42   0.003
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    41   0.003
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    41   0.003
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       42   0.003
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    41   0.004
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    41   0.004
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    41   0.005
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    39   0.006
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    41   0.006
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    40   0.006
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    41   0.006
NCAS0A11080 Chr1 complement(2203317..2204174) [858 bp, 285 aa] {...    40   0.007
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    40   0.007
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    40   0.007
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    40   0.009
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    40   0.009
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               40   0.009
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    40   0.009
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    40   0.010
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    40   0.010
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    40   0.011
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    40   0.012
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    40   0.013
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    40   0.014
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    38   0.015
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    39   0.016
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    39   0.016
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    39   0.016
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    39   0.017
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    38   0.021
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    39   0.021
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    39   0.022
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    39   0.022
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    39   0.023
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    39   0.024
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    38   0.032
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    37   0.033
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    38   0.034
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    38   0.034
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    38   0.037
KLLA0B08459g Chr2 (751178..752065) [888 bp, 295 aa] {ON} similar...    38   0.042
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    36   0.056
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    37   0.060
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    37   0.062
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    36   0.070
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    36   0.083
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    36   0.087
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    37   0.094
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    36   0.12 
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    37   0.13 
Kpol_1025.42 s1025 (112594..113172) [579 bp, 192 aa] {ON} (11259...    35   0.13 
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    35   0.14 
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    36   0.14 
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    36   0.14 
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    36   0.14 
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    36   0.15 
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    36   0.16 
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    36   0.16 
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    35   0.21 
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    36   0.26 
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    35   0.33 
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    34   0.52 
KAFR0F03210 Chr6 complement(634603..635160) [558 bp, 185 aa] {ON...    33   0.54 
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    34   0.64 
NDAI0D03610 Chr4 (859564..860136) [573 bp, 190 aa] {ON} Anc_4.10...    33   0.65 
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    34   0.76 
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    33   0.83 
Skud_16.346 Chr16 complement(640855..641760) [906 bp, 301 aa] {O...    33   0.97 
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    33   1.3  
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    33   1.4  
NCAS0I01830 Chr9 complement(336447..340220) [3774 bp, 1257 aa] {...    33   1.4  
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    33   1.4  
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    33   1.6  
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    32   1.9  
TBLA0A09020 Chr1 complement(2220975..2221535) [561 bp, 186 aa] {...    32   2.0  
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    32   2.0  
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    32   2.2  
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    32   2.6  
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    32   2.6  
TBLA0A06620 Chr1 (1617259..1617876) [618 bp, 205 aa] {ON} Anc_3....    32   2.6  
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    31   3.0  
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    32   3.0  
Suva_10.86 Chr10 complement(171011..171517) [507 bp, 168 aa] {ON...    31   3.2  
YLR008C Chr12 complement(165577..166083) [507 bp, 168 aa] {ON}  ...    31   3.3  
ADR345C Chr4 complement(1315743..1316219) [477 bp, 158 aa] {ON} ...    31   3.3  
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    32   3.4  
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    32   3.5  
NCAS0A01690 Chr1 (330511..331077) [567 bp, 188 aa] {ON} Anc_4.10...    31   4.1  
Ecym_2578 Chr2 complement(1130625..1131521) [897 bp, 298 aa] {ON...    31   4.4  
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    31   4.5  
CAGL0A00297g Chr1 complement(30179..30775) [597 bp, 198 aa] {ON}...    31   4.8  
TDEL0B02440 Chr2 complement(442034..443002) [969 bp, 322 aa] {ON...    31   5.6  
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    31   6.7  
ZYRO0F10714g Chr6 (871970..874096) [2127 bp, 708 aa] {ON} weakly...    31   7.2  
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    30   8.5  
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    30   9.6  

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/439 (100%), Positives = 439/439 (100%)

Query: 1   MSNENDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELK 60
           MSNENDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELK
Sbjct: 1   MSNENDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELK 60

Query: 61  FKEIISAYEILSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGNQTSKDISIPLKVTIK 120
           FKEIISAYEILSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGNQTSKDISIPLKVTIK
Sbjct: 61  FKEIISAYEILSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGNQTSKDISIPLKVTIK 120

Query: 121 DLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPG 180
           DLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPG
Sbjct: 121 DLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPG 180

Query: 181 FFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKDTIII 240
           FFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKDTIII
Sbjct: 181 FFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKDTIII 240

Query: 241 DNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVK 300
           DNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVK
Sbjct: 241 DNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVK 300

Query: 301 TLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPADNWNSEMN 360
           TLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPADNWNSEMN
Sbjct: 301 TLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPADNWNSEMN 360

Query: 361 DIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKDLPDIIDTSHNNGAE 420
           DIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKDLPDIIDTSHNNGAE
Sbjct: 361 DIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKDLPDIIDTSHNNGAE 420

Query: 421 YGHNGDSANFTEMPECSQQ 439
           YGHNGDSANFTEMPECSQQ
Sbjct: 421 YGHNGDSANFTEMPECSQQ 439

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  384 bits (987), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 209/449 (46%), Positives = 286/449 (63%), Gaps = 38/449 (8%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           DLYA+L V    T  ++KK YRKLAL++HPDKV  ++ D+ +     E+KFKEI +AYEI
Sbjct: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREAS---EIKFKEISAAYEI 59

Query: 71  LSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFG-------------NQTSKDISIPLKV 117
           LSDE+KR  YDL  +  +  +     D   + F               + S D+ IPLK+
Sbjct: 60  LSDEDKRAHYDLYGSEEEQQRQQRQYDPFESFFNFEQDEEPSRHYEDPKRSPDVKIPLKM 119

Query: 118 TIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQI 177
           TI++LYNGK  ++  KRNVIC+ C GLGWR RKNG+  VPP  ECK C G G+ +  + +
Sbjct: 120 TIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKGQGFTEKVRML 179

Query: 178 APGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKDT 237
           APGF T++   CK CDGKG++Y K  S KN C KC+G+G+   S+ +TV++PRG  D DT
Sbjct: 180 APGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVSVPRGLRDGDT 239

Query: 238 IIIDNKADQELGKFKTGDLIFVLEEID--DEQTALKRYGDKDLITELTISLADAITGFKE 295
           I + N+ADQELGK KTGDLIF +EE     +   L+R G  + +TEL ISLA+A+TGFK+
Sbjct: 240 IKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGS-NFMTELNISLAEALTGFKD 298

Query: 296 KPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPADNW 355
           K + KT DGR+L LSIP GKVIR G+I+K+E EGWPLN  AT+ GDLYI  NIEFP DNW
Sbjct: 299 KFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISVNIEFPPDNW 358

Query: 356 NSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKDLPDII---- 411
            +E +D+ +I+N+LP  +  K   L D P        +N+E +  ++ ++ LPD +    
Sbjct: 359 FTEKSDLTQIKNILPRSTSDKTK-LSDDP--------LNTELLLKFEVLETLPDTLKEGQ 409

Query: 412 DTSHNNGAEYG-HNGDSANFTEMPECSQQ 439
           D   NN   +G + G+ +     P+C+QQ
Sbjct: 410 DQGENNAESHGEYRGEGS-----PQCAQQ 433

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  382 bits (982), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 205/402 (50%), Positives = 267/402 (66%), Gaps = 20/402 (4%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           +D Y IL V E  T +E+KK YRKLAL+YHPDK       ++  KL  E+KFK+I +AY+
Sbjct: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDK-----SIDEGQKLINEIKFKDITAAYQ 65

Query: 70  ILSDEEKRKQYDLQKNFRDANQGSDYG---DGINTAFGNQTSKDISIPLKVTIKDLYNGK 126
            LSDE+KR +YD +KNF    + SD+    DG   +     SKDI + L +   +LYNGK
Sbjct: 66  TLSDEDKRNEYDNKKNFEPYFE-SDFANNHDGNYNSRYRSRSKDIKVELSLKTSELYNGK 124

Query: 127 IIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQN 186
            I+++  RN IC+ C GLGWR++K+GK YVPP  EC+ C+G GYK ++ Q+APGF+T QN
Sbjct: 125 TIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGYKNMKVQLAPGFYTTQN 184

Query: 187 LVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQ 246
           ++C  C G G+YYKKP S KNFC  CNGK +I+I + I V+IPRGSS+ D II+  +AD+
Sbjct: 185 VLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPRGSSNGDNIILKGEADE 244

Query: 247 ELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRL 306
           ELGK   GDLIF + EI D    L+RYG+  LI    ISLA+AITGF+ K IVKT D R 
Sbjct: 245 ELGKKNAGDLIFEINEIIDSNNDLERYGNH-LINHTHISLAEAITGFENKFIVKTFDDRD 303

Query: 307 LRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPADNWNSEMNDIIKIR 366
           L LS P GKVIR GDIL+V+ EGWP++K     G+LY+   IEFP DNW +E NDIIKIR
Sbjct: 304 LYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFPPDNWINEKNDIIKIR 363

Query: 367 NLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKDLP 408
           N+LP     + +I+            +NSE IS ++ VK LP
Sbjct: 364 NILPNEKTKRNNIVD----------PINSEYISTFEIVKSLP 395

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  381 bits (979), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 207/447 (46%), Positives = 287/447 (64%), Gaps = 34/447 (7%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           DLY+IL V  + T  E+KK YRKLAL+YHPDKV   +  E     E E+KFKEI SAYEI
Sbjct: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDRE-----ENEIKFKEITSAYEI 57

Query: 71  LSDEEKRKQYDLQKNFRDANQG--------------SDYGDGINTAFGNQTSKDISIPLK 116
           LSDEEKR  YDL   + DAN+               +D  D  + AF N  SKD+ IPLK
Sbjct: 58  LSDEEKRAHYDL---YGDANENEYNNQNANDFFNFETDQPDYDSYAFDNDKSKDVKIPLK 114

Query: 117 VTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQ 176
           ++I++LYNGK  ++  KRN+IC +C GLGWR RKNG   +P   ECK C+G GYK+  + 
Sbjct: 115 LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYKERTRM 174

Query: 177 IAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKD 236
           + PGF T   + C++C GKG  Y KP S KN C  C+GKG++  ++ + V++PRG  +KD
Sbjct: 175 LIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRGLQNKD 234

Query: 237 TIIIDNKADQELGKFKTGDLIFVLEE--IDDEQTALKRYGDKDLITELTISLADAITGFK 294
           TI I+N+ADQE+GK KTGD+I V+EE           R G  D +  L++SLA+A+TGFK
Sbjct: 235 TIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKG-TDFVMYLSLSLAEALTGFK 293

Query: 295 EKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPADN 354
           +K + K+LDGR+L LS+P GKVIR G+I+K++ EGWP+N  A++ GDLY+   IEFP DN
Sbjct: 294 DKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEFPPDN 353

Query: 355 WNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKDLPDIIDTS 414
           W SE +DI  +RN+LP+  +    ++     DD     +N+E ++ +D +++LPD ++ S
Sbjct: 354 WFSEKSDIQLLRNVLPSGING---MMNSWKIDD----PLNTETVTTFDILEELPDTLNES 406

Query: 415 HNNGAEYGHNGDSANFTEM--PECSQQ 439
           +N  A    +   AN+     P+CSQQ
Sbjct: 407 NNRSAYDTGDQSDANYDREGPPQCSQQ 433

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  375 bits (962), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 208/459 (45%), Positives = 282/459 (61%), Gaps = 60/459 (13%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY  L V +  TQ E+KK YRKLAL++HPDKV      +D V+ E E++FKEI +AYE+L
Sbjct: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVT-----DDSVREESEVRFKEITAAYEVL 57

Query: 72  SDEEKRKQYDLQKNFRDANQGSDYGDGINTAF-----------------------GNQTS 108
           SDEEKR +YD    + D   G D+ D     F                       G+  S
Sbjct: 58  SDEEKRSKYD---TYGDTADGPDFEDESFMNFFTQFNSGFGFNGGGGGGFPGAQPGDDRS 114

Query: 109 KDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGA 168
            D+ +PLKV++ D YNGK+ ++  KR ++CEKC G GWR R  G    PP T CK+C G 
Sbjct: 115 DDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEGSGWRRRSGGP---PPQTNCKSCQGR 171

Query: 169 GYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNI 228
           GYK+  +++APG   +Q + C  C GKG+Y  KP S KN C KC G+G+IE ++ +TV+I
Sbjct: 172 GYKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSI 231

Query: 229 PRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD--EQTALKRYGDKDLITELTISL 286
           PRGS   D I+ + +ADQE+GK KTGDLIF+++E  +  E   L+R G  DLIT ++ISL
Sbjct: 232 PRGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRG-YDLITNISISL 290

Query: 287 ADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKF 346
           A+AITG  ++ + KTLDGR+L+LS P GKVI  G I+KVE EGWPLN +AT+ GDLY+  
Sbjct: 291 AEAITGL-DRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLV 349

Query: 347 NIEFPADNWNSEMNDIIKIRNLLP---AISDAKADILGDMPKDDIFNITMNSEDISNYDF 403
           +I FP DNW +E +D++KIRN+LP   A +D KAD               N+E +S+   
Sbjct: 350 DIVFPRDNWFAEKSDLLKIRNILPSEAANNDVKAD-------------PGNTEQVSDMKL 396

Query: 404 VKDLPDIIDTSHNNGAEYGHNGD-SANFTE--MPECSQQ 439
           V  LPD + +   NG +Y H G  S  F +   P+C+QQ
Sbjct: 397 VDQLPDYMGS---NGDQYAHEGHASGAFPDDGTPQCAQQ 432

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  340 bits (873), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 185/425 (43%), Positives = 270/425 (63%), Gaps = 50/425 (11%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY IL V+   TQ E+KK YRK AL++HPDKV      ++ ++ E E++FKEI +AYE+L
Sbjct: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVA-----DESLREESEVRFKEIAAAYEVL 58

Query: 72  SDEEKRKQYDLQKNFRDANQGSDYGDGIN-----------TAFGNQT------------- 107
            DEEKR +YD    + DA+ GSD+ +G N            +FG+               
Sbjct: 59  GDEEKRARYD---KYGDAD-GSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVD 114

Query: 108 -SKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCD 166
            S D+ +PL V++ D YNGK  ++  KR ++C++C+G GWR R+N     PP  ECK C 
Sbjct: 115 RSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWR-RRNDHVVPPPQVECKKCG 173

Query: 167 GAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITV 226
           G G+KQ  +++APGF T +N+ C  CDGKG+   KP + KN C KC G G+   S+S+TV
Sbjct: 174 GQGFKQRIRRLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTV 233

Query: 227 NIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD--EQTALKRYGDKDLITELTI 284
           ++PRGS   D I++  +ADQE+GK +TG+L+F ++E  +  E   L+R+G  DLIT LT+
Sbjct: 234 SLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHG-FDLITHLTL 292

Query: 285 SLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYI 344
           SLA+AITGF  K + KTLDGR+L+L IP GKVIR G+I+++  EGWP+  + T SGDLY+
Sbjct: 293 SLAEAITGFS-KTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI--DTTTSGDLYV 349

Query: 345 KFNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFV 404
             +IEFP DNW SE +D+ +++N+LP  ++  A +  D           N+E ++N + V
Sbjct: 350 VVHIEFPPDNWFSERSDLTQVKNVLPGETNNNAAVEDD---------PGNTETVTNINIV 400

Query: 405 KDLPD 409
           +++PD
Sbjct: 401 EEIPD 405

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  315 bits (806), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/456 (39%), Positives = 273/456 (59%), Gaps = 52/456 (11%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY +L V    +Q E+KK YRKLAL++HPDKV      ++ ++ E E+KFKEI +AYEIL
Sbjct: 4   LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVA-----DEVLREESEMKFKEITAAYEIL 58

Query: 72  SDEEKRKQYDL--------------------QKNFRDANQGSDYGDGINTAFGNQTSK-- 109
           SDE+ RK+YD+                      NF     G  + D     +  + ++  
Sbjct: 59  SDEDSRKKYDVYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFYDEPRQPYPEEENRSV 118

Query: 110 ---DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCD 166
              D  IPLK+++K+LYNGK  ++  KRNV+C++C G G R  K  +Q+      C++C+
Sbjct: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLR--KKFQQHPRKPVVCQSCE 176

Query: 167 GAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITV 226
           G G+K+  +++A GF  ++ + C+ C+GKGR    P   ++ C KC+GK +I   +++TV
Sbjct: 177 GHGHKERIKRVAQGFVIRETVKCERCNGKGR--TTPTKPEDHCKKCHGKCVISEEKTLTV 234

Query: 227 NIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISL 286
            IPRGS + D + ++ +ADQE  K  TGDL+FV+EE  +  T L+R GD DL T L ISL
Sbjct: 235 YIPRGSRNGDIVKLEGEADQEPDKV-TGDLLFVIEENPETSTNLERRGD-DLHTRLKISL 292

Query: 287 ADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKF 346
           ++AITGF EK +  TLD R+L+L IP GKVIR G+ +++E EGWPL+ +  + GD+Y++ 
Sbjct: 293 SEAITGF-EKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQV 351

Query: 347 NIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVK- 405
           +IEFP DNW SE +D+  +R LLP + +A+    GD+          N+E + +Y  VK 
Sbjct: 352 HIEFPPDNWFSEKSDVEVLRTLLPEVPNARVADTGDL---------NNTETVIDYSVVKS 402

Query: 406 --DLPDIIDTSHNNGAEYGHNGDSANFTEMPECSQQ 439
             +LPD +  S+  G   G   +   F E P+C+QQ
Sbjct: 403 ADELPDYL--SYEKGEYQGQEQEYGAFEE-PQCAQQ 435

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  302 bits (774), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 177/429 (41%), Positives = 257/429 (59%), Gaps = 48/429 (11%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           KDLY++L +    T+ E+K+ YR LAL YHPDK+      ++  + E E KFKEI +AY+
Sbjct: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS-----DESQRAESEAKFKEISAAYD 57

Query: 70  ILSDEEKRKQYDLQKNFR-----------DANQGSD-------YGDGINTAF------GN 105
           ILSDE+KR +YD    F            D  +G++       YG G    +       +
Sbjct: 58  ILSDEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTS 117

Query: 106 QTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTC 165
           Q +KD  +PLK++ K LY GK  ++ +KRNV+C KC GLG R R     +  P+ +C  C
Sbjct: 118 QKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKR---AAHCMPM-KCGIC 173

Query: 166 DGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESIT 225
           DG G+K+   +I+PGF +++ + C  CDGKG    +  S    C KC+GK +I  +  +T
Sbjct: 174 DGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDN--CKKCHGKCVIVENSILT 231

Query: 226 VNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTIS 285
           + +PRG    DTI ID +AD E GK +TGDL+F ++EI D    L+R G  DL   +TIS
Sbjct: 232 LYVPRGHRHADTIRIDGQADMEAGK-ETGDLVFEIDEITDPDAELERKG-TDLHCSITIS 289

Query: 286 LADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIK 345
           LA+A+TGF  + + +T D RLLR++IP GKV+R G+ LK   EGWP+N N +R GDLY+K
Sbjct: 290 LAEALTGFT-RLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPIN-NGSRFGDLYVK 347

Query: 346 FNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVK 405
            NIEFP DNW +E +++  I+++LP + ++     GD   DD      N+EDI++Y  ++
Sbjct: 348 VNIEFPKDNWLNEKSELEAIKHILPGLKNSSNSHQGD--GDD----PANTEDINSYYVIQ 401

Query: 406 D---LPDII 411
           D   LPD +
Sbjct: 402 DSSRLPDYL 410

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  296 bits (757), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 175/457 (38%), Positives = 258/457 (56%), Gaps = 46/457 (10%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY +L V    +  E+K  YRKLALK+HPDK  + D D  ++    E KFKEI +AYEIL
Sbjct: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDK--SVDQDSKELN---ETKFKEITAAYEIL 64

Query: 72  SDEEKRKQYDL-----------------------QKNFRDANQGSDYGDGINTAFGNQT- 107
           SD EK+  YDL                             A++ +D+ +      GN+T 
Sbjct: 65  SDPEKKSHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEMYEGNETT 124

Query: 108 -SKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCD 166
            SKDI I L  T+KDLY GK +++++KR +IC KC G GW+++K  K +V    EC++C 
Sbjct: 125 SSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKK--KVHVTHEMECESCG 182

Query: 167 GAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITV 226
           G G K+  ++  PG    Q +VC+ C GKG+Y K+P + KNFC  C   G+    E ITV
Sbjct: 183 GKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITV 242

Query: 227 NIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVL----EEIDDEQTALKRYGD---KDLI 279
           N+P G    D + +   AD+E+ K   GDLIF L    E++  +Q  +K++G    +DL 
Sbjct: 243 NVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLY 302

Query: 280 TELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWP-LNKNATR 338
             +T+SL++A+TGF EK + +T D RLL LSI  GKVIR GDI+K+  EGWP L+    +
Sbjct: 303 VSITVSLSEALTGF-EKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDHPRGQ 361

Query: 339 SGDLYIKFNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDI 398
            GDLY+  +IEFP DNW +E ++++ I+  LP+ +   ++   +   D   N  +NSE +
Sbjct: 362 CGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSD---NSPINSETV 418

Query: 399 SNYDFVK--DLPDIIDTSHNNGAEYGHNGDSANFTEM 433
           SN+  +   DLP+ + T +       H   S+++  M
Sbjct: 419 SNFQIIHSDDLPEGMKTFNPKPQTSAHQKASSSYCPM 455

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  290 bits (741), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 156/418 (37%), Positives = 251/418 (60%), Gaps = 46/418 (11%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D Y  L V    TQDE+KK YR+LAL++HPDKV      ++ ++ E E+KFKE+ +AYE+
Sbjct: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVS-----DESLRDESEIKFKEVAAAYEL 56

Query: 71  LSDEEKRKQYDLQ----------KNFRDANQGSDYGDGINTAFGNQ---------TSKDI 111
           LS+EEKR+ YD              F+D +  S +G+  +  + ++          + D 
Sbjct: 57  LSNEEKRQNYDTYGDTNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEAQSPPSPRTDDA 116

Query: 112 SIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYK 171
            +P+++T+++LYNGK IR+  KRNV+C +C G G R R          + C  C+G G K
Sbjct: 117 HVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHA------SACSQCEGHGVK 170

Query: 172 QVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRG 231
           Q  +++ PGF T++ + C  C G G+  +    S++ C KC+GK +   S+++ V IPRG
Sbjct: 171 QRLRRLGPGFVTREIVQCDKCKGLGKNLR----SEDMCKKCHGKRVTPESKNLNVYIPRG 226

Query: 232 SSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAIT 291
           S   D +++  +AD+E GK   GDL+F + E +   ++L+R G  DL  ++TISL+DA+T
Sbjct: 227 SRHGDRVVLKGEADEEPGKI-PGDLVFDIAE-NSASSSLERRG-SDLYAKITISLSDALT 283

Query: 292 GFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
           GF EK +  TLDGRLL+L +P+G+V+R G+ ++++ EGWPL+   ++ GD+Y++ +IEFP
Sbjct: 284 GF-EKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFP 342

Query: 352 ADNWNSEMNDIIKIRNLLP-AISDAKADILGDMPKDDI-------FNITMNSEDISNY 401
            D+W SE +D+  ++NLLP A+S +          D         F+I  ++E++  Y
Sbjct: 343 PDHWFSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQY 400

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  286 bits (732), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 179/438 (40%), Positives = 250/438 (57%), Gaps = 49/438 (11%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY +L V    T  E+K  YRKLALK+HPDK    D  E +     E+KFKEI +AYEIL
Sbjct: 10  LYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVN-----EIKFKEITAAYEIL 64

Query: 72  SDEEKRKQYDL------------QKNFRDANQ----------GSDYGDGINTAF-----G 104
           SD EK+  YDL               F D +           GS  G+     +     G
Sbjct: 65  SDPEKKSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDAYEEG 124

Query: 105 NQTS-KDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECK 163
           N TS KDI I + +T+KDLY GK +++D+KR VIC KC G GW+ ++  K +V    EC+
Sbjct: 125 NSTSSKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKR--KIHVTHDVECE 182

Query: 164 TCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISES 223
           +C G G K+  ++  PG    Q +VC+ C+GKG+Y K+P + KNFC  C G G++   E 
Sbjct: 183 SCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKKEI 242

Query: 224 ITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVL----EEIDDEQTALKRYGD---K 276
           ITVN+  G    D I +   AD+E+ K   GDL F L    E ++ +Q  LK + D   +
Sbjct: 243 ITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGAGE 302

Query: 277 DLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNA 336
           DL T +TISL++A+TGF EK + KT D RLL LS+  G+V+R GD +K+  EGWP+  N 
Sbjct: 303 DLYTSITISLSEALTGF-EKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDNP 361

Query: 337 T-RSGDLYIKFNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNS 395
             R GDLY+  +IEFP DNW +E ++++ I+  LP+ S   +     +  +D  N+T N+
Sbjct: 362 HGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASH--ATVNTEDDSNLT-NN 418

Query: 396 EDISNYDFVK--DLPDII 411
           E ISN+  +   DLP+ I
Sbjct: 419 ETISNFRIIHTDDLPEGI 436

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  284 bits (727), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 173/451 (38%), Positives = 255/451 (56%), Gaps = 60/451 (13%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D Y  L V    TQDE+KK YR+LAL++HPDKV      ++ ++ E E+KFKE+ +AYE+
Sbjct: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVS-----DESLREESEIKFKEVAAAYEL 56

Query: 71  LSDEEKRKQYDLQKNFRDANQGSD-YG---DG-INTAFGNQTSK---------------- 109
           LS+EEKR+ YD    + D N  SD YG   DG   + FGN  S                 
Sbjct: 57  LSNEEKRRNYD---TYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEEDFRAHARPRT 113

Query: 110 -DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGA 168
            D  + L++T++DLYNGK +R+   RNV+C +C G G R R          + C  C+G 
Sbjct: 114 DDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHA------SACTHCEGH 167

Query: 169 GYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNI 228
           G KQ  +++ PGF T++ + C  C G G+  +    S++ C KC+GK +   ++++ V I
Sbjct: 168 GVKQRLRRLGPGFVTRETVQCTKCRGLGKNLR----SEDLCKKCHGKRVTPETKNLNVYI 223

Query: 229 PRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLAD 288
           PRGS   D I+++ +AD+E GK  TGDL+F + E D   + L+R G  DL T++ ISL+D
Sbjct: 224 PRGSRHNDRIVLEGEADEEPGKL-TGDLVFDISE-DSTTSNLERRG-SDLHTKIIISLSD 280

Query: 289 AITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNI 348
           A+TGF EK +  TLDGR LRL IP G+VIR G+ + ++ EGWPL+    + G++Y++ NI
Sbjct: 281 ALTGF-EKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINI 339

Query: 349 EFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKDLP 408
           EFP D+W SE  +I  +RN++P  + + A       + D  N  M + DI      ++LP
Sbjct: 340 EFPPDHWYSERGEIEALRNIIPQSTSSSAASSSASAEPDPVNTEMPTFDI--LKSAEELP 397

Query: 409 DIIDTSHNNGAEYGHNGDSANFTEMPECSQQ 439
           + +      G               P+CSQQ
Sbjct: 398 NYLPDDAEQGG--------------PQCSQQ 414

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  283 bits (723), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 164/455 (36%), Positives = 254/455 (55%), Gaps = 53/455 (11%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
           T+DLY +L +  + ++ E+K+ YR+LAL+YHPDK+  +D  E +     E KFKEI +AY
Sbjct: 2   TRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKI--SDESEREAS---EAKFKEISAAY 56

Query: 69  EILSDEEKRKQYDLQKNFRDANQGSD--------------YGDGINTAFGNQ-------T 107
            +LSDE+KR +YD Q    D   G D              YG G +     +        
Sbjct: 57  AVLSDEQKRAEYD-QFGTVDGGYGHDEFGHGDDDFMNFFRYGAGRHGYQHEEDDFEEVGR 115

Query: 108 SKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDG 167
           + D ++PLK+T K LY GK  ++  +R V+C +C G G R R   +    P+  C+ C+G
Sbjct: 116 TADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAAR----PMIRCEGCEG 171

Query: 168 AGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVN 227
            GYK+   +I PG  +++ + C +C GKG+  + P ++ + C KC GK +++    I+V 
Sbjct: 172 QGYKERISRIGPGLISRERVSCADCGGKGK--RIPTTAADNCKKCTGKCVVQEESIISVY 229

Query: 228 IPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLA 287
           +PRGS   D +    ++D E GK +TGDL+FV++E  D  ++L+R G  DL   + ISLA
Sbjct: 230 VPRGSQHGDRLRYPGQSDMEPGK-ETGDLVFVIDEQTDVSSSLERKG-TDLYCTMKISLA 287

Query: 288 DAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFN 347
           +A+TGF  + + +T D R+LR++IP GKV+R G+ LK   EGWP+   A R GD+Y++  
Sbjct: 288 EALTGFT-RIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGA-RFGDMYVQVL 345

Query: 348 IEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKD- 406
           IEFP DNW +E  ++  IRN+LP ++DA +    D           N+E++  Y  + + 
Sbjct: 346 IEFPKDNWFNEKAELDAIRNILPGLADAPSTKTED---------PSNTEEVRAYSIIANH 396

Query: 407 --LPDIIDTSHNNGAEYGHNGDSANFTEMPECSQQ 439
             LPD +D  +   +   H   +      PEC  Q
Sbjct: 397 TGLPDYLDRENQGYSRQQHESTAGT----PECPMQ 427

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  283 bits (723), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 180/440 (40%), Positives = 247/440 (56%), Gaps = 53/440 (12%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY +L V       E+K  YRKLALK+HPDK    D D  DV    E+KFKEI +AYEIL
Sbjct: 10  LYGVLGVTRDADVQEIKTAYRKLALKHHPDKY--VDQDSKDVN---EIKFKEITAAYEIL 64

Query: 72  SDEEKRKQYDLQKNFRD-ANQGSDYGDGI-----------------NTAFGNQ------- 106
           SD EK+  YDL  +    AN G   G G                     F N+       
Sbjct: 65  SDPEKKSHYDLYGDDNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKMYEDN 124

Query: 107 ---TSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECK 163
              +SKDI I + +T+KDLY GK +R+D+KR V+C KC G GW+++K  + +V    EC+
Sbjct: 125 DSASSKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKK--RVHVTHEVECE 182

Query: 164 TCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISES 223
           +C G G K+  ++  PG    Q ++C+ C GKG+Y K P + KNFC  C G G+    E 
Sbjct: 183 SCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEV 242

Query: 224 ITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDE----QTALKRYGD---K 276
           ITV +  G    D I I+  AD+E+GK   GDL F L E  ++    Q  LK +GD   +
Sbjct: 243 ITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNME 302

Query: 277 DLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNA 336
           D    +TISL++A+TGF EK + KT D RLL LSI  G+VIR GD+LK+  EGWP+  +A
Sbjct: 303 DSYVSVTISLSEALTGF-EKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDA 361

Query: 337 T-RSGDLYIKFNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNS 395
             R GDLY+  +IEFP DNW +E ++++ I+  LP+ S +     GD       N  +N+
Sbjct: 362 RGRCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSC-ASGDA------NDLINN 414

Query: 396 EDISNYDFVK--DLPDIIDT 413
           E +SN+  +   DLP+ + T
Sbjct: 415 ETVSNFQIIHTDDLPEGVKT 434

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  276 bits (706), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 165/415 (39%), Positives = 233/415 (56%), Gaps = 43/415 (10%)

Query: 13  YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
           Y IL VD   T DE++K YRKLALK+HPDKV   D +E   K   E+KFKEI +AYEILS
Sbjct: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKV--IDPEE---KASNEMKFKEITTAYEILS 61

Query: 73  DEEKRKQYDLQKNFRDANQGSDYGDGINTAFGN----------------QTSKDISIPLK 116
           + E  ++ + +        G ++GD     F                   T++   I ++
Sbjct: 62  NGEYVEEMEEEYE--GQGYGFNFGDDFMNFFNEGRNAHPMGGHPQREDESTNEATQIEIE 119

Query: 117 VTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQ 176
           VT+KDLYNGK +++ + RNVIC  C G  WR RKNG  Y PP+  C  C GAGY +    
Sbjct: 120 VTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGYVERLVG 179

Query: 177 IAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKD 236
            +P F   Q + C+ C GKG Y  KP S KN C  C+G+G+I+  + + V IPRGS + +
Sbjct: 180 DSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSN 239

Query: 237 TIIIDNKADQELGKFKTGDLIFVLEEID-----DEQTALKRYGDKDLITELTISLADAIT 291
           TII   K D++L   + GD++F L+  D     D    + + G  DL   + I L +AI+
Sbjct: 240 TIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEG-TDLHMNIEIPLIEAIS 298

Query: 292 GFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
           G + + + KT D R+L+L++P GKV+R GD + ++GEGWP   N T  GD+++  N+EFP
Sbjct: 299 GTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFP 358

Query: 352 ADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVKD 406
            DNW SE NDI  + N+LPA    K+D           +    + D +N +FVKD
Sbjct: 359 PDNWISERNDITTLTNVLPA---GKSD-----------DGHAQTGDANNAEFVKD 399

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  276 bits (706), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 171/468 (36%), Positives = 253/468 (54%), Gaps = 64/468 (13%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY +L V    +  E+K  YRKLALK+HPDK    +  E +     E+KFKEI +AYEIL
Sbjct: 10  LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVN-----EIKFKEITAAYEIL 64

Query: 72  SDEEKRKQYDLQKNFRDANQGSDYGDGINTA---FGN----------------------- 105
           SD EK+  YDL         G DYG   +T    FG+                       
Sbjct: 65  SDPEKKSHYDLY--------GDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEGNDFPR 116

Query: 106 ----------QTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQY 155
                     ++SKDI I + +T+KDLY GK +++++KR ++C  C G GW+ +K  K +
Sbjct: 117 EYDTYEEDKCKSSKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKK--KIH 174

Query: 156 VPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGK 215
           V    EC++C G G K+  ++  PG    Q + C+ C GKG+Y K+P + KNFC  C G 
Sbjct: 175 VTHEVECESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGV 234

Query: 216 GIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVL----EEIDDEQTALK 271
           G+    E ITVN+  G    D I I   AD+EL K   GDL F L    E ++ +Q  LK
Sbjct: 235 GLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLK 294

Query: 272 RYGD---KDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGE 328
            + +   +DL T  TISL++A+TGF EK + +T D RLL LSI  G+VIR GD++K+  E
Sbjct: 295 NFDEGSAEDLYTSATISLSEALTGF-EKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNE 353

Query: 329 GWPLNKNAT-RSGDLYIKFNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDD 387
           GWP+  +   + GDLY+  +IEFP DNW +E ++++ I+ +LP+ S        +  +DD
Sbjct: 354 GWPIMDDPRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDD 413

Query: 388 IFNITMNSEDISNYDFV--KDLPDIIDTSHNNGAEYGHNGDSANFTEM 433
                +N+E ISN+  +  ++LP+ +   ++      H    +++  M
Sbjct: 414 --RNPINNETISNFQIINMEELPEGMKIFNSESQNSAHQKAKSSYCPM 459

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  271 bits (693), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 164/462 (35%), Positives = 255/462 (55%), Gaps = 44/462 (9%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D Y +L V +  +QDE+K+ YRKLAL++HPDK +  +G ED      ++ FKE+ +AY++
Sbjct: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61

Query: 71  LSDEEKRKQYDLQKNFRDANQGSD----------------YGDGINTAFGNQT--SKDIS 112
           LSD   R +YD +  F     G D                +  G ++  G +   S DI 
Sbjct: 62  LSDASLRAEYDQKLAFEAQPYGDDDFMNFFSGFNGGSHPGHRSGFDSGRGARRYKSDDIE 121

Query: 113 IPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRS------RKNGKQYVPPLTECKTCD 166
           I LKV   +LY GK + +++KR   C++C G GW+S      +K  K +      C+ C+
Sbjct: 122 IDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKTAKFF---WNVCEGCE 178

Query: 167 GAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKC---NGKGIIEISES 223
           G G +Q  +Q+APGF T + + C+ C GKG+    P S KN C  C      G++E ++ 
Sbjct: 179 GQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGMVEENKV 238

Query: 224 ITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELT 283
           +T+NI +G+ D D I++  +AD++L   + GDL+  ++E+ + Q  + R G  DLI +  
Sbjct: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNG-YDLIIKKQ 297

Query: 284 ISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNAT------ 337
           I LADAI GF EKP+++T DGR+L+ S   GKVIR  DI++++ EGWP  ++A       
Sbjct: 298 IDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLL 357

Query: 338 RSGDLYIKFNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSED 397
           ++GDLY+  +I FP DNW  E+ND   +RN++P+  + +          ++ NI + SE 
Sbjct: 358 KNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENINV-SEI 416

Query: 398 ISNYDFVKDLPDIIDTSHNNGAEYGHNGDSANFTEMPECSQQ 439
           +       +LP   DT  N   +    G+S  +T  P CSQQ
Sbjct: 417 VKEIPNCDELPKFQDTYDNTNDK----GESPFWT--PNCSQQ 452

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  265 bits (678), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 177/476 (37%), Positives = 253/476 (53%), Gaps = 64/476 (13%)

Query: 2   SNENDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKF 61
           SN N    +  Y +L V++  T+ E++K YRKLALKYHPDK+   D  E +     E  F
Sbjct: 63  SNVNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKI--IDEAERETS---EAMF 117

Query: 62  KEIISAYEILSDEEKRKQYDLQ----------------------KNFRDANQGSDYGDGI 99
           KE+ +AYEILSD E + +YD+                        NF    Q   +G   
Sbjct: 118 KEVTAAYEILSDPELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHA 177

Query: 100 NTA----FGNQTSK---DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNG 152
           + +    +G   SK   D  I  K+T + LY GK + + +KR  +C  C G G R     
Sbjct: 178 SYSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRK---- 233

Query: 153 KQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKC 212
           K +  P   C +C+G G+K+   ++A G+  K + VC  C GKGRY KK AS  + C  C
Sbjct: 234 KHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSAS--DTCKHC 291

Query: 213 NGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKR 272
           +GKG+I   +S TV IPRGS   D   +   AD E GK +TGD+I V++E D  ++ L+R
Sbjct: 292 SGKGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGK-ETGDVIIVIDE-DSSKSHLER 349

Query: 273 YGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPL 332
             + DL T L ISL DA+TGF    + +T D R LR+++P GKVIR G+  K +GEGWPL
Sbjct: 350 KSN-DLHTTLNISLVDALTGF-STIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPL 407

Query: 333 NKNATRSGDLYIKFNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNIT 392
           + N    GD+Y++ NIEFP DNW +E ++I  +RN+LP +            KD      
Sbjct: 408 S-NGDSFGDMYVQINIEFPKDNWFNEKSEITALRNILPGLKS----------KDTKDPDP 456

Query: 393 MNSEDISNYDFVK---DLPDII----DTSHNNGAEYGHNGDSAN-FTEMP-ECSQQ 439
           +N+ED+ +Y  +    +LPD +    +  +    E  H     N +T+MP EC+ Q
Sbjct: 457 LNTEDVLSYSVLHSHDELPDYLAEEKEKYNRKQQEEPHASAFDNDYTQMPSECATQ 512

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  162 bits (409), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 121/396 (30%), Positives = 189/396 (47%), Gaps = 54/396 (13%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY +L V      +++KK YRK ALK+HPDK  + +  E         KFKEI SAYEIL
Sbjct: 7   LYDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSEEAAE---------KFKEITSAYEIL 57

Query: 72  SDEEKRKQYDLQKNFRDANQGSD-----------------YGDGINTAFGNQTSKDISIP 114
           SD +KR+ YD Q      +                     +G G +   G Q  +DI   
Sbjct: 58  SDSQKREVYD-QFGLEGLSGQGAGGPGGFGGFGEDLFSQFFGGGSSRPRGPQKGRDIRHE 116

Query: 115 LKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVR 174
           +  T++ L+ G+  +  + + +IC+ C G G +           + +C  C G G+K V 
Sbjct: 117 IPATLEQLFKGRTAKLALNKQLICKSCEGRGGKEGS--------VKKCTACSGQGFKFVT 168

Query: 175 QQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSD 234
           +Q+ P    +  + C++C G G         K  C  C+GK ++   + + VNI  G  D
Sbjct: 169 RQMGP-MIQRFQVECESCHGAGEII----DPKGRCKVCSGKKVVNERKVLEVNIEPGMKD 223

Query: 235 KDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFK 294
              I+   +ADQ  G    GD++FV+ E        KR G+ DL  +  I L  AI G +
Sbjct: 224 GQRIVFQGEADQSPG-IIPGDVVFVVSE--QPHPVFKRDGN-DLHYDAEIDLLSAIAGGQ 279

Query: 295 EKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPADN 354
               VK + G  L++ I  G+VI  G +  +EG+G P+ K     G+L IKFNI+FP  +
Sbjct: 280 F--AVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKYGGY-GNLLIKFNIKFPPAH 336

Query: 355 WN-----SEMNDIIKIRNL--LPAISDAKADILGDM 383
           +       ++ +I+  RN+  +PA ++ +  +L D 
Sbjct: 337 FTDDETLKKLEEILPPRNVPSIPADAEVEDCVLADF 372

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  157 bits (398), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 114/378 (30%), Positives = 185/378 (48%), Gaps = 49/378 (12%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY +L V       ++KK YRK ALKYHPDK  +++  +         KFK++ +AYEIL
Sbjct: 7   LYDLLGVSADANDAQIKKAYRKAALKYHPDKNPSSEAAD---------KFKQMTAAYEIL 57

Query: 72  SDEEKRKQYDLQKNFRDANQGSDY-------------------GDGINTAFGNQTSKDIS 112
           SD +KR+ YD          G                      G G +   G Q  +DI 
Sbjct: 58  SDSQKREVYDQFGEEGLNGGGGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQKGRDIK 117

Query: 113 IPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQ 172
             +  T+++LY G+  +  + + V+C+ C G G +S          + +C +C G G K 
Sbjct: 118 HDISCTLENLYKGRTAKLALNKTVLCKSCEGRGGKSGS--------VKKCSSCGGHGVKF 169

Query: 173 VRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGS 232
           V +Q+ P    +    C+ C+G+G         K+ C +C+GK I    + + VNI  G 
Sbjct: 170 VTRQMGP-MIQRFQTTCEACNGEGDVI----DPKDRCRECSGKKISNERKILEVNIEPGM 224

Query: 233 SDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITG 292
            +   ++   +ADQ+ G+   GD++FV+ E   E     R GD +L  E  I L  A+ G
Sbjct: 225 KNGQKVVFQGEADQQPGQI-PGDVVFVVNE--QEHPKFVRNGD-NLHYEAQIDLLTAVAG 280

Query: 293 FKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPA 352
            +    ++ + G  L++ I  G+VI  G +  +EG+G P+ K  +  G+L IKFN++FP 
Sbjct: 281 GQF--ALEHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKYGSY-GNLLIKFNVKFPK 337

Query: 353 DNWNSEMNDIIKIRNLLP 370
            ++ S+  D+ K+  +LP
Sbjct: 338 SHFASDA-DLKKLEEILP 354

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  154 bits (388), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 116/379 (30%), Positives = 182/379 (48%), Gaps = 50/379 (13%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY +L V       ++KK YRK ALKYHPDK  + +  +         KFK+I  AYEIL
Sbjct: 7   LYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSEEAAD---------KFKQITGAYEIL 57

Query: 72  SDEEKRKQYDLQKNFRDANQGSDY--------------------GDGINTAFGNQTSKDI 111
           SD +KR+ YD          G                       G G +   G Q  +DI
Sbjct: 58  SDSQKREMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQKGRDI 117

Query: 112 SIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYK 171
              +  T+++LY G+  +  + + V+C++C G G ++          + +C +C+G G K
Sbjct: 118 RHDISCTLENLYKGRAAKLALNKTVLCKRCEGRGGKAGS--------VKKCTSCNGQGVK 169

Query: 172 QVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRG 231
            V + + P    +    C+ C+G+G     PA+ +  C  C+GK I    + + VNI  G
Sbjct: 170 FVTRHMGP-MIQRFQTTCEVCNGEGDVI--PAADR--CKDCDGKKIASERKILEVNIQPG 224

Query: 232 SSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAIT 291
                 I+   +ADQ+ G+   GD++FV+ E   E     R GD +L  E  I L  AI 
Sbjct: 225 MKHGQKIVFQGEADQQPGQI-PGDVVFVVNE--QEHPRFVRNGD-NLHYEAEIDLLTAIA 280

Query: 292 GFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
           G +    ++ + G  L++ I  G+VI  G +  +EG+G P+ K  +  GDL IKFN++FP
Sbjct: 281 GGQF--ALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGS-YGDLLIKFNVKFP 337

Query: 352 ADNWNSEMNDIIKIRNLLP 370
             ++  E   + K+  +LP
Sbjct: 338 KSHFADE-EALKKLEAILP 355

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  152 bits (384), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 120/378 (31%), Positives = 179/378 (47%), Gaps = 48/378 (12%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY IL V  T +  E+KK YRK ALKYHPDK  + +  E         KFKE  SAYE+L
Sbjct: 7   LYDILGVSPTASDSEIKKAYRKQALKYHPDKNPSEEAAE---------KFKEASSAYEVL 57

Query: 72  SDEEKRKQYD------------------LQKNFRDANQGSDYGDGINTAFGNQTSKDISI 113
           SD EKR  YD                        D       G G +   G Q  +DI  
Sbjct: 58  SDSEKRDIYDQFGQDGLSGNGGMPGGAGGFGFGEDLFSQFFGGAGASRPRGPQRGRDIKH 117

Query: 114 PLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQV 173
            + V++++LY GK  +  + + ++C+ C G G +           + +C +C+G G K V
Sbjct: 118 EISVSLEELYKGKTSKLALNKQILCKTCEGRGGKKGA--------VKKCSSCNGQGIKFV 169

Query: 174 RQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSS 233
            +Q+ P    +    C  C G G        +K+ C  C+GK I    + + VN+  G  
Sbjct: 170 TRQMGP-MIQRFQTECDVCHGTGDII----DAKDRCKDCHGKKIANERKILQVNVDPGMK 224

Query: 234 DKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGF 293
           +   ++   +ADQ       GD+IFV+ E        +R GD DLI E  I L  A+ G 
Sbjct: 225 NGQKVVFKGEADQAP-DIIPGDVIFVISE--KPHKHFQRVGD-DLIYEAEIDLLTAVAGG 280

Query: 294 KEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPAD 353
           +    ++ + G  L++SI  G+VI       VEG+G P+ K     G+L IKF+I+FP +
Sbjct: 281 EF--ALEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQKYGGY-GNLIIKFSIKFPEN 337

Query: 354 NWNSEMNDIIKIRNLLPA 371
           ++  E + + K+  +LPA
Sbjct: 338 HFADE-DTLKKLEEILPA 354

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  151 bits (381), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 118/380 (31%), Positives = 183/380 (48%), Gaps = 51/380 (13%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
            Y +L V  T ++ E+KK YRK ALKYHPDK  + +  E         KFKE  SAYE+L
Sbjct: 7   FYDLLGVSATASETEIKKAYRKTALKYHPDKNPSEEAAE---------KFKEASSAYEVL 57

Query: 72  SDEEKRKQYD---------------------LQKNFRDANQGSDYGDGINTAFGNQTSKD 110
            D EKR+ YD                         F D      +G G +   G Q  +D
Sbjct: 58  MDAEKREAYDQFGEEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGGGASRPRGPQRGRD 117

Query: 111 ISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGY 170
           I   + VT+++LY G+  +  + + ++C+ C G G      GK+    + +C +C+G G 
Sbjct: 118 IKHEITVTLEELYKGRTSKLALNKQILCKTCEGRG------GKEGA--VKKCTSCNGQGV 169

Query: 171 KQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPR 230
           K + +Q+ P    +    C  CDG G       + K+ C  C+GK +    + + V++  
Sbjct: 170 KFITRQMGP-MIQRFQTECDACDGTGDII----NPKDRCKACSGKKVANERKILEVHVDP 224

Query: 231 GSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAI 290
           G  D   I+   +ADQ       GD+IFV+ E   +    +R  D DL+ E  I L  AI
Sbjct: 225 GMKDGQKIVFKGEADQ-APDIIPGDVIFVVSERPHKH--FRRDSD-DLVYEADIDLLTAI 280

Query: 291 TGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEF 350
            G +    ++ + G  L++ I  G+VI  G    +EG+G P+ K     G+L +KFNI F
Sbjct: 281 AGGEF--AIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKYGG-FGNLLVKFNIVF 337

Query: 351 PADNWNSEMNDIIKIRNLLP 370
           P D++ S + ++ K+  +LP
Sbjct: 338 PKDHFTS-LENMKKLEEILP 356

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  149 bits (377), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 121/384 (31%), Positives = 179/384 (46%), Gaps = 63/384 (16%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY  L V    +  E+KK YRK ALKYHPDK  + +  E         KFKE+ SAYEIL
Sbjct: 7   LYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAAE---------KFKEVSSAYEIL 57

Query: 72  SDEEKRKQYD-------------------------LQKNFRDANQGSDYGDGINTAFGNQ 106
           SD +KR+ YD                           + F  A  G   G         Q
Sbjct: 58  SDSQKREVYDQFGEEGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGRPRGP--------Q 109

Query: 107 TSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCD 166
             +DI   +  ++++LY G+  +  + + ++C+ C G G      GK+    + +C +C+
Sbjct: 110 RGRDIKHEMAASLEELYKGRTAKLALNKQILCKSCEGRG------GKEGA--VKKCSSCN 161

Query: 167 GAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITV 226
           G G K V +Q+ P    +    C  C G G        +K+ C  CNGK +    + + V
Sbjct: 162 GQGIKFVTRQMGP-MIQRFQTECDVCHGTGDII----DAKDRCKSCNGKKVDNERKILEV 216

Query: 227 NIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISL 286
            I  G  D   I+   +ADQ       GD++FV+ E        +R GD DLI E  I L
Sbjct: 217 RIEPGMKDGQKIVFKGEADQAPDVI-PGDVVFVISE--KPHKHFQRAGD-DLIYEAEIDL 272

Query: 287 ADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKF 346
             A+ G +    ++ + G  L++ I  G+VI  G    VEG+G P+ K     G+L IKF
Sbjct: 273 LTALAGGQF--ALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGG-YGNLLIKF 329

Query: 347 NIEFPADNWNSEMNDIIKIRNLLP 370
           NI+FP +++ SE N + K+  +LP
Sbjct: 330 NIKFPENHFTSEEN-LKKLEEILP 352

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  149 bits (375), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 120/411 (29%), Positives = 191/411 (46%), Gaps = 56/411 (13%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY +L V  T T  E+KK YRK+ALK+HPDK  + +  E         KFKE  SAYE+L
Sbjct: 7   LYDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSEEAAE---------KFKEASSAYEVL 57

Query: 72  SDEEKRKQYDLQKNFRDANQGSDY-------------------GDGINTAFGNQTSKDIS 112
           SD +KR  YD Q      +                        G G     G Q  +DI 
Sbjct: 58  SDADKRDTYD-QFGLEGLSGAGGMGGAGGGFGFGDDIFSQFFGGAGAQRPRGPQRGRDIK 116

Query: 113 IPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQ 172
             + VT+++LY GK  +  + + ++C+ C G G +           + +C +C+G G K 
Sbjct: 117 HEINVTLEELYRGKTSKLALNKQILCKTCEGRGGKKGA--------VKKCSSCNGQGIKF 168

Query: 173 VRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGS 232
           V +Q+ P    +    C  C G G         K+ C  CNGK +    + + V++  G 
Sbjct: 169 VTRQMGP-MIQRFQTECDVCHGAGDI----VDPKDRCKSCNGKKVASERKILEVHVDPGM 223

Query: 233 SDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITG 292
            +   ++   +ADQ       GD++FV+ E        +R GD +L+ E  + L  AI G
Sbjct: 224 KNGQKVVFKGEADQAPDVI-PGDVVFVINE--KPHKHFQRSGD-NLVYEAEVDLLTAIAG 279

Query: 293 FKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPA 352
            +    ++ + G  L+++I  G+VI  G    ++G+G P+ K     G+L IKF ++FP 
Sbjct: 280 GEF--AIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAKYGG-YGNLIIKFTVKFPE 336

Query: 353 DNWNSEMNDIIKIRNLLPAISDAKADILGDMPKD-DIFNITMNSEDISNYD 402
            ++ +E N + K+  +LP  +      L  MPK+  + +  +   D S YD
Sbjct: 337 PHFTTEEN-LKKLEEILPQRTP-----LPQMPKNAHVEDCVLAEFDPSKYD 381

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  148 bits (373), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 133/418 (31%), Positives = 195/418 (46%), Gaps = 58/418 (13%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
            Y IL V  T T  E+KK YRK ALKYHPDK  + +  E         KFKE  SAYEIL
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAE---------KFKEASSAYEIL 57

Query: 72  SDEEKRKQYD---------LQKNFRDANQGSDYGDGINTAF----------GNQTSKDIS 112
           SD EKR+ YD                   G  +GD I + F          G Q  KDI 
Sbjct: 58  SDSEKREVYDQFGEEGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIK 117

Query: 113 IPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQ 172
             +  ++++LY G+  +  + + ++C+ C G G +           + +C +C+G G K 
Sbjct: 118 HEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGA--------VKKCSSCNGQGIKF 169

Query: 173 VRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGS 232
           V +Q+ P    +    C  C G G         K+ C  CNGK +    + + V++  G 
Sbjct: 170 VTRQMGP-MIQRFQTECDVCHGTGDII----DPKDRCKSCNGKKVENERKILEVHVEPGM 224

Query: 233 SDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITG 292
            D   I+   +ADQ       GD++F++ E        KR GD DL+ E  I L  AI G
Sbjct: 225 KDGQRIVFKGEADQAPDVI-PGDVVFIVSE--RPHKNFKRDGD-DLVYEAEIDLLTAIAG 280

Query: 293 FKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPA 352
            +    ++ + G  L++ I  G+VI  G    +EG+G P+ K     G+L IKF I+FP 
Sbjct: 281 GEF--ALEHVSGDWLKVGIVPGEVISPGMRKVIEGKGMPIPKYGG-YGNLVIKFTIKFPE 337

Query: 353 DNWNSEMN-----DIIKIRNLLPAIS-DAKAD--ILGDMPKDDIFNITMNSEDISNYD 402
           +++ +E N     +I+  R ++PAI   A  D  +L D      +N T  S   +NYD
Sbjct: 338 NHFTTEENLKKLEEILPPR-IVPAIPKKATVDECVLADFDPAK-YNRTRASRGGANYD 393

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  147 bits (372), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 133/418 (31%), Positives = 196/418 (46%), Gaps = 58/418 (13%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
            Y IL V  T T  E+KK YRK ALKYHPDK  + +  E         KFKE  +AYEIL
Sbjct: 7   FYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAE---------KFKEASAAYEIL 57

Query: 72  SDEEKRKQYD---------LQKNFRDANQGSDYGDGINTAF----------GNQTSKDIS 112
           SD EKR  YD                   G  +GD I + F          G Q  KDI 
Sbjct: 58  SDPEKRDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIK 117

Query: 113 IPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQ 172
             +  ++++LY G+  +  + + ++C++C G G +           + +C +C+G G K 
Sbjct: 118 HEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGA--------VKKCTSCNGQGIKF 169

Query: 173 VRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGS 232
           V +Q+ P    +    C  C G G         K+ C  CNGK +    + + V++  G 
Sbjct: 170 VTRQMGP-MIQRFQTECDVCHGTGDII----DPKDRCKSCNGKKVENERKILEVHVEPGM 224

Query: 233 SDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITG 292
            D   I+   +ADQ       GD++F++ E      + KR GD DL+ E  I L  AI G
Sbjct: 225 KDGQRIVFKGEADQAPDVI-PGDVVFIVSE--RPHKSFKRDGD-DLVYEAEIDLLTAIAG 280

Query: 293 FKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPA 352
            +    ++ + G  L++ I  G+VI  G    +EG+G P+ K     G+L IKF I+FP 
Sbjct: 281 GEF--ALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGG-YGNLIIKFTIKFPE 337

Query: 353 DNWNSEMN-----DIIKIRNLLPAIS-DAKAD--ILGDMPKDDIFNITMNSEDISNYD 402
           +++ SE N     +I+  R ++PAI   A  D  +L D      +N T  S   +NYD
Sbjct: 338 NHFTSEENLKKLEEILPPR-IVPAIPKKATVDECVLADFDPAK-YNRTRASRGGANYD 393

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  146 bits (369), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 120/379 (31%), Positives = 179/379 (47%), Gaps = 50/379 (13%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
            Y IL V  T T  E+KK YRK ALKYHPDK  + +  E         KFKE  SAYEIL
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAE---------KFKEASSAYEIL 57

Query: 72  SDEEKRKQYD---------LQKNFRDANQGSDYGDGINTAF-----------GNQTSKDI 111
           SD EKR  YD                   G  +GD I + F           G Q  KDI
Sbjct: 58  SDSEKRDVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGGAGGAQRPRGPQRGKDI 117

Query: 112 SIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYK 171
              +  ++++LY G+  +  + + ++C+ C G G +           + +C +C+G G K
Sbjct: 118 KHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGA--------VKKCSSCNGQGIK 169

Query: 172 QVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRG 231
            V +Q+ P    +    C  C G G         K+ C  CNGK +    + + V++  G
Sbjct: 170 FVTRQMGP-MIQRFQTECDVCHGTGDI----VDPKDRCKSCNGKKVENERKILEVHVEPG 224

Query: 232 SSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAIT 291
             D   I+   +ADQ       GD++F++ E      + KR GD DL+ E  I L  AI 
Sbjct: 225 MKDGQRIVFKGEADQAPDVI-PGDVVFLVSE--RPHKSFKRDGD-DLVYEAEIDLLTAIA 280

Query: 292 GFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
           G +    ++ + G  L++ I  G+VI  G    +EG+G P+ K     G+L IKF ++FP
Sbjct: 281 GGEF--ALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGG-YGNLIIKFTVKFP 337

Query: 352 ADNWNSEMNDIIKIRNLLP 370
            +++ +E N + K+  +LP
Sbjct: 338 ENHFTAEEN-LKKLEEILP 355

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  146 bits (368), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 117/380 (30%), Positives = 179/380 (47%), Gaps = 51/380 (13%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
            Y IL V  + +  E+KK YRK ALKYHPDK  + +  E         KFKE  +AYE+L
Sbjct: 7   FYDILGVSPSASSSEIKKAYRKFALKYHPDKNPSEEAAE---------KFKEASAAYEVL 57

Query: 72  SDEEKRKQYD---------LQKNFRDANQGSDYGDGINTAF------------GNQTSKD 110
           SD+EKR+ YD                      +GD I + F            G Q  +D
Sbjct: 58  SDDEKREMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQRGRD 117

Query: 111 ISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGY 170
           I   L  T+++LY G+  +  + + ++C+ C G   R  K G      + +C +C+G G 
Sbjct: 118 IKHELSATLEELYKGRTAKLALNKQILCKTCEG---RGGKKGA-----VKKCSSCNGQGV 169

Query: 171 KQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPR 230
           K V +Q+ P    +    C+ C G G         K+ C  CN K +    + + V+I  
Sbjct: 170 KFVTRQMGP-MLQRFQAECEVCHGTGDII----DPKDRCKTCNAKKVTNERKILEVHIEP 224

Query: 231 GSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAI 290
           G  D   ++   +ADQ       GD+IFV+ +   E    +R GD DL+ E  I L  AI
Sbjct: 225 GMKDGQKVVFKGEADQ-APDIIPGDVIFVVSQKPHEH--FQRAGD-DLVYEAEIDLLTAI 280

Query: 291 TGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEF 350
            G +    +K + G  L+++I  G+VI  G    +  +G P+ K     G+L +KFNI+F
Sbjct: 281 AGGEF--AIKHVSGEWLKVAIVPGEVISPGARKIISDKGMPIPKYGGY-GNLIVKFNIKF 337

Query: 351 PADNWNSEMNDIIKIRNLLP 370
           P +++  E   + K+  +LP
Sbjct: 338 PPNHFTDE-ESLKKLEEILP 356

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  145 bits (367), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 119/378 (31%), Positives = 182/378 (48%), Gaps = 50/378 (13%)

Query: 13  YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
           Y +L V  + T+ E+KK YRK ALKYHPDK  + +  E         KFKE+ SAYE+LS
Sbjct: 8   YDLLGVSVSATEIEIKKAYRKSALKYHPDKNPSAEAAE---------KFKEVSSAYEVLS 58

Query: 73  DEEKRKQYD---------LQKNFRDANQGSDYGDGINTAF-----------GNQTSKDIS 112
           D EKR+ YD                      YGD I + F           G Q  +DI 
Sbjct: 59  DSEKRQVYDQFGEEGLSGGAGGAGGFGGFGGYGDDIFSQFFGGAPGGGRPRGPQRGRDIK 118

Query: 113 IPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQ 172
             + VT+++LY G+  +  + + ++C+ C G G +           + +C +C+G GYK 
Sbjct: 119 HEIAVTLEELYKGRTAKLALNKQILCKGCNGRGGKEG--------AVKKCSSCNGQGYKF 170

Query: 173 VRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGS 232
           V +Q+ P    +    C+ C G G         K+ C  CNGK +    + + V++  G 
Sbjct: 171 VTRQMGP-MIQRFQTECEACAGTGDII----DPKDRCKSCNGKKVANERKILEVHVDPGM 225

Query: 233 SDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITG 292
            D   I+   +ADQ       GD+IFV+ E        +R GD DL+ E  I L  A+ G
Sbjct: 226 KDGQKIVFKGEADQAPDVI-PGDVIFVVSE--KPHKNFQRVGD-DLVYEAEIDLLTAVAG 281

Query: 293 FKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPA 352
            +    ++ + G  L+++I  G+VI  G    VEG+G P+ K     G+L + F I FP 
Sbjct: 282 GEFS--LEHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAKFGGY-GNLLVTFKINFPP 338

Query: 353 DNWNSEMNDIIKIRNLLP 370
           +++ S+ N + K+  +LP
Sbjct: 339 NHFTSDEN-LKKLEEILP 355

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  145 bits (366), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 184/398 (46%), Gaps = 56/398 (14%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
            Y IL V  T ++ E+KK YRK ALKYHPDK  T +  E         KFKE  +AYE+L
Sbjct: 7   FYDILGVSPTASESEIKKGYRKAALKYHPDKNPTAEAAE---------KFKECSAAYEVL 57

Query: 72  SDEEKRKQYD----------LQKNFRDANQGSDYGDGINTAF----------GNQTSKDI 111
           SD EKR  YD                       +GD I + F          G Q  +DI
Sbjct: 58  SDPEKRDVYDQYGEEGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQRPRGPQKGRDI 117

Query: 112 SIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYK 171
              +  T+++LY G+  +  + + ++C+ C G G ++          + +C +C G G K
Sbjct: 118 KHEIAATLEELYKGRTAKLALNKQILCKSCEGRGGKADA--------VKKCSSCGGQGIK 169

Query: 172 QVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRG 231
            V +Q+ P    +    C  C G G         K  C  C+GK I    + + V I  G
Sbjct: 170 FVTKQMGP-MIQRFQTECDVCHGTGDII----DPKGRCKSCHGKKIANERKILEVKIEPG 224

Query: 232 SSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAIT 291
             D   I+   ++DQ       GD++FV+ E        +R G+ DL+    I L  AI 
Sbjct: 225 MKDGQRIVFKGESDQAP-DIIPGDVVFVVNE--KPHKHFQRSGN-DLVYLAEIDLLTAIA 280

Query: 292 GFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
           G +    ++ + G  L+++I  G+VI  G    +EG+G P+ K     G+L I+FNI+FP
Sbjct: 281 GGEF--ALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILKYGGY-GNLIIQFNIKFP 337

Query: 352 ADNWNSEMN-----DIIKIRN--LLPAISDAKADILGD 382
            +++  E N     +I+  RN   +PA ++ +  +L D
Sbjct: 338 ENHFTDESNLKKLEEILPPRNKVTIPAKAEVEECVLAD 375

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  145 bits (366), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 112/378 (29%), Positives = 179/378 (47%), Gaps = 48/378 (12%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
            Y +L V    ++ E+KK YRK ALKYHPDK  + +  E         KFKE  +AYE+L
Sbjct: 7   FYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSEEAAE---------KFKECSAAYEVL 57

Query: 72  SDEEKRKQYDLQKNFRDANQGSDY------------------GDGINTAFGNQTSKDISI 113
           SD +KR+ YD          G+                    G G     G Q  +DI  
Sbjct: 58  SDSQKREVYDQYGEEGLNGGGAGGFPGGGFGFGDDIFSQFFGGAGAQRPSGPQRGRDIKH 117

Query: 114 PLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQV 173
            ++ T+++LY G+  +  + + ++C+ C G G ++          + +C +C+G G K V
Sbjct: 118 EIQNTLEELYKGRTAKLALNKQILCKTCEGRGGKAGA--------VKKCTSCNGQGIKFV 169

Query: 174 RQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSS 233
            +Q+ P    +    C  C G G         K+ C  C GK I    + + V++  G  
Sbjct: 170 TRQMGP-MIQRFQTECDVCHGSGDII----DPKDRCKDCKGKKIANERKVLEVHVEPGMR 224

Query: 234 DKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGF 293
           +   I+   +ADQ       GD+IFV+  ++      KR GD DL+ E  I L  AI G 
Sbjct: 225 EGQKIVFKGEADQAPDVI-PGDVIFVV--VEKPHKHFKRAGD-DLLYEAEIDLLTAIAGG 280

Query: 294 KEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPAD 353
           +    ++ + G  L++S   G+VI  G    +EG+G P+ K     G+L + F I+FP +
Sbjct: 281 EF--AIQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPVPKYGG-YGNLIVTFKIKFPEN 337

Query: 354 NWNSEMNDIIKIRNLLPA 371
           N+ +E + + ++ N+LPA
Sbjct: 338 NFATE-DKLKELENILPA 354

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  145 bits (365), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 118/378 (31%), Positives = 180/378 (47%), Gaps = 49/378 (12%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
            Y IL V  T T  E+KK YRK ALK+HPDK  + +  E         KFKE  SAYE+L
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKFHPDKNPSEEAAE---------KFKEASSAYEVL 57

Query: 72  SDEEKRKQYD---------LQKNFRDANQGSDYGDGINTAF----------GNQTSKDIS 112
           SD EKR+ YD                   G  +GD I + F          G Q  +DI 
Sbjct: 58  SDSEKREVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPKGPQRGRDIK 117

Query: 113 IPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQ 172
             +  ++++LY G+  +  + + ++C++C G G +           + +C  C+G G K 
Sbjct: 118 HEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGA--------VKKCTGCNGQGIKF 169

Query: 173 VRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGS 232
           V +Q+ P    +    C  C G G         K+ C  CNGK I    + + V++  G 
Sbjct: 170 VTRQMGP-MIQRFQTECDACHGTGDI----VDPKDRCKSCNGKKIENERKILEVHVEPGM 224

Query: 233 SDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITG 292
            D   I+   +ADQ       GD++F++ E   +    KR GD DL+ E  I L  AI G
Sbjct: 225 KDGQKIVFKGEADQAPDVI-PGDVVFLVSERPHKH--FKRDGD-DLVYEAEIDLLTAIAG 280

Query: 293 FKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPA 352
            +    ++ + G  L++ I  G+VI  G    +EG+G P+ K     G+L +KF I+FP 
Sbjct: 281 GEF--ALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGG-YGNLIVKFTIKFPE 337

Query: 353 DNWNSEMNDIIKIRNLLP 370
           +++ +E N + K+  +LP
Sbjct: 338 NHFTTEEN-LKKLEEILP 354

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  145 bits (365), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 117/381 (30%), Positives = 177/381 (46%), Gaps = 52/381 (13%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY +L V  T    E+KK YRK ALKYHPDK  T +G E         KFKE+ +AYEIL
Sbjct: 7   LYDVLGVSPTAGDSEIKKAYRKSALKYHPDKNPTEEGAE---------KFKEVSAAYEIL 57

Query: 72  SDEEKRKQYD----------LQKNFRDANQGSDYGDGINTAF------------GNQTSK 109
           SD EKR+ YD                       +GD I + F            G Q  +
Sbjct: 58  SDSEKREIYDQFGEEGLNGGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQRGR 117

Query: 110 DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAG 169
           DI   +  T+++LY G+  +  + + ++C+ C G G +           + +C +C+G G
Sbjct: 118 DIKHEIAATLEELYKGRTAKLALNKQILCKTCEGRGGKKGA--------VKKCSSCNGQG 169

Query: 170 YKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIP 229
            K V +Q+ P    +    C  C G G         K+ C  CN K +    + + V+I 
Sbjct: 170 VKFVTRQMGP-MIQRFQAECDVCSGTGDII----DPKDRCKTCNAKKVTNERKILEVHIE 224

Query: 230 RGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADA 289
            G  D   I+   +ADQ       GD+IFV+ +        +R GD DL+ E  I L  A
Sbjct: 225 PGMKDGQNIVFKGEADQAPDVI-PGDVIFVVAQ--KPHKHFQRSGD-DLVYEAEIDLLTA 280

Query: 290 ITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIE 349
           I G +    ++ + G  L++SI  G+VI  G    +EG+G P+ K     G+L + F ++
Sbjct: 281 IAGGEF--ALEHVSGDWLKVSILPGEVISPGSKKVIEGKGMPIPKYGGH-GNLIVHFTVK 337

Query: 350 FPADNWNSEMNDIIKIRNLLP 370
           FP  ++  E + + K+  +LP
Sbjct: 338 FPQKHFADE-DSLKKLEEILP 357

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  142 bits (357), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 111/379 (29%), Positives = 174/379 (45%), Gaps = 50/379 (13%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY ++ V       ++KK YRK ALKYHPDK  T +  E         KFKEI SAYEIL
Sbjct: 7   LYDLIGVSPGADDAQIKKAYRKAALKYHPDKNPTEEAAE---------KFKEISSAYEIL 57

Query: 72  SDEEKRKQYDLQKNFRDA--------------------NQGSDYGDGINTAFGNQTSKDI 111
           SD +KR+ YD                            +Q      G +   G Q  +DI
Sbjct: 58  SDSQKREMYDQFGEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGGSSRPRGPQKGRDI 117

Query: 112 SIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYK 171
              +  T+++LY G+  +  + + ++C+ C G G ++          + +C +C+G G+K
Sbjct: 118 RHEISATLEELYKGRTAKLALNKQILCKSCEGRGGKAGA--------VKKCSSCNGQGFK 169

Query: 172 QVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRG 231
            + +Q+ P    +    C  C+G G        +K+ C  CNGK I    + + V+I  G
Sbjct: 170 FITRQMGP-MIQRFQAECDACNGTGDII----DAKDRCKACNGKKIANERKILEVHIEPG 224

Query: 232 SSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAIT 291
             D   I+   +ADQ         +  V E   +      R GD DL  E  + L  AI 
Sbjct: 225 MKDGQKIVFQGEADQAPDVVPGDVVFVVSERPHER---FNRKGD-DLYYEAEVDLLTAIA 280

Query: 292 GFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
           G +    V+ + G  L++ I  G+VI  G    +EG+G P+ K     G+L +KF I+FP
Sbjct: 281 GGEF--AVQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQKYGG-FGNLIVKFKIKFP 337

Query: 352 ADNWNSEMNDIIKIRNLLP 370
            +++  E + + ++ N+LP
Sbjct: 338 PNHFADEAS-LKQLENILP 355

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  142 bits (357), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 111/396 (28%), Positives = 177/396 (44%), Gaps = 84/396 (21%)

Query: 8   STKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISA 67
           S  +LY IL V  + ++ ++KK YR  ALK+HPDK   ++        E +LKF++I  A
Sbjct: 5   SNSELYDILGVSASASRQDIKKAYRVNALKHHPDKNGHSE--------ESKLKFQQICKA 56

Query: 68  YEILSDEEKRKQYD-----------LQKNFRDANQGSDYGDGINTAFGNQTSK------- 109
           YEIL DE KR+ YD            +        G   GD     FG  ++        
Sbjct: 57  YEILKDERKREMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDD 116

Query: 110 -----------------------DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGW 146
                                  DI   LK T++++Y+GK  +  +KR  +C+KC G G 
Sbjct: 117 MSFFGKRQGAHTAPSRRELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEGG 176

Query: 147 RSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSK 206
                        ++C TC G G +   ++  P   T  +  C +C G+G + K+    K
Sbjct: 177 LK----------ASQCYTCGGRGIRTETKRHGPMVQTWSS-TCSDCAGRGSFMKQ----K 221

Query: 207 NFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQ----ELGKFKT--GDLIFVL 260
           + C  CNG+G I       + + +G  +   +++  +AD+    ELG      GD+I +L
Sbjct: 222 DICRDCNGQGCIRERRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIIL 281

Query: 261 EEIDDEQTALKRYGDKDLI-----TELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGK 315
           E++     A  R+ D  L+      +L  SL          P      G+LL++ +  G+
Sbjct: 282 EQL--PHKAFWRHRDASLVLDHCKVDLKTSLCGGPVWVDSHP-----SGKLLKIDVLPGE 334

Query: 316 VIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
           +++ G I  VEG G P  K+  R G+LYI+F++ FP
Sbjct: 335 ILKPGAIKCVEGMGMP--KSGGRFGNLYIRFDVAFP 368

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  138 bits (348), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 108/378 (28%), Positives = 176/378 (46%), Gaps = 49/378 (12%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
            Y +L V       ++KK YRK ALK+HPDK  + +  +         KFKE+  AYE+L
Sbjct: 7   FYDLLGVPVDANDAQIKKGYRKQALKFHPDKNPSAEAAD---------KFKELTVAYEVL 57

Query: 72  SDEEKRKQYDLQKNFRDANQGSD-------------------YGDGINTAFGNQTSKDIS 112
           SD +KR  YD       +  G+                    +G G +   G Q  +DI 
Sbjct: 58  SDSQKRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGASRPRGPQKGRDIK 117

Query: 113 IPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQ 172
             +  ++++LY G+  +  + + V+C+ C G G      GK+    + +C +C+G G K 
Sbjct: 118 HEMSASLEELYKGRTAKLALNKQVLCKTCEGRG------GKEGA--VKKCASCNGQGVKF 169

Query: 173 VRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGS 232
           + +Q+ P    +    C  C+G G         K+ C  CNGK I    + + V+I  G 
Sbjct: 170 ITRQMGP-MIQRFQAECDACNGTGDI----VDPKDRCKTCNGKKIDNERKILEVHIEPGM 224

Query: 233 SDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITG 292
            D   I+   +ADQ  G    GD+IFV+ +   +    +R GD +L  +  + L  AI G
Sbjct: 225 KDGQKIVFQGEADQAPGVI-PGDVIFVISQRPHKH--FERKGD-NLYYQAEVDLLSAIAG 280

Query: 293 FKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPA 352
            +    ++ + G  L++ I  G+VI  G    +EG+G P+ K     GDL + F + FP 
Sbjct: 281 GEF--AIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKYGG-FGDLIVTFKVNFPT 337

Query: 353 DNWNSEMNDIIKIRNLLP 370
           +++  E   + K+  +LP
Sbjct: 338 NHFADE-ESLKKLEEILP 354

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  138 bits (348), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 108/382 (28%), Positives = 175/382 (45%), Gaps = 50/382 (13%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
            Y +L V       ++KK YRK ALK+HPDK  + +  +         KFKE+  AYEIL
Sbjct: 7   FYDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSEEAAD---------KFKELTVAYEIL 57

Query: 72  SDEEKRKQYDLQKNFRDANQGSDY--------------------GDGINTAFGNQTSKDI 111
           SD +KR  YD       +  G+                      G G     G Q  +DI
Sbjct: 58  SDSQKRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQRPRGPQKGRDI 117

Query: 112 SIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYK 171
              +  ++++LY G+  +  + + ++C+ C G G ++          + +C +C+G G K
Sbjct: 118 KHEMSASLEELYKGRTAKLALNKQILCKTCEGRGGKAGA--------VKKCSSCNGQGIK 169

Query: 172 QVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRG 231
            + +Q+ P    +    C  C G G         K+ C  CNGK I    + + V+I  G
Sbjct: 170 FITRQMGP-MIQRFQAECDVCSGTGDII----DPKDRCKSCNGKKIDNERKILEVHIEPG 224

Query: 232 SSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAIT 291
             D   I+   +ADQ  G    GD++FV+ +   +    +R GD DL+ +  + L  AI 
Sbjct: 225 MKDGQKIVFQGEADQAPG-IIPGDVVFVISQRPHKH--FERKGD-DLLYQAEVDLLSAIA 280

Query: 292 GFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
           G +    ++ + G  L++SI  G+VI  G    +EG+G P+ K     G+L + F I FP
Sbjct: 281 GGEF--AIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKYGGY-GNLIVTFKINFP 337

Query: 352 ADNWNSEMNDIIKIRNLLPAIS 373
            +++  E   + K+  +LP  S
Sbjct: 338 TNHFADE-ESLKKLEEILPPRS 358

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  134 bits (337), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 177/385 (45%), Gaps = 52/385 (13%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
            Y +L V    ++ E+KK YRK ALKYHPDK  T +  E         KFKE   AYE+L
Sbjct: 7   FYDLLGVSPNASESEIKKGYRKAALKYHPDKNPTDEAAE---------KFKECSGAYEVL 57

Query: 72  SDEEKRKQYDLQKNFRDANQGSDY------------------GDGINTAFGNQTSKDISI 113
           SD +KR+ YD       +  G                     G G +   G Q  KDI  
Sbjct: 58  SDSQKREIYDQYGEEGLSGGGPGAGFGGFGGFGDDIFSQFFGGAGASRPRGPQRGKDIRH 117

Query: 114 PLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQV 173
            ++ T+++LY G+  +  + + ++C+ C G G      GK+    + +C +C G G K V
Sbjct: 118 EIQNTLEELYKGRTAKLALNKQILCKGCEGRG------GKEGA--VKKCSSCGGQGVKFV 169

Query: 174 RQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSS 233
            +Q+ P    +    C  C G G         K+ C +C G  +    + + V++  G  
Sbjct: 170 TRQMGP-MIQRFQTECDVCHGSGDII----DPKDRCKECKGNKVANERKVLEVHVEPGMR 224

Query: 234 DKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITG- 292
           +   +    +ADQ       GD+IFV+ E        KR GD DL+ E  + L  AI G 
Sbjct: 225 EGQKVTFKGEADQAP-DIIPGDVIFVVTE--KPHKHFKRSGD-DLLYEAEVDLLTAIAGG 280

Query: 293 -FKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
            F     ++ + G  L+++I  G+VI  G    ++G+G P+ K     G+L I F I+FP
Sbjct: 281 DF----AIEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQKYGG-YGNLIITFKIKFP 335

Query: 352 ADNWNSEMNDIIKIRNLLPAISDAK 376
            +++  E   +  + ++LP  ++ K
Sbjct: 336 ENHFADEAK-LKALEDILPPRTEVK 359

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  130 bits (328), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 113/384 (29%), Positives = 176/384 (45%), Gaps = 56/384 (14%)

Query: 8   STKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISA 67
           + +D Y IL V++     E+K  YR+L+ KYHPDK     GDE     E   KF E+  A
Sbjct: 19  NAQDYYKILGVNKDANDKEIKSAYRQLSKKYHPDK---NPGDE-----EAHNKFIEVGEA 70

Query: 68  YEILSDEEKRKQYDLQ-----KNFRDANQGSDYGDGINTAF--------GN--------- 105
           Y++LSD EKR  YD       KN  +  +    G   +  F        GN         
Sbjct: 71  YDVLSDSEKRNIYDQYGADAIKNGGNGQRPGGGGSPFHDPFEMFEKMFNGNPFGGAARGG 130

Query: 106 ------QTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPL 159
                    +++ +  +V++ D YNG+  +Y+++ N  CEKC G G    K+GK     +
Sbjct: 131 PGGRGRPRGQNLLLREEVSLMDFYNGREFKYNLQLNDFCEKCHGTG---SKDGK-----V 182

Query: 160 TECKTCDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGII 218
           T C  C G G   + Q I  G  T+Q   VC  C G G   K P      C  C+G  + 
Sbjct: 183 TRCPDCQGRGV--IVQVIQMGIMTQQIQHVCDRCSGSGEIIKNP------CPHCHGHKVA 234

Query: 219 EISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDL 278
           ++ +  TV +P G+  ++ + I +   ++   F  GDL+F   E        +R GD   
Sbjct: 235 KMDKEFTVKLPNGAQ-RNYVDIKHGEAEKGADFDAGDLMFEFRENSMNNMGYRRRGDHLY 293

Query: 279 ITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWP-LNKNAT 337
            TE+ +S+ +A+ G  E+ +      + ++L     +V+  G+I  V G G P LN    
Sbjct: 294 RTEV-LSVQEALKGGWERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGR 352

Query: 338 RSGDLYIKFNIEFPADNWNSEMND 361
           + GDL+I + I  P +  N++  D
Sbjct: 353 KFGDLFIDYVILMPQEFKNTKFTD 376

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score =  129 bits (323), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 111/394 (28%), Positives = 182/394 (46%), Gaps = 73/394 (18%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           + LY +L V    +Q E+KK YRKLAL+YHPDK    +GDE     +    F++I  AY 
Sbjct: 2   ESLYDVLGVASDASQSEIKKAYRKLALRYHPDK---NNGDE-----KCHEAFQKISHAYG 53

Query: 70  ILSDEEKRKQYDLQKNFRDANQ--GSDYGDGINTAFGN------------------QTSK 109
           +L D  +R++YD   +  ++ Q  GS+  D  ++ F                        
Sbjct: 54  VLGDVAQRQRYDQSGDENESLQPTGSNAADLFSSFFNGGGVYPSGSSGGPGPSRGPSRGP 113

Query: 110 DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAG 169
           +I   LK T++DLY GK+I+  ++R   CE+C  LG                C +C+G+G
Sbjct: 114 NIIHELKCTLQDLYRGKVIKLALRRTAPCERC-SLG------------AANVCSSCNGSG 160

Query: 170 YKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIP 229
                +++ P      +  C  C G+GR           C +C G   +       V++ 
Sbjct: 161 NITRIERVGP-LTQTWSSTCNACQGQGRMSVD-------CSQCGGAQYLNERVVFKVHVK 212

Query: 230 RGSSDKDTIIIDNKADQ----ELGKF---KTGDLIFVLEEIDD---EQTALKRYGDKDLI 279
            G  D  TI++D +ADQ     LG     ++GD++ V+ E+ D   +++AL +  +   +
Sbjct: 213 PGMHDGQTIVLDGEADQCVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNKR-ENLFV 271

Query: 280 TELTISLADAITG----FKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKN 335
            ++ + L  A+TG     ++ P      G L++++I  G+ +    I  VEG G P++  
Sbjct: 272 DQVKVDLTTALTGGNVLLEDHP-----SGNLMKINILPGEFLPENCIKCVEGLGMPIDDT 326

Query: 336 ATRSGDLYIKFNIEFPADNWNSEMNDIIKIRNLL 369
             R GDLYI+F    P      E   I K+R +L
Sbjct: 327 GQR-GDLYIRFCTHSP---LQLEPETIDKLREVL 356

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  124 bits (312), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 109/395 (27%), Positives = 175/395 (44%), Gaps = 87/395 (22%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           DLY  L V    ++ E+KK YR  ALK+HPDK    +G  +  KL    KF++I  AYEI
Sbjct: 8   DLYDTLGVAANASRQEIKKAYRLKALKHHPDK----NGHSEQSKL----KFQQICKAYEI 59

Query: 71  LSDEEKRKQYDL------------QKNFRDANQGSDYGD--------------------- 97
           L D++KR+ YD               N+ + + G   GD                     
Sbjct: 60  LGDDKKREMYDRFGTADETQWHTEATNYEEPS-GMSAGDLFSQFFGGGSTTGGFFSEGMD 118

Query: 98  --GINTAFGNQTSK--------DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWR 147
             G +  F  Q S+        DI   LK T++++YNGK  +  +KR  +C+ C G G  
Sbjct: 119 FFGSSRGFRAQGSRRSAPQRGPDIKHYLKCTLEEMYNGKRAKLALKRTRLCQTCQGEG-- 176

Query: 148 SRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKN 207
           S+K         T C  C G G +   ++  P      +  C  C G G   K      +
Sbjct: 177 SKK--------ATSCYACRGKGMQTQTKRQGP-IMQTWSSTCGTCGGSGTIVK----PSD 223

Query: 208 FCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQ-ELGKFKT-----GDLIFVLE 261
            C  C+G+G +   +   + + +G  +  T+++  +AD+  + K+ +     GD+I +LE
Sbjct: 224 ICNGCHGQGWVRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVIIILE 283

Query: 262 EIDDEQTALKRYGDKDLI-----TELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKV 316
           ++     +LKR  D  L+      +L  SL          P      G++L++ +  G++
Sbjct: 284 QLPHR--SLKRGHDSSLLLSECQVDLKTSLCGGTVWVDSHP-----SGKVLKIDVIPGEL 336

Query: 317 IRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
           ++ G I  V+  G P +K     GDL+IKF + FP
Sbjct: 337 LKPGAIKCVQSMGMPKSKGGY--GDLFIKFKVIFP 369

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  123 bits (308), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 110/371 (29%), Positives = 167/371 (45%), Gaps = 58/371 (15%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
            +D YAIL++ +  ++ E+K  YR+L+ KYHPDK   +D        E   KF EI  AY
Sbjct: 21  AQDYYAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGSD--------EAHHKFIEIGEAY 72

Query: 69  EILSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGN----------------------- 105
           E+LSD EK+K YD        N G   G      F +                       
Sbjct: 73  EVLSDPEKKKIYDQFGADAVKNGGGGAGGPGGGGFHDPFDIFERMFQGGQGGPGGGFGQR 132

Query: 106 --QTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECK 163
             Q    I +   +++K  Y+G  I + +  N  C+ C G G     +GK     L +C 
Sbjct: 133 QRQRGPTIKVHENLSLKQFYSGTSIEFTLSLNDECDGCHGSG---SADGK-----LAQCP 184

Query: 164 TCDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISE 222
            C G G   + Q +  G  T+Q   +C  C G G+        KN C  C+GK + + ++
Sbjct: 185 DCQGRGI--IVQVVRMGIMTQQIQQICGRCAGTGQVI------KNQCKTCHGKKVTKKNK 236

Query: 223 SITVNIPRGSSDKDTIIIDNKA-DQELGK-FKTGDLIFVLEEIDDEQTALKRYGDKDLIT 280
              V++P G+       +D +A + E G  F  GDL+    E+D E    +R G     T
Sbjct: 237 FFHVDVPPGAPRN---YMDTRAGEAEKGPDFDAGDLVIEFREMDTENMGYRRRGHNLYRT 293

Query: 281 ELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSG 340
           E+ +S A+A+ G  E+ I    + + ++LS P   V+  G+I  V+G G P  K +   G
Sbjct: 294 EV-LSAAEALYGGWERTIEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGMP--KGSRDHG 350

Query: 341 DLYIKFNIEFP 351
           DLYI + +  P
Sbjct: 351 DLYIDYVVVMP 361

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score =  122 bits (305), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 109/381 (28%), Positives = 172/381 (45%), Gaps = 55/381 (14%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
            +D YAIL V    +  ++K  YR+L+ KYHPDK     GDED        +F E+  AY
Sbjct: 19  AQDYYAILGVGRGASDKDIKSAYRQLSKKYHPDK---NPGDEDA-----HNRFIEVGEAY 70

Query: 69  EILSDEEKRKQYD------------------LQKNFRDANQGSD--YGDGINTAF---GN 105
           E LSD EKRK YD                      F D     D  +G G  + F   G 
Sbjct: 71  EALSDPEKRKIYDQFGAEALKNGGDRAGGGGAGGGFHDPFDIFDQMFGGGAGSRFHGGGG 130

Query: 106 QTSKDISIPLKV----TIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTE 161
           Q  K     L+V     +K  Y+G  I + +  N  C+ C G G +  K        + +
Sbjct: 131 QRRKQRGQSLQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSGSQDGK--------VEK 182

Query: 162 CKTCDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEI 220
           C  C G G   V Q I  GF T+Q   +C+ C+G+G         KN C  C+G  +++ 
Sbjct: 183 CGQCGGRG--MVVQVIRQGFITQQIQQMCQKCEGRGEVI------KNKCKTCHGSKVVKK 234

Query: 221 SESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLIT 280
           ++S  V++P G+      +I  +A++     + GD+   + E   +    +R G  DL  
Sbjct: 235 NKSFHVDVPAGAPRDFVAVIRGEAEKSPDT-EPGDIYVKVVESPVQNMGYRRRG-PDLFR 292

Query: 281 ELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSG 340
              +SL +A+ G   + +      + + LS   G  ++ G++  ++G G PL ++ T+ G
Sbjct: 293 TEVLSLTEALKGGWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPL-ESGTKYG 351

Query: 341 DLYIKFNIEFPADNWNSEMND 361
           DLY+ + I  P+    + +ND
Sbjct: 352 DLYVDYVIVMPSKYKPAPLND 372

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  123 bits (308), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 121/448 (27%), Positives = 192/448 (42%), Gaps = 98/448 (21%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY +L V   ++  ELKK Y+  AL+YHPDK    +G  +  K     +F++I  AY +L
Sbjct: 7   LYDVLGVQPGVSAAELKKSYKLAALRYHPDK----NGHSEASKQ----RFQQIADAYRVL 58

Query: 72  SDEEKRKQYD----------------------------LQKNFRDANQG----SDYGD-G 98
            DE  RK YD                            L  +F    QG    + +G+ G
Sbjct: 59  GDERLRKIYDRYGTVDEGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGLGSFAIFGESG 118

Query: 99  INTAFGNQTSK--DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYV 156
            ++A  ++ S+  DI   L+ T+++LY GK++R  + R  +C  C G G  SR       
Sbjct: 119 ASSARCSRVSRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLCAGRGG-SRA------ 171

Query: 157 PPLTECKTCDGAGY-KQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGK 215
              + C  C G G   Q ++Q +       +  C+ C G G   K      + C  C G 
Sbjct: 172 ---STCTACSGQGICSQTKRQGS--LVQTWSSTCRVCSGSGTIVK----DCDTCTSCGGA 222

Query: 216 GIIEISESITVNIPRGSSDKDTIIIDNKADQEL----GKFKT--GDLIFVLEEIDDEQTA 269
           G +   +   V I  G      ++   +AD+ +    GK +   GDL   +EE     T 
Sbjct: 223 GYLRERKVFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEE----ATP 278

Query: 270 LKRY---GDKDLI-TELTISLADAITG----FKEKPIVKTLDGRLLRLSIPVGKVIRFGD 321
             RY   GD +L+ TEL + L  ++ G     ++ P      G+L++L I  G+++  G 
Sbjct: 279 ATRYQCRGDANLLLTELHVDLRTSLCGGTVYIEDHP-----SGKLIQLEIIPGELLEPGA 333

Query: 322 ILKVEGEGWPLNKNATRSGDLYIKFNIEFPADNWNSEMNDI---------IKIRNLLPAI 372
           I  +E  G P   + ++ G L+IKF+++FP    +S +  I         ++ R    A 
Sbjct: 334 IKCIEHLGMPHPDDPSQYGHLFIKFHVDFPKTLADSTITAIAQALDADTNVRTRTPPAAA 393

Query: 373 SDAKADILG------DMPKDDIFNITMN 394
              +  +L       D PK  I N TM 
Sbjct: 394 DGCEEHVLSNFHHDLDTPKRHIHNSTMR 421

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score =  120 bits (301), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 110/377 (29%), Positives = 168/377 (44%), Gaps = 68/377 (18%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
            +D YAILE+D+  T+ E+K  YR+L+ KYHPDK   ++        E   KF E+  AY
Sbjct: 21  AQDYYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSE--------EAHQKFIEVGEAY 72

Query: 69  EILSDEEKRKQYD-----LQKNFRDANQG--------SDYGDGINTAFG----------- 104
           ++LSD EK+K YD       KN                D  D     F            
Sbjct: 73  DVLSDPEKKKIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMFQGGHGGPGGGFG 132

Query: 105 ---NQTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTE 161
               Q    I +  K+++K  Y+G  I + +  N  C+ C G G     +GK     L +
Sbjct: 133 QRQRQRGPMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSG---SADGK-----LAQ 184

Query: 162 CKTCDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEI 220
           C  C G G   + Q +  G  T+Q   +C  C G G+        KN C  C+GK + + 
Sbjct: 185 CPDCQGRGV--IIQVLRMGIMTQQIQQMCGRCGGTGQII------KNECKTCHGKKVTKK 236

Query: 221 SESITVNIPRGSSDKDTIIIDNKADQELGK------FKTGDLIFVLEEIDDEQTALKRYG 274
           ++   V++P G+         N  D  +G+      F  GDL+   +E D E    +R G
Sbjct: 237 NKFFHVDVPPGAP-------RNYMDTRVGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRG 289

Query: 275 DKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNK 334
           D    TE+ +S A+A+ G  ++ I    + + ++LS P   V+  G++  V+G G P  K
Sbjct: 290 DNLYRTEV-LSAAEALYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMP--K 346

Query: 335 NATRSGDLYIKFNIEFP 351
            +   GDLYI + +  P
Sbjct: 347 GSKGYGDLYIDYVVVMP 363

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  119 bits (299), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 107/384 (27%), Positives = 171/384 (44%), Gaps = 58/384 (15%)

Query: 8   STKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISA 67
           + +D YAIL V +  ++ ++K  YR+++ K+HPDK     GD+     E   KF EI  A
Sbjct: 16  AAQDYYAILGVAKDASEKDIKSAYRQMSKKWHPDK---NAGDD-----EAHHKFIEIGEA 67

Query: 68  YEILSDEEKRKQYD---------------LQKNFRDANQGSDYGDGINTAFGN------- 105
           YE+LSD EKR  YD                           D  D  N  FG+       
Sbjct: 68  YEVLSDSEKRATYDRFGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFGDSHPGGQN 127

Query: 106 -QTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKT 164
            +   ++ +   VT+   Y+G      +  N  CE C G G    +           C+T
Sbjct: 128 VRKGSNLIVKDSVTLNGFYHGFYANLTLDLNDDCEHCHGSGAEDNQ--------FATCET 179

Query: 165 CDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISES 223
           C G G   + Q I  GF T+Q   VC  C GKG+      + K+ C  C G  +++  ++
Sbjct: 180 CQGRGV--IIQVIQMGFMTQQIQQVCGACQGKGK------TIKHVCKICRGARVVKTPKT 231

Query: 224 ITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELT 283
             +++P G+     ++   +A++ +   ++GDL+FV EE   E    +R GD    TE+ 
Sbjct: 232 FEISVPAGAQRNYNVVKSGQAEK-VPDMQSGDLVFVFEENSHENLGYRRRGDHLYRTEV- 289

Query: 284 ISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWP-LN---KNATRS 339
           +   +A+ G  E+ I    D + + +      V   G+I +V   G P LN   K+    
Sbjct: 290 LHWKEALLGGWERRIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKLNSKGKSTNAY 349

Query: 340 GDLYIKFNI----EFPADNWNSEM 359
           GDL+I++ I    EFP+   + E+
Sbjct: 350 GDLFIEYVIVSPKEFPSGKGSPEI 373

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score =  119 bits (298), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 102/377 (27%), Positives = 163/377 (43%), Gaps = 52/377 (13%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
            +D Y ILE+D+  T  +++  YR+L+ KYHPDK      DED        KF E+  AY
Sbjct: 20  AQDYYKILELDKDATDKDIRSAYRQLSKKYHPDK---NPNDEDA-----HHKFIEVGQAY 71

Query: 69  EILSDEEKRKQYD---------------LQKNFRDA--------NQGSDYGDGINTAFGN 105
           EILSD EKR++YD                   F D           G   G      F  
Sbjct: 72  EILSDPEKRQRYDQFGPEGVNGQNGGGPGGAGFHDPFDIFEQMFGGGGGMGGHGGNPFQQ 131

Query: 106 QTSKDISIPLK--VTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECK 163
           Q  +  ++  +   ++K+ YNG ++++ I  N IC+ C G G    K+        T+C 
Sbjct: 132 QRQRGQNVVARESTSLKNYYNGYVLKFSINLNDICDHCHGSGSNDGKS--------TKCP 183

Query: 164 TCDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISE 222
            C G G     Q I  G  T+Q   VC  C GKG+  K P      C  C+G  +++  +
Sbjct: 184 DCQGRGV--TVQVIRMGMMTQQIQQVCGKCGGKGQIIKNP------CKTCHGSKVVQKPK 235

Query: 223 SITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITEL 282
              + +P G+  K        AD+    + +GD+     E D +    +R G     TE+
Sbjct: 236 DFEIELPAGAPRKFVHAEHGAADKH-PDYDSGDVYIEFTENDKDNMGYRRRGPHLYRTEV 294

Query: 283 TISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDL 342
            ++  +A+ G  E+ +      +++ +     K+I+ G+  ++ G G PL       GDL
Sbjct: 295 -LNATEALYGGWERQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKGFGDL 353

Query: 343 YIKFNIEFPADNWNSEM 359
           +I + +  P      E+
Sbjct: 354 FIDYVVVMPESLSGEEL 370

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score =  120 bits (302), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 115/449 (25%), Positives = 197/449 (43%), Gaps = 114/449 (25%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY ILEV+ T T+ E+KK YRK ALK+HPDK    +   + +KL     F++I  AYE L
Sbjct: 7   LYDILEVNTTATEQEIKKAYRKKALKHHPDK---NNHSAESIKL-----FQDISHAYETL 58

Query: 72  SDEEKRKQYD---------LQKNFRDANQGSDYGDGINTAFGNQTSKD------------ 110
           S+  KR+ YD         + +     N G+   +G +  F   T+ D            
Sbjct: 59  SNSNKRELYDQYGTVDEGEISEIIAKQNMGNTGSNGNSHPFSAHTAGDLFAQFFGGRGSS 118

Query: 111 -------------ISIPLKVTIKD----------------LYNGKIIRYDIKRNV----- 136
                        ++ P +    D                + +G  IR+++K N+     
Sbjct: 119 GTGASGFGFMRGMVNGPFQSFSHDFNMNSMADFEDDGSHEMASGPGIRHNLKCNLYDLFH 178

Query: 137 ------------ICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTK 184
                       +C++C G G +            T+C+ C G G     +++ P   T 
Sbjct: 179 GKRAKLALNRTRLCQRCQGYGGKK----------ATQCRGCQGTGLFTTTKRMGPMVQTW 228

Query: 185 QNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKA 244
           Q   CK C G G+Y +    SK+ C +C+G G I+  +   V +  G  + + II+  +A
Sbjct: 229 QT-TCKECSGTGKYIR----SKDACTECSGNGFIKERKFFDVEVLPGMRNGNEIILPGEA 283

Query: 245 DQ----ELGKFKT--GDLIFVLEEIDDEQTALK-RY--GDKDLI-----TELTISLADAI 290
           D+    E GK +   GD+I  ++   +E++ ++ +Y   D DLI      +L  SL    
Sbjct: 284 DEVINTEYGKERVIPGDVIITIQLTRNEESNMRYKYLVHDHDLILDNFEVDLKTSLCGGT 343

Query: 291 TGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEF 350
              ++ P      G   ++ +  G++++ G I  VE +G P++ N    G+LYI+F ++F
Sbjct: 344 IIIEDHP-----SGNPFKIEVLSGELLKPGCIKCVENKGMPVDSNGN-FGNLYIRFRVKF 397

Query: 351 P----ADNWNSEMNDIIKIRNLLPAISDA 375
           P    +D  N     +++  N+   +SD+
Sbjct: 398 PEQLKSDTINKLSEILVQDENISSILSDS 426

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score =  119 bits (297), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 114/374 (30%), Positives = 171/374 (45%), Gaps = 61/374 (16%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
            +D YAILEVD+  ++ E+K  YR+L+ KYHPDK     G E     E   KF E+  AY
Sbjct: 21  AQDYYAILEVDKDASEKEIKSAYRQLSKKYHPDK---NSGSE-----EAHHKFIEVGEAY 72

Query: 69  EILSDEEKRKQYD-----LQKNFRDANQG---------SDYGDGINTAFG---------- 104
           ++LSD EK+K YD       KN      G          D  D     F           
Sbjct: 73  DVLSDPEKKKIYDQFGADAVKNGGGGGGGAGGPGGGGFHDPFDIFEHMFQGGHGGPGGGF 132

Query: 105 ----NQTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLT 160
                Q    I +  K+++K  Y+G  I + +  N  C+ C G G     +GK     L 
Sbjct: 133 GQRQRQRGPMIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSG---SADGK-----LA 184

Query: 161 ECKTCDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIE 219
           +C  C G G   + Q +  G  T+Q   +C  C G G+        KN C  C+GK +I+
Sbjct: 185 QCPDCQGRGV--IIQVLRMGIMTQQIQQMCGRCGGTGQII------KNQCKTCHGKKVIK 236

Query: 220 ISESITVNIPRGSSDKDTIIIDNKA-DQELGK-FKTGDLIFVLEEIDDEQTALKRYGDKD 277
            ++   V++P G+       +D +A + E G  F  GDL+   +E D E    +R GD  
Sbjct: 237 KNKFFHVDVPPGAPRN---YLDTRAGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNL 293

Query: 278 LITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNAT 337
             TE+ +S  +A+ G  ++ I    + + ++LS P   V+  G+I  ++G G P  K+  
Sbjct: 294 YRTEV-LSAEEALYGGWQRTIEFFDENKPVKLSRPAHVVVSNGEIEVLKGFGMP--KSGK 350

Query: 338 RSGDLYIKFNIEFP 351
             GDLYI + +  P
Sbjct: 351 GHGDLYIDYVVIMP 364

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  115 bits (289), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 104/377 (27%), Positives = 163/377 (43%), Gaps = 52/377 (13%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
            +D Y+IL V +     ++K  YR+L+ KYHPDK    D   +        KF E+  AY
Sbjct: 18  AQDYYSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDDDSAHN--------KFIEVGEAY 69

Query: 69  EILSDEEKRKQYD------LQKNFRDANQGSDYGDGINTAF-----------------GN 105
           E+LSD EKRK YD      L+ N          G G +  F                   
Sbjct: 70  EVLSDPEKRKIYDQYGAEALKNNGGQGGGQGPRGGGFHDPFDIFEQMFGGGGGGQRQRRR 129

Query: 106 QTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTC 165
               ++    ++T+K+ Y G  I +++  N  CE C G G +  K        +T+C  C
Sbjct: 130 ARGHNLETREELTLKEYYRGTSIDFNLNLNDFCEHCEGSGSQDGK--------VTKCPDC 181

Query: 166 DGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESI 224
            G G   V Q +  G  T+Q   +C  C G+G      ++ KN C  C+G+ ++   +S 
Sbjct: 182 KGHGV--VVQIVRMGPVTQQIQQMCGKCQGRG------STIKNKCKHCHGEKVVRKPKSF 233

Query: 225 TVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTI 284
            V++P G+  ++ + +      +   F  GDL     E   +    +R GD DL     +
Sbjct: 234 HVDVPPGAP-RNFVEVKQGESDKGPDFDAGDLFIKFSETSRDNLGYRRRGD-DLFRTEAL 291

Query: 285 SLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYI 344
           SL +A+ G  E+ I      R +++      V   G+I ++ G G P  K   + GDLYI
Sbjct: 292 SLREALKGGWEREIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMP--KEHNKFGDLYI 349

Query: 345 KFNIEFPADNWNSEMND 361
            + +  P D   S + D
Sbjct: 350 DYVVIVPDDIATSPIKD 366

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score =  115 bits (289), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 100/374 (26%), Positives = 165/374 (44%), Gaps = 56/374 (14%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
            +D Y+IL +++  +  ++K  YR+L+ KYHPDK     GDE   +     +F E+  AY
Sbjct: 17  AQDYYSILGLNKDASDKDVKSAYRQLSKKYHPDK---NPGDESAHQ-----RFIEVGEAY 68

Query: 69  EILSDEEKRKQYD-------------------LQKNFRDA--------NQGSDYGDGINT 101
           E+LSD EKR  +D                       F D         N+G   G     
Sbjct: 69  EVLSDPEKRGIFDQYGADGLKNGAGGGGGPGGGFGGFHDPFDIFEQMFNRGGGGGGFGGG 128

Query: 102 AFGNQTSKDISIPL--KVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPL 159
             G    K  S+ +  ++++KD Y+G  + +++  N IC+ C G G    ++GK     +
Sbjct: 129 FGGMHRGKGPSLRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSG---SEDGK-----V 180

Query: 160 TECKTCDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGII 218
             C  C G G   + Q I  G  T++    C  C G+G   K      N C  C G  ++
Sbjct: 181 ETCPDCGGQGI--LIQIIRMGIMTQRIQQPCGRCSGRGHIIK------NQCKACGGHKVV 232

Query: 219 EISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDL 278
           +  +S  V +P G+      +   +ADQ     + GD+     E D      +R GD   
Sbjct: 233 KKPKSFQVEVPAGAPRDHVEVRHQEADQST-DMEAGDIFVEFTESDKNNMGYRRRGDHLF 291

Query: 279 ITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATR 338
            TE+ +S  +A+ G   + I    D + ++L  P G ++  G+I ++ G G P   +   
Sbjct: 292 RTEV-LSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGKS 350

Query: 339 SGDLYIKFNIEFPA 352
            GDL++++ +  PA
Sbjct: 351 FGDLFVEYAVVMPA 364

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  112 bits (280), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 106/371 (28%), Positives = 167/371 (45%), Gaps = 58/371 (15%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
            +D YAILE+D+  ++ E+K  YR+L+ K+HPDK   ++        E   KF E+  AY
Sbjct: 21  AQDYYAILEIDKGASEKEIKSAYRQLSKKFHPDKNAGSE--------EAHQKFIEVGEAY 72

Query: 69  EILSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGN----------------------- 105
           ++LSD EK+K YD        N G   G      F +                       
Sbjct: 73  DVLSDPEKKKIYDQFGAEAVKNGGDGAGGPGAGGFHDPFDIFERMFQGGHGGTGGGFGQR 132

Query: 106 --QTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECK 163
             Q    I +  K+++K  Y+G  I + +  N  C+ C G G     +GK     L +C 
Sbjct: 133 QRQRGPMIKVQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSG---SADGK-----LAQCP 184

Query: 164 TCDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISE 222
            C G G   + Q +  G  T+Q   +C  C G G+        KN C  C+G  + + ++
Sbjct: 185 DCQGRGV--IIQVLRMGIMTQQIQQMCGRCGGTGQVI------KNECKTCHGNKVTKRNK 236

Query: 223 SITVNIPRGSSDKDTIIIDNKA-DQELGK-FKTGDLIFVLEEIDDEQTALKRYGDKDLIT 280
              V++P G+       +D +A + E G  F  GDL+   +E D E    +R GD    T
Sbjct: 237 FFHVDVPPGAPRN---YMDTRAGEAEKGPDFDAGDLVIEFKEKDSENMGYRRRGDNLYRT 293

Query: 281 ELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSG 340
           E+ +S+ +A+ G  E+ I    + + ++LS P    +  G+I  ++G G P  K     G
Sbjct: 294 EV-LSIEEALYGGWERTIEFLDENKPVKLSRPAYVGVSNGEIEVMKGFGMP--KGGKGYG 350

Query: 341 DLYIKFNIEFP 351
           DLYI + +  P
Sbjct: 351 DLYIDYVVIMP 361

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score =  111 bits (278), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 109/363 (30%), Positives = 167/363 (46%), Gaps = 50/363 (13%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
           ++D YAIL + +  +  E+K  YR+L+ KYHPDK     GDE     E   KF E+  AY
Sbjct: 18  SQDYYAILGLSKDASDKEIKSAYRQLSKKYHPDK---NPGDE-----EAHHKFIEVGEAY 69

Query: 69  EILSDEEKRKQYDLQ-----KNFRDANQGSDYGDGINT---AFG--------NQTSKDIS 112
           +IL D EKRK YD+      KN     +G  + D  +     FG         Q S++  
Sbjct: 70  DILGDPEKRKTYDVHGADAFKNGGQGQRGGGFHDPFDMFEQMFGRQGGGFRQTQRSQNYQ 129

Query: 113 IPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQ 172
           +  +V++K+ Y+G  + ++I  N IC+ C G G     +GK  V     C  C G G   
Sbjct: 130 VRNQVSLKEFYSGGEVEFEIPLNDICDSCHGSG---SADGKVKV-----CPACQGRGV-- 179

Query: 173 VRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITV----NI 228
           V Q I  G  T+Q           +   K  + +N C  C G  ++  ++         I
Sbjct: 180 VVQVIRMGPITQQIQQQCG-----QCGGKGKTIENPCKTCKGHKVVRKNKPFHFEFPGGI 234

Query: 229 PRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLAD 288
           PR   DK +   D   D E     +GD+I    E + E    +R G+    TE+ I+  +
Sbjct: 235 PRNHIDKKSGESDKSPDME-----SGDIIIEYNESEKENLGYRRRGNNLYRTEI-ITANE 288

Query: 289 AITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNI 348
           AI G   + I    + + ++LS P G ++  GDI +++G G P+   +   GDLYI + +
Sbjct: 289 AINGGWTREIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPI-MGSKNFGDLYIDYVV 347

Query: 349 EFP 351
             P
Sbjct: 348 LVP 350

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  112 bits (280), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 124/474 (26%), Positives = 195/474 (41%), Gaps = 83/474 (17%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY +L V    +  E++K YR LALK+HPDK   ++        E + KF E+  AYEIL
Sbjct: 7   LYDVLNVSPEASAVEIRKAYRLLALKHHPDKNNHSE--------ESKSKFLEVNEAYEIL 58

Query: 72  SDEEKRKQYDLQKNFRDAN---QGSDYGDGINTAF------------------------- 103
            DE+KR  YD Q    D N   Q     D + ++F                         
Sbjct: 59  IDEKKRSLYD-QYGTIDENAIQQSMPQEDPVMSSFFNTGSPMGMGMGMSAGDLFASFFDK 117

Query: 104 -------GNQTSK------DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRK 150
                  G +T K      DI   LK T+  LY GK  +  + R  +C+ C G G    +
Sbjct: 118 MSSPSFGGKKTKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRGSMKVR 177

Query: 151 NGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCL 210
                      CK C G G +   +Q+ P   T     C +C+G G + K      + C 
Sbjct: 178 T----------CKACRGRGQQSRSRQMGPMMQT-WTQTCSDCNGMGTFTK----DSDVCR 222

Query: 211 KCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQEL-GKFKT-----GDLIFVLEEID 264
            C G+G I   +   V +  G      II+  +AD+ +  +F       GD+I  + +I 
Sbjct: 223 DCEGEGCIRERKIFDVEVKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVIITIIQIK 282

Query: 265 DEQ-TALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDIL 323
           D +   + R G   ++    I L  ++ G K   I    +G+L+ ++I  G++I+     
Sbjct: 283 DPKFQRVNRNGCDLMVRNCKIPLVTSLCGGKLS-IDGHPNGKLINVTILPGELIKPNHFK 341

Query: 324 KVEGEGWPL--NKNATRS-GDLYIKFNIEFPADNWNSEMNDIIKIRNLLPAISDAKADIL 380
            +E  G P    K A    G+LYI+F +EFP +   SE   + K++ +L    + K  + 
Sbjct: 342 SIENLGMPRYEEKRAPEGYGNLYIQFQVEFP-ETLASET--VTKLKQVLDEDPNVKKQVT 398

Query: 381 GDMPKDDIFNITMNSEDISNYDFVKDLPDIIDTSHNNGAEYGHNGDSANFTEMP 434
            +    D+     +  ++  +     LPD  D   N   E G+      + E P
Sbjct: 399 AE--DKDVCERVDDCIEMEEHVLSNLLPDFDDLMRNE--ETGNRSKKRRYYEDP 448

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  110 bits (275), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 97/369 (26%), Positives = 164/369 (44%), Gaps = 47/369 (12%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
            +D YAIL VD+  ++ E+K  YR+L+ KYHPDK    D        E    F E+  AY
Sbjct: 18  AQDYYAILGVDKQASEKEIKSAYRQLSKKYHPDKNPGND--------EAHHHFIEVGEAY 69

Query: 69  EILSDEEKRKQYDLQ----------------KNFRDANQGSD--YGDGI-NTAFGNQTSK 109
           ++LSD EKR+ YD                    F D     +  +G  + N A G    +
Sbjct: 70  DVLSDPEKRQIYDRHGADALKNGHPGGPGGGNGFHDPFDLFEQMFGSNMYNRARGKPRGQ 129

Query: 110 DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAG 169
           ++ +   +++K  Y G    + +  N IC+ C G G    ++GK        C  C G+G
Sbjct: 130 NLQVNHDISLKTFYLGTEFEFTLNLNDICDACDGSG---SEDGK-----TETCPDCGGSG 181

Query: 170 YKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNI 228
             Q+ +    G   ++    C  C G+G+        K+ C KC G  +++ S+  T  +
Sbjct: 182 --QIMKVFRAGPIEQRVRQPCSRCQGRGQLI------KHVCKKCKGVKVVQKSKVFTAKV 233

Query: 229 PRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLAD 288
             G  +++ I +     ++    + GDL     E + +    +R G+    TE+ +S  +
Sbjct: 234 EPG-MERNHIHVMQGQSEKHPDIEPGDLYQYFRESEKDSMGYRRRGNTLYRTEI-LSFKE 291

Query: 289 AITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNI 348
           A+ G  E+ I      + L LS PVG  ++ G+   ++  G P+     + GDL I + I
Sbjct: 292 ALQGGWERNIEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPIPSATDKFGDLIIDYVI 351

Query: 349 EFPADNWNS 357
             P + W++
Sbjct: 352 LLPGE-WST 359

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  111 bits (278), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 97/388 (25%), Positives = 172/388 (44%), Gaps = 74/388 (19%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           +LY  L +    T  E+KK YR  ALK HPDK    +  ED  +     KF+EI  AYEI
Sbjct: 8   ELYDTLNISVDATPQEIKKAYRLAALKSHPDK---NNHSEDSKR-----KFQEICKAYEI 59

Query: 71  LSDEEKRKQYDL-------------QKNFRDANQGSDYGDGINTAFGNQTSK-------- 109
           L D +K+  YD              Q+     + G   GD  +  FG  ++         
Sbjct: 60  LGDAKKKLLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFND 119

Query: 110 -------------------DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRK 150
                              DI   L+ ++++LY+GK  +  + R  +C+ C G G  S  
Sbjct: 120 DTMFFTGKKNSQRRVSRGPDIKHNLRCSLEELYHGKKSKLRLDRTRLCKTCKGNGGTSS- 178

Query: 151 NGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCL 210
                    + C+ C+G G+    ++  P   T  +  C++C G G + ++    K+ C 
Sbjct: 179 ---------SACRACNGQGFYTQTRRHGPMVQT-WSTTCQDCGGSGTFVRR----KDVCS 224

Query: 211 KCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQ----ELGKFKT--GDLIFVLEEID 264
           +C G+G I+  +   + +  G      I++  +AD+      GK +   GD+I +++++ 
Sbjct: 225 ECKGQGCIKERKIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIVQQV- 283

Query: 265 DEQTALKRYGDKDLIT-ELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDIL 323
            +    + + D DL+  +  + L  ++ G  E  I     G  L++ +  G++++ G + 
Sbjct: 284 -KHPLFQIHNDTDLVMNDCHVDLKTSLCG-GEVLIENHPCGSALKIEVLPGEILKPGCVK 341

Query: 324 KVEGEGWPLNKNATRSGDLYIKFNIEFP 351
            VE  G P +  +   G+LYI+F ++FP
Sbjct: 342 CVESMGMP-HPQSQGFGNLYIRFQVDFP 368

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score =  110 bits (276), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 114/410 (27%), Positives = 168/410 (40%), Gaps = 101/410 (24%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY  L +  T +Q ++KK YR  AL+YHPDK   ++        E + KF++I  AY IL
Sbjct: 7   LYNALNIPPTASQSDIKKAYRVQALRYHPDKNNESE--------ESKKKFQDISEAYSIL 58

Query: 72  SDEEKRKQY-------------------------------DLQKNFRD--------ANQG 92
            DE +RK Y                               DL   F D        +N  
Sbjct: 59  RDENQRKMYDKYGTVNPTEIQQQNQRTNVPFTDPFGMSAADLFSQFFDTQNHNSGQSNSS 118

Query: 93  SDYG-----------------DGINTAFGNQTSK------DISIPLKVTIKDLYNGKIIR 129
             +G                 DG+   F N  S+      DI+  LK TIKDLY GK  +
Sbjct: 119 PPFGFPFNSSRNGNGNNNRAADGVFGDFFNTKSRPLQKGPDINHNLKCTIKDLYRGKRSK 178

Query: 130 YDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVC 189
             ++R+ +C  C G G   R          + C  C G G      ++ P   T  +  C
Sbjct: 179 LRLERSKLCSICKGDGGVKR----------SMCNQCHGDGNITETTRLGPMLQTFTH-TC 227

Query: 190 KNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELG 249
             C+G G        S+  C  CNG G     +   V I  G  D   I+ +N+ D+ + 
Sbjct: 228 NICNGNGWV----IISQETCQGCNGVGFYNEMKIFDVEIYPGMKDGTQIVFNNEGDEIVN 283

Query: 250 KFKT--GDLIFVLEEIDDEQTALKRYGD-KDLI-----TELTISLADAITGFKEKPIVKT 301
           K +   G++I  + EI+D +   KR  D +DL       +L  SL   +   K  P    
Sbjct: 284 KRRVIPGNVIIHINEIEDNK--FKRVNDGQDLYYWNYEIDLFTSLCGGVIYIKGHP---- 337

Query: 302 LDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
            + +L+++ I  G++I  G +  VE  G P NK     G LYI+F +++P
Sbjct: 338 -NNKLIKVDILPGEIIESGSVKGVESLGMPKNK-GNEYGILYIQFQVKYP 385

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score =  108 bits (269), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 103/379 (27%), Positives = 169/379 (44%), Gaps = 52/379 (13%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
            +D YAIL +++  +  E+K  YR+L+ K+HPDK     GDE     E   KF EI  AY
Sbjct: 19  AQDYYAILGLNKDASDKEIKSSYRQLSKKFHPDK---NPGDE-----EAHHKFIEIGEAY 70

Query: 69  EILSDEEKRK---QY--DLQKN------------FRDA--------NQGSDYGDGINTAF 103
           E+LSD EKRK   QY  D  KN            F D         N+G   G G     
Sbjct: 71  EVLSDPEKRKIFDQYGADALKNGGPGGPGGGGGGFNDPFDIFEQMFNRGGGGGGGGFGRM 130

Query: 104 GNQTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECK 163
                 ++ +  ++++K+ Y G  + + +  N IC+ C G G     +GK     + +C 
Sbjct: 131 QRPRGHNLKVREQLSLKEYYTGATLEFTLALNDICDHCDGTG---SADGK-----VAKCS 182

Query: 164 TCDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISE 222
            C G G   V Q I  G  T+Q   +C  C GKG      +  KN C  C+G  +++  +
Sbjct: 183 DCQGRGV--VIQVIRMGMMTQQIQQMCGRCGGKG------SVIKNHCKTCHGSKVVKKQK 234

Query: 223 SITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITEL 282
              V +P G++   T     ++D+    F  GD+     E        +R G     TE+
Sbjct: 235 PFHVEVPPGAARHYTETRSGESDKG-ADFDAGDVFIEFNEKTTNNLGYRRRGPHLYRTEV 293

Query: 283 TISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDL 342
            +S  +A+ G  ++ +    + + ++++     V+  G++ ++ G G P        GDL
Sbjct: 294 -LSAREALKGDWQREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGMPQPNGKHAFGDL 352

Query: 343 YIKFNIEFPADNWNSEMND 361
           +I++ +  P +   S + D
Sbjct: 353 FIEYVVVMPHEISKSGIRD 371

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score =  107 bits (266), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 104/380 (27%), Positives = 168/380 (44%), Gaps = 53/380 (13%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
            +D Y IL + +  T  E+K  YR+L+ K+HPDK     G+ED  +     KF E+  AY
Sbjct: 19  AQDYYQILGIAKDATDKEIKSAYRQLSKKFHPDK---NPGNEDAHQ-----KFIEVGEAY 70

Query: 69  EILSDEEKRKQYD----------------LQKNFRDA----NQGSDYGDGINTAFGNQTS 108
           E+LSD +KR+ +D                    F D      Q      G    FG Q  
Sbjct: 71  EVLSDPQKRQTFDQFGADAVKNGGQGQPGGGAQFHDPFDIFEQMFGGQGGGGNPFGGQRQ 130

Query: 109 K----DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKT 164
           K    +I    ++++KD Y G  + + +  N +C+ C G G     +GK     LT C  
Sbjct: 131 KPRGPNIMAREEISLKDYYTGYELNFTLNVNDLCDHCHGTG---SDDGK-----LTPCPD 182

Query: 165 CDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISES 223
           C G G   + Q I  G  T+Q   +C  C GKG+ +KK       C KC+G  ++   + 
Sbjct: 183 CQGRGV--IIQLIRMGMMTQQIQQMCGRCGGKGQLFKKQ------CRKCHGNKVMPQKKE 234

Query: 224 ITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELT 283
             V +P+G+      +   +AD+     + GDL+    E D      +R G     TE+ 
Sbjct: 235 FQVKLPKGAKRHYMDVKHGEADKN-PDLEAGDLLIEFNENDKSNMGYRRRGQNLYRTEV- 292

Query: 284 ISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRS-GDL 342
           +++ +A+ G  ++ I      + L++      V+  G++ ++ G G P  K    + GDL
Sbjct: 293 LNVTEALYGGWQREIPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDL 352

Query: 343 YIKFNIEFPADNWNSEMNDI 362
           +I + +  P   WN   + I
Sbjct: 353 FIDYVVIMPK-QWNKVSSSI 371

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 98/370 (26%), Positives = 158/370 (42%), Gaps = 55/370 (14%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
            +D YAIL V +  ++ E+K  YR+L+ KYHPDK     GDE         KF E+  AY
Sbjct: 22  AQDYYAILGVSKDASEKEIKSAYRQLSKKYHPDK---NPGDE-----TAHHKFIEVGEAY 73

Query: 69  EILSDEEKRKQYD-----------------LQKNFRDANQGSDYGDGINTAFGNQ----- 106
           E+LSD++KR+ Y+                             D  D     FG Q     
Sbjct: 74  EVLSDDQKRQIYNQYGAEALKNGGPGGSGGPGGPGGFGGGFHDPMDIFEQMFGAQRGGGG 133

Query: 107 ----TSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTEC 162
                  ++    ++T+K+ Y G  + + +  N  C+ C G G +  K         T C
Sbjct: 134 RGRPRGHNLEAREEITLKEYYQGTSLDFTLNLNDFCDNCKGTGSQDGKT--------TRC 185

Query: 163 KTCDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEIS 221
             C G G   V Q I  G  T+Q   +C  C GKG+        KN C +C+G  +   +
Sbjct: 186 SDCQGQGV--VIQIIRMGPITQQIQQMCGACQGKGQII------KNKCKQCHGAKVERKT 237

Query: 222 ESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITE 281
           +   V++P G+  +D + + N    +   F  GD+     E   +    +R G     TE
Sbjct: 238 KHFHVDVPAGAP-RDFVDVKNGEADKGPDFDAGDVYIKFSESSRDNMGYRRRGVHLHRTE 296

Query: 282 LTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGD 341
           + ++L +A+ G  ++ I      + ++L    G  +R G+  +V G G P  K+    GD
Sbjct: 297 V-LTLKEALQGGWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMP--KDGRHFGD 353

Query: 342 LYIKFNIEFP 351
           L++ + +  P
Sbjct: 354 LFVDYVVLTP 363

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score =  103 bits (257), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 99/369 (26%), Positives = 159/369 (43%), Gaps = 52/369 (14%)

Query: 8   STKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISA 67
           + +D Y IL V +  +  E+K  YR+L+ K+HPDK     GDED        KF E+  A
Sbjct: 22  AAQDYYGILGVSKDASDKEIKSAYRQLSKKFHPDK---NPGDEDA-----HHKFIEVGEA 73

Query: 68  YEILSDEEKRKQYDLQ-----KN----------FRDANQGSDYGDGINTAF--------- 103
           YE+LSD++KR+ YD       KN                  D  D     F         
Sbjct: 74  YEVLSDDQKRQIYDQHGAEALKNGGPGGPGGPGGGFGGGFHDPMDIFEQMFGGHRGGGGR 133

Query: 104 GNQTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECK 163
           G     ++    ++T+K  Y G  + + +  N  CE C G G +  K         T C 
Sbjct: 134 GRPRGHNLEAREELTLKQYYQGTSLDFTLNLNDFCENCHGSGSQDGKT--------THCS 185

Query: 164 TCDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISE 222
            C G G   V Q +  G  T++   +C  C GKG+        KN C +C+G  +   ++
Sbjct: 186 ECRGQGV--VIQVVRMGPLTQKIQQMCGACQGKGQVI------KNKCKRCHGAKVERKAK 237

Query: 223 SITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITEL 282
              V++P G+  +D + +      +   F +GD+     E   +    +R G     TE+
Sbjct: 238 HFHVDVPAGAP-RDFVDVKAGEADKGPDFDSGDVFIKFSESSRDNMGYRRRGPHLYRTEV 296

Query: 283 TISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDL 342
            +SL +A+ G  ++ I      + L+L    G  +R G+I +V G G P   +  + GDL
Sbjct: 297 -LSLKEALLGGWKREIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPTGGHG-KHGDL 354

Query: 343 YIKFNIEFP 351
           ++ + +  P
Sbjct: 355 FVDYVVVIP 363

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score =  104 bits (260), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 116/462 (25%), Positives = 188/462 (40%), Gaps = 113/462 (24%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
           + +LY IL +       ++KK YR LALKYHPDK   ++        E ++ F++I  AY
Sbjct: 4   SSELYDILNISSNADAKDIKKAYRVLALKYHPDKNNHSE--------ESKVMFQKISEAY 55

Query: 69  EILSD----------------------EEKRKQYDLQKN--------FRDANQ--GSDY- 95
           E+L D                      E KRK   +Q+         F + N   GSD  
Sbjct: 56  EVLIDVEKRKLYDQYGTVDESVIEQMKERKRKSEFMQQRQGMYPSDPFGNVNPLFGSDLA 115

Query: 96  ---GDGINTAFGN---------------------------------QTSKDISIPLKVTI 119
              GD     FGN                                 +   DI   L+ ++
Sbjct: 116 ASAGDLFAQFFGNSNKNSSRFNPFGNMKPNFSNFNNTFENTASVELERGPDIKHTLRCSL 175

Query: 120 KDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAP 179
           KDLY GK  +  + R  +C  C+G G   +          ++C TC+G G     +++ P
Sbjct: 176 KDLYYGKKTKLRLDRTRLCVLCMGQGSMKK----------SKCFTCNGLGSLTQTRRMGP 225

Query: 180 GFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKDTII 239
              T     C +C G G + K+  +    C  C+G G +E  +   V I  G  +   II
Sbjct: 226 MIQTFSQ-SCPDCQGSGMFVKRSDT----CQSCSGNGYVEERKIFDVEIQPGMVNGQVII 280

Query: 240 IDNKADQ----ELGKFK--TGDLIFVLEEIDDEQTALKRYGDKDLITE-LTISLADAITG 292
           +  +AD+      GK K   GD++  + ++ D     +   D DL+ +  +++L+ A+ G
Sbjct: 281 LPGEADEVVNTSFGKQKVIAGDIVLTINQLKDNN--FEVINDCDLLLDNFSVNLSKALCG 338

Query: 293 FKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNA--------TRSGDLYI 344
                I     G L+++ I  G+++  G I  V   G P  +             G+LY+
Sbjct: 339 -GTIFISNHPSGNLIKIDIIPGEILSPGVIKTVANLGMPKEEKRDPDVSIINISKGNLYV 397

Query: 345 KFNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKD 386
           KF+I+FP      E + I K++ +L     A A++  +  KD
Sbjct: 398 KFDIKFPT---RLEEDTIAKLKAVLSEDRYAHAEMADEEAKD 436

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score =  103 bits (256), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 122/265 (46%), Gaps = 28/265 (10%)

Query: 110 DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAG 169
           DI   LK T+++LYNGK+ +  + R  +C  C G G   R          T C++C G G
Sbjct: 153 DIKHVLKCTLRELYNGKMAKLALNRTRLCLPCNGFGGLQR----------TTCESCQGDG 202

Query: 170 YKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIP 229
           ++   +++ P   T     C +CDG G + K      + C  C+G+G I   +   V + 
Sbjct: 203 FQTQTRRMGPMVQTWTQ-TCASCDGAGCFIK----PNDVCPHCHGEGFIRERKIFHVEVK 257

Query: 230 RGSSDKDTIIIDNKADQEL------GKFKTGDLIFVLEEIDDEQTALKRYGDKDLITE-L 282
            G  D   +I+  +AD+ +       K   GD++  +++  DE    +   +KDL+    
Sbjct: 258 PGFQDGKDVIMQGEADEIMLNNLVKEKVIPGDVVITIKQSRDENNCFQMINNKDLLMNGC 317

Query: 283 TISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPL-----NKNAT 337
            + L  ++ G  E  I     G+L++L I  G++++      +EG G P      +    
Sbjct: 318 PVDLVTSLCG-GEVYIDNHPSGKLIKLDIIPGEILKPNCFKIIEGLGMPYLEDGKDDTML 376

Query: 338 RSGDLYIKFNIEFPADNWNSEMNDI 362
           R GDLYI+F I++P    N  M  +
Sbjct: 377 RRGDLYIQFKIQYPEQLENETMTQL 401

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score =  102 bits (253), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 81/271 (29%), Positives = 123/271 (45%), Gaps = 34/271 (12%)

Query: 104 GNQTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECK 163
           G     DI   LK  +K+LY+GK+ +  + R  +C +C G G  +           + C 
Sbjct: 148 GKSRGPDIKHNLKCELKELYSGKVAKLGLTRTRLCHRCSGHGSMTS----------SVCG 197

Query: 164 TCDGAG-YKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISE 222
            C G G Y Q R+   P      +  C+NC G G + K    S + C  C G G I   +
Sbjct: 198 ECRGQGVYSQTRRH-GP-LVQTWSSSCRNCSGAGTFVK----SNDVCQTCRGTGYIRERK 251

Query: 223 SITVNIPRGSSDKDTIIIDNKADQEL----GKFKT--GDLIFVLEEIDDEQTALKRYGDK 276
              V I  G S+K  II+  +ADQ +    GK +   GD+I +++E        +R+ + 
Sbjct: 252 IFEVEIKPGLSNKSEIILPGEADQVISTVYGKQQVIPGDVIIIVQE-QCSTGRYRRFRES 310

Query: 277 DLI-TELTISLADAITG----FKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWP 331
           DL+ T   + L  ++ G      + P      GR ++L +  G+++  G I  VE  G P
Sbjct: 311 DLVLTRCVVDLRTSLCGGSIYIDDHP-----SGRPIKLEVIPGELLNPGSIKCVENLGMP 365

Query: 332 LNKNATRSGDLYIKFNIEFPADNWNSEMNDI 362
              N ++ GDLYIKF + FP       MN I
Sbjct: 366 KRDNPSQYGDLYIKFCVNFPERLEPETMNVI 396

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 41/70 (58%), Gaps = 8/70 (11%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           Y +L V  T++  ELKK Y+  AL+YHPDK    +G  +  K      F++I  AY IL
Sbjct: 7  FYDLLNVSPTVSPQELKKSYKLAALRYHPDK----NGHSESAK----QAFQQITEAYGIL 58

Query: 72 SDEEKRKQYD 81
          SDE KRK YD
Sbjct: 59 SDERKRKIYD 68

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score =  100 bits (248), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 109/391 (27%), Positives = 165/391 (42%), Gaps = 64/391 (16%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
            +D Y IL + +   + E+K  YR+L+ K+HPDK      DED        KF EI  AY
Sbjct: 21  AQDYYKILGLSKNCNEKEIKSAYRQLSKKFHPDK---NPNDED-----AHNKFIEIGEAY 72

Query: 69  EILSDEEKRKQY-----DLQKN--------------FRDA------------------NQ 91
           E+LSD EKR+ Y     D  KN              F D                     
Sbjct: 73  EVLSDPEKRRMYDQFGADAVKNGGPGGPGGPGGPGGFHDPFDLFEQMFGGGHGGGFGGFG 132

Query: 92  GSDYGDGINTAFGNQTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKN 151
           G     G     G Q  + I +   +T+KD YNG  I + +  N  C+ C G G    ++
Sbjct: 133 GFGGFGGGQQHQGKQRGQSIKVRHALTLKDYYNGGSISFSLLLNDNCDHCHGSG---SED 189

Query: 152 GKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCL 210
           GK     + +C  C G G   V Q I  G  T+Q    C  C G G   +      N C 
Sbjct: 190 GK-----VKKCPDCGGRGV--VIQVIRMGIVTQQVQQRCNRCAGSGEIIQ------NKCK 236

Query: 211 KCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTAL 270
            C+G  + +  + I+V+   G       +   +A++  G  + GDLI    E+ +     
Sbjct: 237 VCSGAKVQKKEKDISVSFDSGIERNHISVQQGEAEKGPG-IEPGDLIVEFFEVPEANMGY 295

Query: 271 KRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGW 330
           +R G KDL     ++L +AI G   + I      + L+L      ++  G++ K+ G G 
Sbjct: 296 RRRG-KDLFRTEVLTLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGM 354

Query: 331 PLNKNATRSGDLYIKFNIEFPADNWNSEMND 361
           P+  +  + GDLYI + +  P  + NS ++D
Sbjct: 355 PILGSKGKFGDLYIDYVVIKPHVDPNSRLDD 385

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score =  100 bits (249), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 97/411 (23%), Positives = 168/411 (40%), Gaps = 97/411 (23%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           LY +L V+   +Q  +KK +   AL+ HPDK   ++        E + +F+EI  AYE+L
Sbjct: 7   LYDLLNVECDASQVTIKKAFHAAALRCHPDKNNHSE--------ESKKQFQEISKAYEVL 58

Query: 72  SDEEKRKQYDLQKNFRDANQGSD--YGDGINT---------------------------- 101
           SD + R+ YD      ++   S   +G+G++                             
Sbjct: 59  SDPKSREMYDRYGTTDESAIASQEPFGEGMSFYSGGNPMHMFGTSAGDLFAQFFNSSGDA 118

Query: 102 -----------AFGN------------QTSKDISIPLKVTIKDLYNGKIIRYDIKRNVIC 138
                       FGN            +T  DI   LK  + DLY GK  +  + R  +C
Sbjct: 119 GPSFGFGSRFDGFGNSAQAHGARDGHMRTGPDIKHYLKCNLSDLYQGKKTKLGLNRMRVC 178

Query: 139 EKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRY 198
             C G G             +  C+TC G G     +++ P   T  +  C +C G G +
Sbjct: 179 SSCDGKGGMR----------VASCRTCKGQGEVVKTRRVGPMVQTMSS-TCNSCHGTGTF 227

Query: 199 YKKPASSKNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQ------ELGKFK 252
            K      + C  C G G+ +  +   V +  G +    I++  +AD+       L K +
Sbjct: 228 IK----DSDLCFVCKGSGVSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETSHGLIKVQ 283

Query: 253 TGDLIFVLEEIDDEQTALKRYGDKDLITE-LTISLADAITGFKEKPIVKTLDGRLLRLSI 311
            GD++ V++ + + Q   +   D DL+ +   + L   + G  E  I     G++++LSI
Sbjct: 284 PGDVVIVIDLVKNTQ--FQVVNDHDLVLKNCEVPLKTCLCG-GEIMIEGHPSGKIIKLSI 340

Query: 312 PVGKVIRFGDILKVEGEGWP-LNKNATRS----------GDLYIKFNIEFP 351
              ++++      VEG G P +  N+  +          G+LY++F ++FP
Sbjct: 341 IPNELLKPSCFKTVEGLGMPKVIANSDHANIAGTDIDGYGNLYVQFQVKFP 391

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score =  100 bits (248), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 121/250 (48%), Gaps = 23/250 (9%)

Query: 110 DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAG 169
           DI   LK T+ +LY+GKI +  + R  +C+ C G G   R+           CKTC G G
Sbjct: 164 DIKHNLKCTLAELYDGKITKLGLNRRRMCQSCQGQGSLRRRT----------CKTCRGQG 213

Query: 170 YKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIP 229
            +   ++  P         C +C+G G Y K+     + C +C G+  I+  +   V + 
Sbjct: 214 QQTETRRTGP-MVQTWTQTCPDCNGLGTYTKQ----ADVCHECRGESYIKERKIFDVEVS 268

Query: 230 RGSSDKDTIIIDNKADQELG------KFKTGDLIFVLEEIDDEQ-TALKRYGDKDLITEL 282
           +G     TI++  +AD+ +       K   GD++  ++++ D +   + RYG   ++   
Sbjct: 269 KGMCHGQTIVLPGEADELIKTSFGVEKVIPGDVVITIDQVKDSKFHRVNRYGCDLVMGSC 328

Query: 283 TISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDL 342
           +I L+ ++ G  +  I     G+LL++SI  G++I    +  +EG G P   +    G+L
Sbjct: 329 SIDLSTSLCG-GDIYIDGHPSGKLLKVSIVPGELIGPNCLKSIEGMGMPKYGHDGGKGNL 387

Query: 343 YIKFNIEFPA 352
           YI+F +E+P 
Sbjct: 388 YIQFQLEYPV 397

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 8/70 (11%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY  L+V    T  E+K+ Y+ +ALKYHPDK   ++  ++        KF+E+  AYEIL
Sbjct: 7  LYDTLKVSPDATISEIKRAYKVMALKYHPDKNHHSEDAKN--------KFQEVCKAYEIL 58

Query: 72 SDEEKRKQYD 81
          +DE+KR  YD
Sbjct: 59 ADEDKRVMYD 68

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score = 95.5 bits (236), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 95/374 (25%), Positives = 163/374 (43%), Gaps = 50/374 (13%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           +D YAIL VD   T+ ++K  YR+L+ KYHPDK      +  D    +   F E+  AYE
Sbjct: 20  QDYYAILGVDREATEKDIKSAYRQLSKKYHPDK------NPGDTTAHH--NFIEVGEAYE 71

Query: 70  ILSDEEKRKQYD------LQKNFRDANQGSDYGDGIN--------------TAFGNQTSK 109
            LSD EKR+ YD      L+           + D  +                   Q S+
Sbjct: 72  ALSDPEKRRIYDQYGAEALKNGGGAEGGHGGFHDPFDIFEQMFGGGARFGGGQRRRQRSQ 131

Query: 110 DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAG 169
            + +  ++T++  Y+G  + + +  N  C+ C   G    ++GK     +  C  C   G
Sbjct: 132 SLQVQEELTLRQYYHGTAVEFTLSLNDHCDHC---GATGSQDGK-----VERCTQCSVRG 183

Query: 170 Y-KQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVN 227
              QV +Q   GF T+Q   VC    G       P +    C  C G   I+ ++S  V 
Sbjct: 184 VIVQVGRQ---GFMTQQFQQVCPRLLGPW-----PKALPKKCKVCQGHKAIKKNKSFRVE 235

Query: 228 IPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLA 287
           +P G+  +D + +     +++     GD+   + E   +    +R G     TE+ +SL 
Sbjct: 236 VPPGAP-RDFVAVQQGEAEKVPDMDPGDIYVKVFENTRDNMGYRRQGANLFRTEV-LSLK 293

Query: 288 DAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFN 347
           +A+ G  ++ +      + +  S   G+ ++ G++ +V G G PL  +A   GDLY+ + 
Sbjct: 294 EALHGDWKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMPLPDSAG-FGDLYVDYV 352

Query: 348 IEFPADNWNSEMND 361
           +  P   ++S + D
Sbjct: 353 VILPG-TFDSRIMD 365

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score = 93.6 bits (231), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 92/354 (25%), Positives = 151/354 (42%), Gaps = 64/354 (18%)

Query: 110 DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAG 169
           DI   LK T+K+LY GK  +  + R  IC+ C G G       K+Y      CKTC G G
Sbjct: 182 DIKHNLKCTLKELYMGKTAKLGLNRTRICQVCDGHGGL-----KKYA-----CKTCKGQG 231

Query: 170 YKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIP 229
            +    ++ P      +  C +C G G +      SK+ C +C G G ++  + + V + 
Sbjct: 232 VQTQTNRMGP-LVQSWSQTCADCGGAGIF----VESKDICQQCQGLGFVKQRKILQVAVQ 286

Query: 230 RGSSDKDTIIIDNKADQELG-------KFKTGDLIFVLEEIDDEQTALKRYGDKDLI--- 279
            GS     I++  + D+ +        K   GD++  +  + D +  +    D +LI   
Sbjct: 287 PGSCHNQLIVLTGEGDEVISSKGGGHEKIIPGDVVITILRLKDPRFQI--VDDYNLIYKK 344

Query: 280 --TELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNAT 337
              +L  SL   +   +  P      G+L++L I  G+V++ G    VE  G P   N  
Sbjct: 345 CKVDLMTSLCGGVVYIEGHP-----SGKLIKLDIIPGEVLKPGCFKTVENMGMPKFINGV 399

Query: 338 RS--GDLYIKFNIEFPADNWNSEMNDIIKIRNLLP----------AISDAKADILGDMPK 385
           RS  G +Y+KF + +P      E  + IK++ +L           A+  A AD   D+ +
Sbjct: 400 RSGFGHMYVKFEVTYPR---RLEPENAIKLQKVLANDKYVQNERSAMETADADCYCDLER 456

Query: 386 DDIFNIT------------MNSEDISNYDFVKDLPDIIDTSHNNGAEYGHNGDS 427
              +N+             M SE I N D + DL +  D+   N   +G + +S
Sbjct: 457 S--YNVVEEHVLSSFEAPDMKSEIIENDD-LDDLINERDSRKRNNRRFGESSNS 507

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 37/70 (52%), Gaps = 8/70 (11%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY  L V  T +  E+KK YR  ALKYHPDK   T+        E + KF+EI  AYE L
Sbjct: 7  LYDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTE--------ESKRKFQEICQAYETL 58

Query: 72 SDEEKRKQYD 81
           D   R  YD
Sbjct: 59 KDNHLRSLYD 68

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 119/272 (43%), Gaps = 35/272 (12%)

Query: 110 DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAG 169
           DI   LK T+K+LY GK  +  + R  IC  C G G   +            CKTC G G
Sbjct: 178 DIKHNLKCTLKELYMGKTAKLGLNRTRICSVCDGHGGLKK----------CTCKTCKGQG 227

Query: 170 YKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIP 229
            +   +++ P      +  C +C G G + K    +K+ C +C G G I+  + + V + 
Sbjct: 228 IQTQTRRMGP-LVQSWSQTCADCGGAGVFVK----NKDICQQCQGLGFIKERKILQVTVQ 282

Query: 230 RGSSDKDTIIIDNKADQELG-------KFKTGDLIFVLEEIDDEQTALKRYGD---KDLI 279
            GS     I++  + D+ +        K   GD++  +  + D    +  Y +   K   
Sbjct: 283 PGSCHNQLIVLTGEGDEVISTKGGGHEKVIPGDVVITILRLKDPNFQVINYSNLICKKCK 342

Query: 280 TELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRS 339
            +   SL   +   +  P      G+L++L I  G++++ G    VE  G P   N  RS
Sbjct: 343 IDFMTSLCGGVVYIEGHP-----SGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVRS 397

Query: 340 --GDLYIKFNIEFPADNWNSEMNDIIKIRNLL 369
             G LY+KF++ +P      E  +  KI+N+L
Sbjct: 398 GFGHLYVKFDVTYPE---RLEPENAKKIQNIL 426

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 37/70 (52%), Gaps = 8/70 (11%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY  L V    +  E+KK YR  ALKYHPDK   T+        E + KF+EI  AYEIL
Sbjct: 7  LYDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTE--------ESKRKFQEICQAYEIL 58

Query: 72 SDEEKRKQYD 81
           D   R  YD
Sbjct: 59 KDNRLRALYD 68

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score = 91.3 bits (225), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 110/253 (43%), Gaps = 31/253 (12%)

Query: 110 DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAG 169
           DI   LK T+++LY GK  +  + R  IC  C G G   +            CKTC G G
Sbjct: 189 DIKHTLKCTLRELYMGKTAKLGLNRTRICHVCEGHGGLQKYT----------CKTCKGQG 238

Query: 170 YKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIP 229
            +   + + P      +  C +C G G +      SK+ C +C G G I+  + + V + 
Sbjct: 239 VQTQTKCMGP-LVQSWSQTCADCGGAGIF----VESKDICQQCQGLGFIKQRKILQVTVQ 293

Query: 230 RGSSDKDTIIIDNKADQELG------KFKTGDLIFVLEEIDDEQTALKRYGD---KDLIT 280
            G+S    I++  + D+ +       K   GD++  +  + D +  +        K    
Sbjct: 294 PGTSHNQLIVLTGEGDEVISKGGGHEKVIPGDVVITILRLKDPKFQVTDNCSLIYKKCKV 353

Query: 281 ELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRS- 339
           +L  SL   I   +  P      G+L++L I  G+V++      +EG G P   N  RS 
Sbjct: 354 DLMTSLCGGIVYIEGHP-----SGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFINGVRSG 408

Query: 340 -GDLYIKFNIEFP 351
            G LY+KF++ +P
Sbjct: 409 FGHLYVKFDVSYP 421

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 8/70 (11%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY  L V  T +  E+KK YR  AL+YHPDK   T+        E + KF+EI  AYE+L
Sbjct: 7  LYDSLNVTTTASTSEIKKAYRNAALRYHPDKNNHTE--------ESKRKFQEICQAYEVL 58

Query: 72 SDEEKRKQYD 81
           D   R  YD
Sbjct: 59 KDNHLRSLYD 68

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 113/254 (44%), Gaps = 32/254 (12%)

Query: 110 DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAG 169
           DI   LK T+K+LY GK  +  + R  IC  C G G       ++Y      CK C G G
Sbjct: 185 DIKHNLKCTLKELYMGKTAKLGLNRTRICHVCDGHGGL-----RKYT-----CKPCKGQG 234

Query: 170 YKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIP 229
            +   +++ P      +  C +C G G + K    +K+ C +C G G I+  + + V + 
Sbjct: 235 IQTQTKRMGP-LVQSWSQTCADCGGAGTFVK----NKDICEQCQGLGFIKQRKILQVTVQ 289

Query: 230 RGSSDKDTIIIDNKADQELG-------KFKTGDLIFVLEEIDDEQTALKRYGD---KDLI 279
            GS     I++  + D+ +        K   GD++  +  + D +  +    D   K   
Sbjct: 290 PGSCHNQLIVLTGEGDEVISTKGGGREKVIPGDVVITILRLKDPKFQITDNCDLICKKCE 349

Query: 280 TELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRS 339
            +L  SL   I   +  P      G+L+++ I  G+V++ G    VE  G P   N  RS
Sbjct: 350 VDLMTSLCGGIVYIEGHP-----SGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGVRS 404

Query: 340 --GDLYIKFNIEFP 351
             G LY+KF++ +P
Sbjct: 405 GFGHLYVKFDVTYP 418

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 38/70 (54%), Gaps = 8/70 (11%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY  L V  T +  E+KK YR  ALKYHPDK   T+        E + KF+EI  AYE+L
Sbjct: 7  LYDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTE--------ESKRKFQEICQAYEVL 58

Query: 72 SDEEKRKQYD 81
           D   R  YD
Sbjct: 59 KDNHLRSLYD 68

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 99/401 (24%), Positives = 164/401 (40%), Gaps = 89/401 (22%)

Query: 6   DPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEII 65
           D + KD Y  L V    +  ++K+ Y KLA KYHPD  +    D+          F  + 
Sbjct: 43  DETFKDPYKTLGVSRDASPSDIKRAYYKLAKKYHPDINKEPGADK---------TFHNLQ 93

Query: 66  SAYEILSDEEKRKQYD-LQKNFRDANQGSDYGDGINTAFGNQTSKDISIPLKVTIKDLYN 124
           +AYEILSDE+K+ QYD    +  D N  ++   G N   G  ++   +    +  +DL+ 
Sbjct: 94  NAYEILSDEKKKLQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFADFGGLNFEDLFG 153

Query: 125 GKIIR-----------YDIKRNVI-----------------------------------C 138
               R           ++ + N++                                   C
Sbjct: 154 AAFGRSGFRNGGDAGGFNGRANIVREYQGDSIEIQHVVSFKDAVFGLNNVSLKYKSLDPC 213

Query: 139 EKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRY 198
             C G G    KNG+Q+      C  C+G G    +  +  GF  +    C +C G+G  
Sbjct: 214 GTCHGSGL---KNGEQH--KRKTCSYCNGTG---TQVHVKSGF--QMASTCMHCHGEGTT 263

Query: 199 YKKPASSKNFCLKCNGKGI-IEISESITVNIPRGSSDKDTIIIDNKA----------DQE 247
             +    ++ C  C+G G+ I   +S+ VN P G SD D I I  +           D+ 
Sbjct: 264 IAR----EDTCSACDGDGVKINSKKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKS 319

Query: 248 LGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLL 307
           + K   GDL+  +    D +  +K   D   I E+ I+ A A+ G  E   ++T+DG+ +
Sbjct: 320 I-KLSRGDLLVRIRVKSDPKFFVKNKYDIWTIKEIPITTA-ALGGTVE---IETVDGKNI 374

Query: 308 RLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNI 348
           RL +  G   +   +  +   G P  +N T  G++ +++ I
Sbjct: 375 RLKVISG--TQHDQVTSIPNMGIPY-RNGTGRGNMNVQYKI 412

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 95/387 (24%), Positives = 159/387 (41%), Gaps = 64/387 (16%)

Query: 11  DLYAILEVDETIT-QDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           D Y IL +++    + E+K  YRKL+ KYHPDK      D+D      +  F ++  AY+
Sbjct: 24  DYYKILGINKNYKYEKEIKSAYRKLSKKYHPDK---NKNDKDA-----QQNFIKVGEAYD 75

Query: 70  ILSDEEKRKQYDLQKNFRDANQG--------------SDYGDGINTAFGNQTSK------ 109
           +L D +K++QYD   +    N                 D  D     F            
Sbjct: 76  VLGDPDKKRQYDQMGHDAFVNNAQHGGPEGGPGGQPFHDPFDMFEKMFHGGGPGGGNPFG 135

Query: 110 --------------DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQY 155
                          + +  ++++K  Y G   ++ +  +  C+ C G G    ++GK  
Sbjct: 136 GNPFGGGGGQRRGPSLKVEQQLSLKQYYQGFDFQFALNLHDDCDHCHGTG---SEDGKTK 192

Query: 156 VPPLTECKTCDGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNG 214
           V     C  C G+G   + Q I  G  T+Q    C  C G+G   K      NFC  CNG
Sbjct: 193 V-----CPDCKGSGI--IIQIIRMGMMTQQIQQPCGRCRGQGHLIK------NFCKVCNG 239

Query: 215 KGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYG 274
             + +  +   V +P GS      +   +A++    ++ GD+I    E+  +    +R G
Sbjct: 240 AKVQQKLKDFKVYVPPGSPRNHVEVKAGQAEKN-PNYEPGDVIIEFNELPLDNLGYRRRG 298

Query: 275 DKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNK 334
           +    TE  ISL +A+ G  E+ +      + + L       I  G+I  ++G G P+  
Sbjct: 299 NNLFRTEY-ISLNEALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPIPN 357

Query: 335 NATRSGDLYIKFNIEFP--ADNWNSEM 359
              + GDLYI + +  P  + + N E+
Sbjct: 358 KKNKFGDLYIDYKVIIPKGSHHLNDEL 384

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 120/249 (48%), Gaps = 20/249 (8%)

Query: 106 QTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTC 165
           + ++ I +   +++++ + G  + + +     C+ C G G    ++GK     + +CK C
Sbjct: 152 RKAQSIQVTYPLSLREYFTGANVNFQMDFKDTCDHCKGSG---SEDGK-----VDKCKEC 203

Query: 166 DGAGYKQVRQQIAPGFFTKQ-NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESI 224
            G G+  V Q I  G  T+Q +  C  C G G      ++ KN C KC+G+ ++  S+ I
Sbjct: 204 GGNGF--VVQVIRMGPVTQQMHTQCPKCHGAG------STIKNHCKKCHGQKLVTKSKEI 255

Query: 225 TVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTI 284
            V +P G+      I++N  D+EL   + GDL+   +EI       +R G+ DL     +
Sbjct: 256 NVKVPAGAPRDFLKIVENGGDKELNA-EAGDLLVQFQEIAQNNLGYRRRGN-DLFRTEAL 313

Query: 285 SLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYI 344
              DA+ G   + I      R +++S   G  +   +I K+ G G P+ + + R GDLYI
Sbjct: 314 VFKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPI-QGSDRFGDLYI 372

Query: 345 KFNIEFPAD 353
            + I  P +
Sbjct: 373 DYVIIVPQN 381

>NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {ON}
           Anc_8.61
          Length = 552

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 111/410 (27%), Positives = 174/410 (42%), Gaps = 104/410 (25%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           KD Y++L V+ + +  E+KK Y KLA KYHPD  +  D          E KF ++ +AYE
Sbjct: 78  KDPYSVLGVNNSASTSEIKKAYYKLAKKYHPDINKQPDA---------EKKFHDLQNAYE 128

Query: 70  ILSDEEKRKQYDL--QKNFRDANQ------------------------------------ 91
           ILSDE KRKQYD      F+DA Q                                    
Sbjct: 129 ILSDENKRKQYDTFGPSAFQDAQQGGAGGPGGGPGGFPGGYPFGQTSSGSGNPFADFGIN 188

Query: 92  -----GSDYGDGINTAFGNQTSKDISI-------PLKVT----IKDLYNGKIIRYDIKRN 135
                G+ +G+G +   G +  +  +I       P+++      KD   G +   ++K N
Sbjct: 189 FEDLFGAAFGNGPHATGGGRARRQSNIYREFKGDPIEIVHNLNFKDAVFG-VQNVNLKFN 247

Query: 136 VI--CEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCD 193
            +  C KC G G    +N K+     T C +C G+G K     I  GF  +    C +C 
Sbjct: 248 SMDPCNKCSGSGL--NRNAKR-----TTCPSCHGSGQK---VHIRSGF--QMVSTCNHCH 295

Query: 194 GKGRYYKKPASSKNFCLKCNGKGI-IEISESITVNIPRGSSDKDTIIIDNKAD-QELG-- 249
           G+G        SK+ C  C+G G+ +  ++SI VN+P G  D D I +  + +  + G  
Sbjct: 296 GEGTII----DSKDICSSCHGDGVELNHNKSIDVNLPNGLQDGDVIRVPGQGNYPQTGAS 351

Query: 250 ---------KFKTGDLIFVLEEIDDEQTALKRYGDK-DLITELTISLADAITGFKEKPIV 299
                    K   GDL+  +    D   +++   DK D+     I +  AI G   K  +
Sbjct: 352 IDPAMMNSIKLSRGDLLVRVRVNKDPNFSIR---DKYDIWFTKQIPITTAILGGVVK--I 406

Query: 300 KTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNK-NATRSGDLYIKFNI 348
            T+DG  +RL +  G   +   I+ +   G P +  N    G++ +++ I
Sbjct: 407 PTVDGTQIRLKVSPG--TKHDQIISIPNLGVPRSSINKDNRGNMKVQYKI 454

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 105/406 (25%), Positives = 163/406 (40%), Gaps = 94/406 (23%)

Query: 4   ENDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKE 63
            N+ + KD Y  L + ++ T  E+KK Y KLA KYHPD  +  D          E KF +
Sbjct: 54  RNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEVDA---------EKKFHD 104

Query: 64  IISAYEILSDEEKRKQYD----------------------LQKNFRD----ANQGSDYGD 97
           + +AYEILSDE KR+QYD                          F D     N G     
Sbjct: 105 LQNAYEILSDENKRQQYDQFGPAAFGGGGAAGGPGSGGSPFGSQFHDFSGFTNAGGSPFG 164

Query: 98  GIN-----------------------TAFGNQTSKDISIPLKVTIKD-LYNGKIIRYDIK 133
           GIN                       + F       I I  KV+ KD ++    ++    
Sbjct: 165 GINFEDLFGAAFGGAGRSSGGGPRSSSMFRQYRGDPIEIVHKVSFKDAVFGSNNVQLKFS 224

Query: 134 RNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCD 193
               C  C G G +   +          C TC G G       I  GF  +    C  C+
Sbjct: 225 ALDPCSTCSGTGMKPNTHK-------VNCSTCHGTG---TTVHIRGGF--QMMSTCPTCN 272

Query: 194 GKGRYYKKPASSKNFCLKCNGKGI-IEISESITVNIPRGSSDKDTIIIDNKAD------- 245
           G+G   K+P  S   C KC+G+G+ +  +++ITV++P G  D D + I  +         
Sbjct: 273 GEGTM-KRPQDS---CTKCHGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVE 328

Query: 246 ---QELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTL 302
              ++  K   GD++  +    D   ++K   D     E+ I+ A A+ G    P   T+
Sbjct: 329 ADLKDTVKLSRGDILVRIRVDKDPNFSIKNKYDIWYDKEIPITTA-ALGGTVTIP---TV 384

Query: 303 DGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNI 348
           +G+ +R+ +  G   ++  ++ +   G P  K  T  GD+ I++ I
Sbjct: 385 EGQKIRIKVAPG--TQYNQVISIPNMGVP--KTTTIRGDMKIQYKI 426

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 125/285 (43%), Gaps = 52/285 (18%)

Query: 110 DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAG 169
           DI   LK T+ +LY+GK  +  ++R   C KC G G  + K+          C  C+G G
Sbjct: 232 DIKHTLKCTLSNLYSGKRSKLRLERTRCCLKCKGFGSLNIKS----------CSKCNGRG 281

Query: 170 YKQVRQQIAP--GFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVN 227
                ++  P    FT+    C  C G G +    A +++ C +C G+G +   +   V 
Sbjct: 282 SLTQTKKFGPMTQTFTQ---TCDGCGGNGTF----ADAQDICNECQGEGFLNEKKIFEVE 334

Query: 228 IPRGSSDKDTIIIDNKADQ----ELGKFKT--GDLIFVLEEIDDEQTALKRYGDKDLITE 281
           I  G +D   II+  +AD+     LGK +   GD+I  +  + D    + +  D  L   
Sbjct: 335 ITPGMTDGQLIILTGEADEVISTNLGKERVIPGDIILTINLLPDPTFKVVQGADL-LYAN 393

Query: 282 LTISLADAITG----FKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWP------ 331
             I+L  ++ G     K  P        L++++I  G++I+ G I  VE  G P      
Sbjct: 394 YKINLLTSLCGGSIYIKNHP-----SEHLIKINIIPGELIKNGAIKTVENLGMPKIDLSV 448

Query: 332 -------LNKNATRSGDLYIKFNIEFPADNWNSEMNDIIKIRNLL 369
                   NK  T  G+L I F I +P      E + +I+++N+L
Sbjct: 449 GHSNDIQANK-PTLKGNLVIHFEIVYPD---MLETDTVIELQNIL 489

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (60%), Gaps = 8/74 (10%)

Query: 8  STKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISA 67
          ++  LY IL+V     +  +KK YR LALKYHPDK        +++  E +  F++I  A
Sbjct: 3  ASTQLYDILQVRYDSDESVIKKAYRTLALKYHPDK--------NNLSEESKQMFQKISEA 54

Query: 68 YEILSDEEKRKQYD 81
          Y +LS+++KR+ YD
Sbjct: 55 YVVLSNKDKRQMYD 68

>Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON}
           (23785..25272) [1488 nt, 496 aa]
          Length = 495

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 103/401 (25%), Positives = 163/401 (40%), Gaps = 88/401 (21%)

Query: 5   NDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEI 64
           +D S KD Y  L V  + +Q E+KK Y KLA KYHPD  +  D          E  F  +
Sbjct: 50  SDSSFKDPYKTLGVARSASQSEIKKAYYKLAKKYHPDINKEPDA---------EKTFHNL 100

Query: 65  ISAYEILSDEEKRKQYD-LQKNFRDANQGSDYGDG------------------------- 98
            +AYEILSDE+KR Q+D    +    N G   G G                         
Sbjct: 101 QNAYEILSDEDKRAQFDQFGASAFSQNAGPSGGSGGFNPFANGNGGGFGDFGGLNFEDLF 160

Query: 99  -----------INTAFGNQTSK-------DISIPLKVTIKDLYNGKIIRYDIKRNVI--C 138
                       N  FG++ +         I I   ++ KD   G +    +  N +  C
Sbjct: 161 GAAFGGGASGRSNGGFGSRVNMVREYKGDTIEIIHNLSFKDAVFG-VNNVSLTFNALDPC 219

Query: 139 EKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRY 198
           + C G G +  +N K+       C  C+G G    +  +  GF  +    C +C G+G  
Sbjct: 220 DTCHGSGLKKGENHKRR-----SCSYCNGTG---TQIHVRSGF--QMASTCNHCHGEGTI 269

Query: 199 YKKPASSKNFCLKCNGKGI-IEISESITVNIPRGSSDKDTIIIDNKA----------DQE 247
                + ++ C KC+G G+ ++  + I VN+P   SD D I I  +           D++
Sbjct: 270 I----AFEDMCTKCHGDGVKLDAQKKINVNLPSSLSDGDVIRIPGEGSFPNIAVPEEDKD 325

Query: 248 LGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLL 307
             K   GDL+  +    D    +K   D   + E+ I+ A A+ G      +KT+D + +
Sbjct: 326 RVKLSRGDLLVRIRVKPDPDYTIKNKYDIWSVKEIPITTA-ALGG---TITIKTIDDKQI 381

Query: 308 RLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNI 348
           RL +  G   +   +  +   G P  +N    GD+ I++ +
Sbjct: 382 RLKVMAG--TQHDQVTSIPNMGVP-RRNGLGRGDMKIQYKV 419

>YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}
           MDJ1Co-chaperone that stimulates the ATPase activity of
           the HSP70 protein Ssc1p; involved in protein
           folding/refolding in the mitochodrial matrix; required
           for proteolysis of misfolded proteins; member of the
           HSP40 (DnaJ) family of chaperones
          Length = 511

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 105/408 (25%), Positives = 169/408 (41%), Gaps = 97/408 (23%)

Query: 4   ENDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKE 63
            N+ + KD Y  L + ++ T  E+KK Y KLA KYHPD  +  D          E KF +
Sbjct: 54  RNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDA---------EKKFHD 104

Query: 64  IISAYEILSDEEKRKQYD-----------------------LQKNFRD-----ANQGSDY 95
           + +AYEILSDE KR+QYD                           F D     +  GS +
Sbjct: 105 LQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQFHDFSGFTSAGGSPF 164

Query: 96  GDGIN-----------------------TAFGNQTSKDISIPLKVTIKD-LYNGKIIRYD 131
           G GIN                       + F       I I  KV+ KD ++  K ++  
Sbjct: 165 G-GINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGDPIEIVHKVSFKDAVFGSKNVQLR 223

Query: 132 IKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKN 191
                 C  C G G +   +          C TC G G       I  GF  +    C  
Sbjct: 224 FSALDPCSTCSGTGMKPNTHK-------VSCSTCHGTG---TTVHIRGGF--QMMSTCPT 271

Query: 192 CDGKGRYYKKPASSKNFCLKCNGKGI-IEISESITVNIPRGSSDKDTIIIDNKAD----- 245
           C+G+G   K+P   ++ C KC+G+G+ +  +++ITV++P G  D D + I  +       
Sbjct: 272 CNGEGTM-KRP---QDNCTKCHGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIA 327

Query: 246 -----QELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVK 300
                ++  K   GD++  +    D   ++K   D     E+ I+ A A+ G    P   
Sbjct: 328 VEADLKDSVKLSRGDILVRIRVDKDPNFSIKNKYDIWYDKEIPITTA-ALGGTVTIP--- 383

Query: 301 TLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNI 348
           T++G+ +R+ +  G   ++  ++ +   G P  K +T  GD+ +++ I
Sbjct: 384 TVEGQKIRIKVAPG--TQYNQVISIPNMGVP--KTSTIRGDMKVQYKI 427

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 103/404 (25%), Positives = 168/404 (41%), Gaps = 97/404 (24%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           KD Y  L ++   +Q ++KK Y KLA KYHPD  +  +          E KF ++ +AYE
Sbjct: 46  KDPYKTLGINSNASQSDIKKAYYKLAKKYHPDINKEENA---------EAKFHDLQNAYE 96

Query: 70  ILSDEEKRKQYD------LQKNFRDA-----------------NQGSDYGDGINTA--FG 104
           ILSDE+KRKQYD         N   +                 N  SD+G GIN    FG
Sbjct: 97  ILSDEQKRKQYDQFGPSAFDPNINTSGNSNPFTSDPFGFGTTNNPFSDFG-GINFEDLFG 155

Query: 105 NQTSKD--------------------ISIPLKVTIKD-LYNGKIIRYDIKRNVICEKCVG 143
           N   +                     I +   +  KD ++  K ++ +      C  C G
Sbjct: 156 NAFKQQHSNNTSNSNRNFFREFKGDTIHLNYNLNFKDSVFGKKNVKLNFNSFDPCNTCNG 215

Query: 144 LGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPA 203
            G +   +        + C+TC+G G    R  I  GF  +    C +C+G+G       
Sbjct: 216 SGLKHNAHK-------STCQTCNGTG---TRVHIRGGF--QMMSTCNDCNGEG----TKI 259

Query: 204 SSKNFCLKCNGKGI-IEISESITVNIPRGSSDKDTIIIDNKA-------DQEL-----GK 250
              ++C  C+G G+  + ++ ITV++P    D D I + NK        D +L      +
Sbjct: 260 DPNDYCNHCHGDGVEFKRNKEITVDLPNALQDGDVIRVSNKGSYPQMAMDPDLINNNNVR 319

Query: 251 FKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLS 310
              GD++  +  I+D +  ++   D     E+ I+ A A+ G    P   ++DG  +RL 
Sbjct: 320 MTRGDILIKINVINDTKFKIRDKYDIWYTMEIPITTA-ALGGIVTIP---SIDGTNVRLR 375

Query: 311 IPVGKVIRFGDILKVEGEGWPLNK------NATRSGDLYIKFNI 348
           +  G   +   I+ +   G P +       N T  G++ +++ I
Sbjct: 376 VSPG--TQNDQIISIPNMGVPRSNIFSRSTNTTNRGNMKVQYKI 417

>CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016c MDJ1
           heat shock protein - chaperone
          Length = 522

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 100/406 (24%), Positives = 161/406 (39%), Gaps = 91/406 (22%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           KD Y  L V ++ +Q ++KK Y KLA KYHPD +    G E         KF ++ +AYE
Sbjct: 46  KDPYETLGVKKSSSQSDIKKAYYKLAKKYHPD-INKEAGAEK--------KFHDLQNAYE 96

Query: 70  ILSDEEKRKQYD--------------LQKNFRDANQGSDYGDGINTAFGNQTSKDISIPL 115
           ILSDE KRKQYD                         + +G+G    F    +       
Sbjct: 97  ILSDESKRKQYDQFGAAAFSGGAGAGPGGPGAGPGGFNPFGNGFGFDFSGGQAGGAGGFG 156

Query: 116 KVTIKDL--------------------------YNGKIIR----YDIKRNVICEKCVGLG 145
            +  +DL                          Y G  I      D K  V  +K V + 
Sbjct: 157 GINFEDLFGTAFGGGPFGSSSNSGRRSSSMFREYKGDTIEVIQNLDFKDAVFGKKNVSIK 216

Query: 146 WRS-------RKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRY 198
           +R+         +G +     T C +C G+G       +  GF  +    C+ C G+G  
Sbjct: 217 FRALDPCGTCNGSGLKSGASKTTCPSCHGSG---TTVHVRAGF--QMMSTCQTCGGEG-- 269

Query: 199 YKKPASSKNFCLKCNGKGI-IEISESITVNIPRGSSDKDTIII-------DNKADQELG- 249
                ++ +FC  C+G+G+ +   ++ITV++P G  D D + I       D   D+E+  
Sbjct: 270 --TTVNASDFCKSCHGEGVNVNTQKTITVDLPHGLQDGDVVRIPGQGSYPDIAVDKEMAK 327

Query: 250 --KFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLL 307
             K   GD++  +    D   ++K   D     E+ I+ A A+ G    P   T++G  +
Sbjct: 328 SVKLSRGDILVRIRVNKDPHFSIKNKYDIWYTKEIPITTA-ALGGTVSIP---TIEGTKI 383

Query: 308 RLSIPVGKVIRFGDILKVEGEGWP-----LNKNATRSGDLYIKFNI 348
           R+ +P G       ++ +   G P      N      GD+ I++ +
Sbjct: 384 RIKVPAGTAPE--QVISIPNMGVPKSSPYRNSAVQARGDMKIQYKV 427

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 103/406 (25%), Positives = 166/406 (40%), Gaps = 101/406 (24%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           KD Y  L + ++ T  E+KK Y KLA KYHPD  +  D          E KF ++ +AYE
Sbjct: 60  KDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDA---------EKKFHDLQNAYE 110

Query: 70  ILSDEEKRKQYDLQ---------------------------KNFRDANQGSDYGDGIN-- 100
           ILSD+ KR+Q+D                               F +A+ GS +G GIN  
Sbjct: 111 ILSDDTKRQQFDQFGPAAFGGGGGGGAGGAGSPFGSQFHDFSGFTNASGGSPFG-GINFE 169

Query: 101 -------------------------TAFGNQTSKD-ISIPLKVTIKD-LYNGKIIRYDIK 133
                                    +    Q   D I I  KV+ KD ++  K ++    
Sbjct: 170 DLFGAAFGGGGAGAGAGRGGSGGRSSPMYRQYRGDPIEIVHKVSFKDAVFGAKNVQLKFS 229

Query: 134 RNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCD 193
               C  C G G +   +          C TC G+G       +  GF  +    C  C+
Sbjct: 230 ALDPCGTCSGTGMKPNTHK-------VSCTTCHGSGSTV---HVRGGF--QMMSTCPTCN 277

Query: 194 GKGRYYKKPASSKNFCLKCNGKGI-IEISESITVNIPRGSSDKDTIIIDNKAD------- 245
           G+G   K+P   ++ C  C+G+G+     +SITV++P G  D D + I  +         
Sbjct: 278 GEGTM-KRP---QDNCTSCHGEGVQANRGKSITVDLPHGLQDGDVVRIPGQGSYPDIAVE 333

Query: 246 ---QELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTL 302
              Q+  K   GD++  +    D   +++   D     E+ I+ A A+ G    P   T+
Sbjct: 334 ADLQDSIKLSRGDILVRIRVDKDPSFSIRNKYDIWYDKEIPITTA-ALGGTITIP---TV 389

Query: 303 DGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNI 348
           DG+ +R+ +  G   ++  ++ +   G P  + AT  GD+ +++ I
Sbjct: 390 DGQKIRIKVAPG--TQYNQVISIPNMGVP--RTATLRGDMKVQYKI 431

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 120/299 (40%), Gaps = 66/299 (22%)

Query: 110 DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAG 169
           DI   L  T+K+LY GK  +  + R   C  C G+G      G   +     C  C G G
Sbjct: 172 DIKHVLNCTLKELYQGKKCKLGLNRTRSCHSCNGMG------GMNTII----CNECQGKG 221

Query: 170 YKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESITVNIP 229
                + + P      +  C NC G G +      S++ C +C G+G +      TV + 
Sbjct: 222 INTETKMLGP-MVQSWSSTCFNCSGMGYF----IDSQSGCKECQGEGYLRERTIFTVTVK 276

Query: 230 RGSSDKDTIIIDNKADQEL--GKFKT-----GDLIFVLEEID------------------ 264
            G  +   I++  +ADQ +  GK        GD+I V+ +I+                  
Sbjct: 277 PGMRNNQKIVLKGEADQVMLVGKLNKEKVIPGDVIIVINQIEGKSWKNDSNIDQGENKNK 336

Query: 265 ------DEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIR 318
                 +E+  L R    DLIT    SL       K  P      G+L++L I   ++++
Sbjct: 337 FHFEIINEKDLLLRNCQIDLIT----SLCGGEIYIKNHP-----SGKLIKLDIIPSEILK 387

Query: 319 FGDILKVEGEGWPL--------NKNATRSGDLYIKFNIEFPADNWNSEMNDIIKIRNLL 369
              +  VE  G P          +    +GDLYI+F +++P    N  ++   K+R++L
Sbjct: 388 PDCLKCVENLGMPRYIEDETNNGEEYLPNGDLYIQFKVKYPTKLENETID---KLRSIL 443

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 8/70 (11%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY+IL+V    T  E+K  Y+KLALKYHPDK   ++        E +LKF+EI  AYE+L
Sbjct: 14 LYSILQVPTAATLFEIKNAYKKLALKYHPDKNNHSE--------ESKLKFQEICKAYEVL 65

Query: 72 SDEEKRKQYD 81
           D++K+  YD
Sbjct: 66 HDKDKKLLYD 75

>NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {ON}
           Anc_8.61
          Length = 519

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 106/405 (26%), Positives = 159/405 (39%), Gaps = 98/405 (24%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           KD Y +L ++++ T  E+KK Y KLA KYHPD          + +   E KF ++ +AYE
Sbjct: 50  KDPYKVLGINKSATSSEIKKAYYKLAKKYHPDI---------NKEPTAEKKFHDLQNAYE 100

Query: 70  ILSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGNQTSK----------DISI------ 113
           ILSDE K+ QYD   +      GS      N  F    S           D  I      
Sbjct: 101 ILSDETKKSQYDTFGSAAFNQDGSGGASSANNPFAGGFSSSGGPGGNPFTDFGINFEDLF 160

Query: 114 --------------------------------PLKVT----IKDLYNGKIIRYDIKRNVI 137
                                           PL++T     KD   G +    +K NV+
Sbjct: 161 GAAFGGGAGTGPGGARSGGARRSNMYREFKGDPLEITHRIPFKDAVFG-LANVSLKYNVM 219

Query: 138 --CEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGK 195
             C  C G G    K G Q      +C +C G+G K     I  GF  +    C  C G+
Sbjct: 220 DPCHTCHGSGI---KQGAQK----HQCPSCHGSGQK---VHIRSGF--QMVSTCNECHGE 267

Query: 196 GRYYKKPASSKNFCLKCNGKGI-IEISESITVNIPRGSSDKDTIIIDNKA-------DQE 247
           G       ++ ++C  C+G  +      SI VN+P G  D D I I  +        D E
Sbjct: 268 GTIL----NASDYCGTCHGDAVEFTRDHSINVNLPNGLQDGDVIRIPGQGNYPQMALDPE 323

Query: 248 LG---KFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDG 304
           L    K   GD++  +    D + ++K   D     ++ I+ A A+ G    P   T+DG
Sbjct: 324 LKNSVKLTRGDVLVRIRVDKDNRFSIKDKYDIWFTKDIPITTA-ALGGIVTIP---TVDG 379

Query: 305 RLLRLSIPVGKVIRFGDILKVEGEGWPLNK-NATRSGDLYIKFNI 348
             LRL +  G   +   ++ +   G P +  N    G++ +++ I
Sbjct: 380 TTLRLKVQAG--TQHDQVISIPNLGVPRSSINKENRGNMKVQYRI 422

>Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}
           YFL016C (REAL)
          Length = 517

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 105/414 (25%), Positives = 165/414 (39%), Gaps = 104/414 (25%)

Query: 4   ENDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKE 63
            ND + KD Y  L + ++ T  E+KK Y KLA KYHPD  +  D          E KF +
Sbjct: 54  RNDEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDA---------EKKFHD 104

Query: 64  IISAYEILSDEEKRKQ-----------------------------YDLQKNFRDANQGSD 94
           + +AYEILSDE KR+Q                             +D    F +A   S 
Sbjct: 105 LQNAYEILSDESKRQQYDQFGPAAFGGGDAAGGPSGGGSPFGSQFHDFS-GFSNAGGSSP 163

Query: 95  YGDGIN----------------------------TAFGNQTSKDISIPLKVTIKD-LYNG 125
           +G GIN                            + F       I I   V+ KD ++  
Sbjct: 164 FG-GINFEDLFGAAFGGAGRGSSSSGGGGSTRSSSMFRQYRGDPIEIVHNVSFKDAVFGS 222

Query: 126 KIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQ 185
             ++        C  C G G +   +          C TC G G       I  GF  + 
Sbjct: 223 NNVQLKFSALDPCGTCSGTGMKPNTHK-------VNCGTCHGTG---TTVHIRGGF--QM 270

Query: 186 NLVCKNCDGKGRYYKKPASSKNFCLKCNGKGI-IEISESITVNIPRGSSDKDTIII---- 240
              C  C+G+G   K+P  S   C KC+G+G+ +   ++ITV++P G  D D + I    
Sbjct: 271 MSTCPTCNGEGTM-KRPQDS---CSKCHGEGVQVNRGKTITVDLPHGLQDGDVVRIPGQG 326

Query: 241 ---DNKADQELG---KFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFK 294
              D   +++L    K   GD++  +    D   ++K   D     E+ I+ A A+ G  
Sbjct: 327 SYPDIAVEEDLKDSVKLSRGDILVRIRVDKDPNFSIKNKYDIWYNKEIPITTA-ALGGTV 385

Query: 295 EKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNI 348
             P   T++G+ +R+ +  G   ++  ++ +   G P  K  T  GD+ +++ I
Sbjct: 386 TIP---TVEGQKIRIKVAPG--TQYNQVISIPNMGVP--KTPTIRGDMKVQYKI 432

>KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 471

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 125/291 (42%), Gaps = 47/291 (16%)

Query: 109 KDISIPLKVTIKD-LYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTCDG 167
           +++++P +V+ KD ++  K ++ + +    C  C G G ++  +        + C TC G
Sbjct: 170 ENVTVPFQVSFKDAVFGVKNVKLNYQCYDPCSSCDGSGLKAGHS-------RSVCPTCHG 222

Query: 168 AGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGI-IEISESITV 226
            G    +  +  GF  +    C+ CDG+G   K      + C  C+  G  +  +++ITV
Sbjct: 223 TG---TQVHVRAGF--QMASTCQTCDGEGSTIK----DSDKCGTCHSHGFKLNSNKTITV 273

Query: 227 NIPRGSSDKDTIIIDNKAD-----------QELGKFKTGDLIFVLEEIDDEQTALKRYGD 275
           ++P G  D DTI + N+              EL     GDL+  +    D +  +    D
Sbjct: 274 DLPHGLQDGDTIRVPNQGSYPGMAIDPSMKSEL-HLTRGDLLIRVRVRKDTRFQVSNNYD 332

Query: 276 KDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKN 335
                E+ I+ A A+ G  E P   T++   +RL +  G   +   ++++  +G P    
Sbjct: 333 IIYTQEIPITTA-ALGGVIEVP---TVEEEKIRLKVSSG--TQHDQVIRIPNKGVPRGAR 386

Query: 336 ATRSGDLYIKFNIEF--PADN-----WNS---EMNDIIKIRNLLPAISDAK 376
             R GD+ +KF I    P D      W +     ND    R + P+ S AK
Sbjct: 387 GDR-GDMLVKFKIVIKKPKDETERYLWETLAHLTNDTTARRTITPSGSSAK 436

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 48/72 (66%), Gaps = 9/72 (12%)

Query: 10 KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
          KD Y +L +++  +Q ++KK Y KLA KYHPD     + +ED  K     KF ++ +AYE
Sbjct: 24 KDPYKVLGINKNSSQSDIKKAYYKLAKKYHPD----INKEEDSQK-----KFHDLQNAYE 74

Query: 70 ILSDEEKRKQYD 81
          ILSDE+KRKQYD
Sbjct: 75 ILSDEDKRKQYD 86

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
           (REAL)
          Length = 224

 Score = 63.5 bits (153), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 53/118 (44%), Gaps = 29/118 (24%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           + Y IL VD+  T  E+KK YRKLA+K HPDK       E          FK I  A+E+
Sbjct: 21  EFYEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASE---------AFKVINRAFEV 71

Query: 71  LSDEEKRKQYD---------------LQKNFRDANQGSDYGDG-----INTAFGNQTS 108
           LS+EEKR  YD                   FR +  GS  G G      N+ FG Q +
Sbjct: 72  LSNEEKRSIYDRIGRDPDDRQMPSSSAASGFRGSAGGSPMGSGFEDMFFNSRFGGQRA 129

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
           HLJ1Co-chaperone for Hsp40p, anchored in the ER
           membrane; with its homolog Ydj1p promotes ER-associated
           protein degradation (ERAD) of integral membrane
           substrates; similar to E. coli DnaJ
          Length = 224

 Score = 63.5 bits (153), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 53/118 (44%), Gaps = 29/118 (24%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           + Y IL+VD   T  E+KK YRKLA+K HPDK       E          FK I  A+E+
Sbjct: 21  EFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGE---------AFKVINRAFEV 71

Query: 71  LSDEEKRKQYD---------------LQKNFRDANQGSDYGDG-----INTAFGNQTS 108
           LS+EEKR  YD                   FR +  GS  G G      N+ FG Q +
Sbjct: 72  LSNEEKRSIYDRIGRDPDDRQMPSRGAASGFRGSAGGSPMGGGFEDMFFNSRFGGQRA 129

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 57/96 (59%), Gaps = 6/96 (6%)

Query: 5   NDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKV-QTTDGDEDDVKLEYELKFKE 63
           ND S K+ Y +L V +  T  +++K Y  +  KYHPDK  Q ++      K++ + K  E
Sbjct: 499 NDMSKKNYYKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQ----KIKNQEKMSE 554

Query: 64  IISAYEILSDEEKRKQYDLQKNFRDAN-QGSDYGDG 98
           I  AYEILSDE KRK+YD Q++ R    QGS +G G
Sbjct: 555 INEAYEILSDEGKRKEYDDQRSGRAPQGQGSPFGQG 590

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
           Anc_2.350 YMR161W
          Length = 225

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 51/92 (55%), Gaps = 10/92 (10%)

Query: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
            Y +L+++ + + +E+KK YRKLA+K HPDK       E          FK I  A+E+L
Sbjct: 25  FYEVLQIERSASDNEIKKSYRKLAIKLHPDKNPHPRASE---------AFKVINRAFEVL 75

Query: 72  SDEEKRKQYD-LQKNFRDANQGSDYGDGINTA 102
           SDEEKR+ YD L ++  D N  S    G  TA
Sbjct: 76  SDEEKRRLYDRLGRDPDDRNMPSASSSGFRTA 107

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  T  + E+KK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLNVSPTANEQEIKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          SD EKR+ YD
Sbjct: 56 SDAEKREVYD 65

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 57/99 (57%), Gaps = 11/99 (11%)

Query: 256 LIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGK 315
           L F+L+E  +  T  KR  D +LI  L ++  +++ GF++   +KT+DG+ L    P+ +
Sbjct: 254 LQFILKEKPN--TNFKRDED-NLIYTLPLTFKESLLGFQK--TIKTIDGKTL----PISR 304

Query: 316 V--IRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPA 352
           V  ++  +     G+G P++K+  + GD+ +KF + +P 
Sbjct: 305 VQPVQPSECTTYPGQGMPISKSVGQRGDMIVKFKVGYPT 343

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 48/81 (59%), Gaps = 12/81 (14%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  T  + ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKSALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYDLQKNFRDANQG 92
          +D++KR+ YD Q     A QG
Sbjct: 56 NDKQKREIYD-QYGLEAARQG 75

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 70/148 (47%), Gaps = 11/148 (7%)

Query: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKAD--QELGKFKTGDLIFVLEEI 263
           K+F +   G G  +    I + +  G      +   N  D     G  KT  L FV++E 
Sbjct: 210 KSFKVGRKGPGGAQEKVQIDIQLKAGWKAGTKVTYKNHGDYNPRTGGRKT--LQFVIQE- 266

Query: 264 DDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDIL 323
                  KR GD DL   L ++  +++ GF +   ++T+DGR L LS      ++  +  
Sbjct: 267 -KTHPLYKRNGD-DLEYTLPLTFKESLLGFSK--TIQTIDGRTLPLS--RSSPVQPTETS 320

Query: 324 KVEGEGWPLNKNATRSGDLYIKFNIEFP 351
           +  G+G P+ K  ++ GDL ++F I++P
Sbjct: 321 RYPGQGMPMPKMPSQRGDLVVRFKIDYP 348

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/93 (41%), Positives = 52/93 (55%), Gaps = 4/93 (4%)

Query: 5   NDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEI 64
           ND S K+ Y +LEV    T  +++K Y  +  KYHPDK       +   KL+ + +  EI
Sbjct: 497 NDMSKKNYYKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQ---KLQNQERMSEI 553

Query: 65  ISAYEILSDEEKRKQYDLQKNFR-DANQGSDYG 96
             AYEILSDE KRK+YD Q+  R    QG  +G
Sbjct: 554 NEAYEILSDEGKRKEYDDQRAGRGQQRQGFPFG 586

>ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {ON}
           similar to uniprot|Q752R6 Ashbya gossypii AFR507W
           AFR507Wp and some similarites with YFL016C
           uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 462

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 99/397 (24%), Positives = 161/397 (40%), Gaps = 91/397 (22%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           KD Y  L V ++ +  E+KK Y KLA KYHPD +    G  D        KF ++ +AYE
Sbjct: 32  KDPYDTLGVGKSASPSEIKKAYYKLAKKYHPD-INKEQGAGD--------KFHDLQNAYE 82

Query: 70  ILSDEEKRKQYD---------------------LQKNFRDANQGSDYGDGIN-------T 101
           ILSD +K+ QYD                         F D +   ++G GIN        
Sbjct: 83  ILSDADKKSQYDQFGAAAFGQGGAGGGPGGPGAGYGGFSDFSGFGNFG-GINFEDLFGAA 141

Query: 102 AFGNQTSKDISIPLKVTIKDLYNGKII----RYDIKRNVICEKCVGLGWRSRKNGKQYVP 157
             G         P   ++   Y G  I    R   K  V   K V L +R+         
Sbjct: 142 FGGGGGRSSRGSPFGSSMFREYRGDPIEVSYRMPFKDAVFGAKDVNLKFRA--------- 192

Query: 158 PLTECKTCDGAGYKQ-VRQQIAP-------------GFFTKQNLVCKNCDGKGRYYKKPA 203
            L  C TCDG+G K   + Q  P             GF  +    C+ C G+G   K+  
Sbjct: 193 -LDPCHTCDGSGMKTGAKPQSCPSCHGTGTTVHVRAGF--QMATTCQQCGGEGTTTKR-- 247

Query: 204 SSKNFCLKCNGKGIIEISE-SITVNIPRGSSDKDTIIIDNKAD----------QELGKFK 252
             ++ C  C+G G+    + S+ V++P+G  D D + +  +            +   + +
Sbjct: 248 --EDLCGSCHGDGVEWTKDKSVRVDLPQGLQDGDVVRVPGQGSYPNMAVPPEMKSSIRLR 305

Query: 253 TGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIP 312
            GD++  +    D + +++   D   I ++ I+ A A+ G  + P   T+DG  +RL + 
Sbjct: 306 RGDVLVRIRVDKDPRFSIRDKWDIWFIQDIPITTA-ALGGTVQVP---TVDGSHVRLRVQ 361

Query: 313 VGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIE 349
            G   +   I+ +   G P  + A   G + +++ I+
Sbjct: 362 PG--TQHDQIISIPNMGVP--RVAGTRGSMKVQYKIQ 394

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  T  + ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLNVQPTANEQELKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          +D +KR+ YD
Sbjct: 56 NDPQKREIYD 65

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 52/96 (54%), Gaps = 7/96 (7%)

Query: 256 LIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGK 315
           L F++ E        KR  D +LI  L ++  +++ GF +   ++T+DG+ L LS   G+
Sbjct: 264 LQFIISE--KPHPHFKRE-DDNLIYTLPLTFKESLLGFSK--TIQTIDGKNLPLS--RGQ 316

Query: 316 VIRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
            ++  +     G+G P+ K   + GDL IK+ +++P
Sbjct: 317 PVQPSETTTYPGQGMPITKKPGQRGDLLIKYKVDYP 352

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 58/116 (50%), Gaps = 20/116 (17%)

Query: 5   NDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEI 64
           +DP  KD Y +L V    T  E++K Y  L  KYHPDK++    D+++   E      +I
Sbjct: 530 HDPQ-KDYYKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHE---TMSQI 585

Query: 65  ISAYEILSDEEKRKQYDLQKN----------------FRDANQGSDYGDGINTAFG 104
             AYE LSD++KRK+YDL ++                F++   G  +G+G    FG
Sbjct: 586 NEAYETLSDDDKRKEYDLSRSNPRRNTFAQGPRQNNMFKNPGNGFPFGNGFKMNFG 641

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  T  + ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          +D +KR+ YD
Sbjct: 56 NDSQKREIYD 65

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 77/162 (47%), Gaps = 23/162 (14%)

Query: 202 PASSKNFC------LKCNGKGIIEISE--SITVNIPRGSSDKDTIIIDNKAD--QELGKF 251
           P S ++ C       K   KG    SE   I + + +G      I   N+ D     G  
Sbjct: 204 PVSLEDLCAGKKKSFKIGRKGPNGTSEKTQIDIQLKQGWKAGTKITYKNEGDYNPRTGGR 263

Query: 252 KTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSI 311
           KT  L FVL+E        KR GD +LI  L +S  +++ GF +   ++T+DGR L    
Sbjct: 264 KT--LQFVLQE--KAHPLFKRDGD-NLIYTLPLSFKESLLGFSK--TIQTIDGRTL---- 312

Query: 312 PVGKV--IRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
           P+ +V  I+  +  +  G+G P+ K   + GDL +K+ I++P
Sbjct: 313 PISRVQPIQPSESSRYPGQGMPITKKPGQRGDLIVKYKIDYP 354

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 57/115 (49%), Gaps = 20/115 (17%)

Query: 6   DPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEII 65
           DP  KD Y IL V  + +  E++K Y  L  KYHPDK++    D+ +   E      +I 
Sbjct: 534 DPK-KDYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHE---TMSQIN 589

Query: 66  SAYEILSDEEKRKQYDLQKN----------------FRDANQGSDYGDGINTAFG 104
            AYE LSD++KRK+YDL ++                F++   G  +G+G    FG
Sbjct: 590 EAYETLSDDDKRKEYDLSRSNPRRNTFPQGPRQNNMFKNPGSGFPFGNGFKMNFG 644

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  T  + ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          +D +KR+ YD
Sbjct: 56 NDSQKREIYD 65

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 71/147 (48%), Gaps = 13/147 (8%)

Query: 209 CLKCNGKGIIEISE--SITVNIPRGSSDKDTIIIDNKAD--QELGKFKTGDLIFVLEEID 264
             K   KG    SE   I + +  G      I   N+ D   + G+ KT  L FV++E  
Sbjct: 214 SFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKT--LQFVIQE-- 269

Query: 265 DEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILK 324
                 KR GD DLI  L +S  +++ GF +   ++T+DGR L LS    + ++      
Sbjct: 270 KSHPNFKRDGD-DLIYTLPLSFKESLLGFSK--TIQTIDGRTLPLS--RVQPVQPSQTST 324

Query: 325 VEGEGWPLNKNATRSGDLYIKFNIEFP 351
             G+G P  KN ++ G+L +K+ +++P
Sbjct: 325 YPGQGMPTPKNPSQRGNLIVKYKVDYP 351

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
          YFL016C
          Length = 500

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/74 (45%), Positives = 45/74 (60%), Gaps = 9/74 (12%)

Query: 8  STKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISA 67
          + KD Y +L V  + +Q E+KK Y KLA +YHPD +    G E         KF ++ +A
Sbjct: 32 TIKDPYGVLGVKSSASQGEIKKAYYKLAKQYHPD-INKEAGAEK--------KFHDLQNA 82

Query: 68 YEILSDEEKRKQYD 81
          YEILSDE KRKQ+D
Sbjct: 83 YEILSDESKRKQFD 96

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 108/252 (42%), Gaps = 38/252 (15%)

Query: 111 ISIPLKVTIKDLYNGKIIRYDIKRNVI--CEKCVGLGWRSRKNGKQYVPPLTECKTCDGA 168
           + +   ++ KD   GK     +K NV   C+ C G G +   +  Q       C  C G+
Sbjct: 186 VHVSYNMSFKDAVFGKS-GVKLKFNVFDPCDTCSGSGIKKGASRHQ-------CPGCQGS 237

Query: 169 GYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGI-IEISESITVN 227
           G K     +  GF  +    C  C G+G       +S + C  C+G+G+     + ITV+
Sbjct: 238 GTKI---HVRGGF--QMMSTCNECQGEG----TTVNSSDLCGACHGEGVHFHRGKEITVD 288

Query: 228 IPRGSSDKDTIIIDNKA-------DQELG---KFKTGDLIFVLEEIDDEQTALKRYGDKD 277
           +P G  D D I I  +        D  L    K   GD++  +   +D    ++   D  
Sbjct: 289 LPHGLQDGDVIRIPGQGSYPEVALDPSLAGSVKLTRGDVLVNVRVEEDPTFTIRDKSDIW 348

Query: 278 LITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNAT 337
              E+ I+ A A+ G  + P   T+DG  +RL +  G   + GD++ V   G P   N T
Sbjct: 349 YTMEIPITTA-ALGGTVQVP---TVDGSHIRLKVAPG--TQSGDVITVPNMGVP-RSNLT 401

Query: 338 RS-GDLYIKFNI 348
           RS G + +++ I
Sbjct: 402 RSRGAMKVQYRI 413

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 42/70 (60%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  +  + ELKK Y+K ALKYHPDK     GD +        KFKEI  AYEIL
Sbjct: 7  LYDMLGVSPSANEQELKKGYKKAALKYHPDK---PAGDTE--------KFKEISEAYEIL 55

Query: 72 SDEEKRKQYD 81
          SD  KR+ YD
Sbjct: 56 SDSSKREIYD 65

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 56/98 (57%), Gaps = 11/98 (11%)

Query: 256 LIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGK 315
           L FVL+E        KR GD +LI  L +S  +++ GF +   ++T+DGR L    P+ K
Sbjct: 254 LQFVLQE--KSHPLYKRDGD-NLIYSLPLSFKESLLGFSK--TIQTIDGRTL----PISK 304

Query: 316 V--IRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
           +  ++  ++    G+G P++K   + GDL +K+ I++P
Sbjct: 305 IQPVQPTEVSSYPGQGMPVSKRPGQRGDLVVKYKIDYP 342

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  T  + ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDMLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          +D +KR+ YD
Sbjct: 56 NDPQKREIYD 65

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 67/137 (48%), Gaps = 21/137 (15%)

Query: 229 PRGSSDKDTIIIDNKADQELGKFKT----GD----------LIFVLEEIDDEQTALKRYG 274
           P G+S+K  I I  K   + G   T    GD          L FV++E        KR G
Sbjct: 215 PHGTSEKTQIDIQLKPGWKAGTKITYKNQGDFNPQTNRRKTLQFVIQE--KSHPNFKRDG 272

Query: 275 DKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNK 334
           D DLI  L +S  +++ GF +   ++T+DGR L LS    + ++        G+G P  K
Sbjct: 273 D-DLIYTLPLSFKESLLGFSK--TIQTIDGRTLPLS--RVQPVQPSQTSTYPGQGMPTPK 327

Query: 335 NATRSGDLYIKFNIEFP 351
           N ++ G+L +K+ +++P
Sbjct: 328 NPSQRGNLIVKYKVDYP 344

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  +  + ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGVSPSAQETELKKGYRKAALKYHPDK---PSGDAE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          +D +KR+ YD
Sbjct: 56 NDPQKREVYD 65

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 77/161 (47%), Gaps = 11/161 (6%)

Query: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD 265
           K+F +   G G     + + + +  G      I   N+ D      +   L F+L+E   
Sbjct: 200 KSFKITRKGPGGASEKQQVDIQLKPGWKAGTKITYKNEGDYNPRTGRRQTLQFILQE--K 257

Query: 266 EQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKV--IRFGDIL 323
             +   R G+ DLI  L ++  +++ GF +   ++T+DGR L    P+ +V  ++  D  
Sbjct: 258 PHSNYTRDGN-DLIYSLPLTFKESLLGFSK--TIQTIDGRTL----PISRVQPVQPSDSS 310

Query: 324 KVEGEGWPLNKNATRSGDLYIKFNIEFPADNWNSEMNDIIK 364
              G+G P+ K  ++ G+L +K+ I++P    +S+   I++
Sbjct: 311 TYPGQGMPIAKTPSQRGNLIVKYKIDYPVTLNDSQRRAILE 351

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 41/71 (57%), Gaps = 9/71 (12%)

Query: 11 DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
          + Y IL+VD+  T  E+KK YRKLA+K HPDK       E          FK I  A+E+
Sbjct: 21 EFYQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKASE---------AFKIINRAFEV 71

Query: 71 LSDEEKRKQYD 81
          LS+EEKR  YD
Sbjct: 72 LSNEEKRGLYD 82

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  T  + ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          +D +KR+ YD
Sbjct: 56 NDAQKREIYD 65

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 71/148 (47%), Gaps = 11/148 (7%)

Query: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKAD--QELGKFKTGDLIFVLEEI 263
           K+F +   G         I + +  G      I   N+ D   + G+ KT  L FV++E 
Sbjct: 215 KSFKIGRKGPHGAAEKTQIDIQLKPGWKAGTKITYKNQGDFNSQTGRRKT--LQFVIQE- 271

Query: 264 DDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDIL 323
                  KR GD DLI  L +S  +++ GF +   ++T+DGR L LS    + ++     
Sbjct: 272 -KGHPNFKRDGD-DLIYTLPLSFKESLLGFSK--TIQTIDGRTLPLS--RVQPVQPSQTS 325

Query: 324 KVEGEGWPLNKNATRSGDLYIKFNIEFP 351
              G+G P  KN ++ G+L +K+ +++P
Sbjct: 326 TYPGQGMPTPKNPSQRGNLIVKYKVDYP 353

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           Y IL+V+ T T++E+KK YRKLA++ HPDK       E          FK I  A+E+L
Sbjct: 22 FYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKASE---------AFKIINRAFEVL 72

Query: 72 SDEEKRKQYD 81
          SD EKR+ +D
Sbjct: 73 SDNEKRRIFD 82

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  +  + E+KK YRK ALKYHPDK     GD +        KFK+I  AYEIL
Sbjct: 7  LYDLLGVTPSANEQEIKKGYRKAALKYHPDK---PTGDTE--------KFKQISEAYEIL 55

Query: 72 SDEEKRKQYD 81
          SD  KR+ YD
Sbjct: 56 SDSNKREIYD 65

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 69/146 (47%), Gaps = 7/146 (4%)

Query: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD 265
           K+F +   G G ++    I + +  G      +   NK D          L F+   ID+
Sbjct: 208 KSFKIGRKGPGGVQEKTQIDIQLKPGWKAGTKLTYKNKGDYNPRTHGRKTLQFI---IDE 264

Query: 266 EQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKV 325
           +     +  D +L+  + ++  +++ GF +   V+T+DGR   L I   + I+  +I + 
Sbjct: 265 KPHPTFQREDDNLVCTVPLTFKESLLGFSK--TVQTIDGR--NLPISRSQPIQPTEITRY 320

Query: 326 EGEGWPLNKNATRSGDLYIKFNIEFP 351
            G+G P++K   + GDL +K+ I +P
Sbjct: 321 PGQGMPISKKPGQRGDLIVKYKIAYP 346

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 40/71 (56%), Gaps = 9/71 (12%)

Query: 11 DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
          + Y IL+VD   T  ++KK YRKLA+K HPDK       E          FK I  A+E+
Sbjct: 21 EFYEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGE---------AFKVINRAFEV 71

Query: 71 LSDEEKRKQYD 81
          LS+EEKR  YD
Sbjct: 72 LSNEEKRSIYD 82

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  +  + ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGVSPSANEQELKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          +D +KR+ YD
Sbjct: 56 NDPQKREIYD 65

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 71/147 (48%), Gaps = 13/147 (8%)

Query: 209 CLKCNGKGIIEISE--SITVNIPRGSSDKDTIIIDNKAD--QELGKFKTGDLIFVLEEID 264
             K   KG    SE   I + +  G      I   N+ D   + G+ KT  L FV++E  
Sbjct: 200 SFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKT--LQFVIQE-- 255

Query: 265 DEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILK 324
                 KR GD DLI  L +S  +++ GF +   ++T+DGR L LS    + ++      
Sbjct: 256 KSHPNFKRDGD-DLIYTLPLSFKESLLGFSK--TIQTIDGRTLPLS--RVQPVQPSQTST 310

Query: 325 VEGEGWPLNKNATRSGDLYIKFNIEFP 351
             G+G P  KN ++ G+L +K+ +++P
Sbjct: 311 YPGQGMPTPKNPSQRGNLIVKYKVDYP 337

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L +  +  + E+KK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          SD +KR+ YD
Sbjct: 56 SDPQKREVYD 65

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 65/148 (43%), Gaps = 11/148 (7%)

Query: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD 265
           K F +   G         + + +  G      I   N  D      +   L F+++E   
Sbjct: 196 KTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQE--K 253

Query: 266 EQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKV--IRFGDIL 323
           +     R G+ DLI  L ++  +++ GF +   ++T+DGR L    PV ++  I+  +  
Sbjct: 254 KHPFFTRDGN-DLIYTLPLTFKESLLGFNK--TIQTIDGRTL----PVSRIQPIQPSEKS 306

Query: 324 KVEGEGWPLNKNATRSGDLYIKFNIEFP 351
              G+G P+ K   + GD+ + + +++P
Sbjct: 307 TYPGQGMPIPKTPGQRGDMIVNYKVDYP 334

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  +  + ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGVSPSAQETELKKGYRKAALKYHPDK---PTGDAE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          +D +KR+ YD
Sbjct: 56 NDPQKREIYD 65

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 74/149 (49%), Gaps = 11/149 (7%)

Query: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD 265
           K+F +   G G     + + + +  G      I   N+ D      +   + F+++E   
Sbjct: 197 KSFKITRKGPGGAPEKQQVDIQLRPGWKAGTKITYKNEGDYNPRTGRRQTMQFIIQEKPH 256

Query: 266 EQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKV--IRFGDIL 323
           E     R G+ DLI  L ++  +++ GF +   ++T+DGR L    P+ +V  ++  D+ 
Sbjct: 257 EN--YTRDGN-DLIYTLPLTFKESLLGFNK--TIQTIDGRTL----PISRVQPVQPSDVS 307

Query: 324 KVEGEGWPLNKNATRSGDLYIKFNIEFPA 352
              G+G P+ KN ++ G+L +K+ I++PA
Sbjct: 308 TYPGQGMPVAKNPSQRGNLIVKYKIDYPA 336

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 44/73 (60%), Gaps = 3/73 (4%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           KD Y ILEV +     +++K Y +L  KYHPDK Q    +E   ++  E K   I  AYE
Sbjct: 506 KDYYKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENE---QVANEEKMSAINEAYE 562

Query: 70  ILSDEEKRKQYDL 82
           ILSDE KRK+YDL
Sbjct: 563 ILSDESKRKEYDL 575

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 42/70 (60%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  + +  ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGVSPSASDAELKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          SD  KR+ YD
Sbjct: 56 SDPNKREVYD 65

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 74/146 (50%), Gaps = 7/146 (4%)

Query: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD 265
           K+F +   G+  I   + I + +  G      I   N+ D          + F+++E   
Sbjct: 196 KSFKITRKGQTGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTIQFIIQEKPH 255

Query: 266 EQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKV 325
           E    KR G+ DLI  L ++  +++ GF +   V+T+DGR  ++SI   + ++  + ++ 
Sbjct: 256 E--FFKRDGN-DLIYTLPLTFKESLLGFDK--TVRTIDGR--QISIHKTQPVQPSEEMRY 308

Query: 326 EGEGWPLNKNATRSGDLYIKFNIEFP 351
            G+G PL+KN +  GDL +K+  ++P
Sbjct: 309 PGQGMPLSKNPSERGDLIVKYKTDYP 334

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L +  +  + E+KK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGISPSAGEAEIKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          SD +KR+ YD
Sbjct: 56 SDAQKREVYD 65

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 69/148 (46%), Gaps = 11/148 (7%)

Query: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD 265
           K+F +   G G +     I + +  G      I    + D          L FVL+E   
Sbjct: 201 KSFKITRKGAGGVSEKNQIDIQLKPGWKAGTKITFKGEGDYNPRTGGRQTLQFVLQEKPH 260

Query: 266 EQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKV--IRFGDIL 323
           E    +   D DLI  L +S  +++ GF ++  V+T+DG+    +IP+ +   I+     
Sbjct: 261 EFFTRQ---DNDLIYTLPLSFKESLLGFSKQ--VQTIDGK----TIPITRTQPIQPTQTS 311

Query: 324 KVEGEGWPLNKNATRSGDLYIKFNIEFP 351
              G+G  L+KN ++ GDL IKF I++P
Sbjct: 312 TYPGQGMTLSKNPSQRGDLIIKFKIDYP 339

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 41/70 (58%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  + +  E+KK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          SD  KR  YD
Sbjct: 56 SDSNKRSVYD 65

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 68/139 (48%), Gaps = 7/139 (5%)

Query: 224 ITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELT 283
           I +N+  G  +   +   N  D          L F+++E   +    KR GD ++I  L 
Sbjct: 218 IDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKE--KKHPLYKRDGD-NIIYTLP 274

Query: 284 ISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLY 343
           ++  +++ GF +   ++TLDGR L LS    + ++  +     G+G P++KN  + G+L 
Sbjct: 275 LTFKESLLGFSK--TLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLI 330

Query: 344 IKFNIEFPADNWNSEMNDI 362
           IK+ I +P    +S+   I
Sbjct: 331 IKYKINYPISLTDSQRRAI 349

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  +  + ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGVSPSADEGELKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          +D +KR+ YD
Sbjct: 56 NDPQKREIYD 65

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 75/150 (50%), Gaps = 15/150 (10%)

Query: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKAD--QELGKFKTGDLIFVLEEI 263
           K+F +   G G +   + I + +  G      I   N+ D  Q+ G  +T  + FV++E 
Sbjct: 195 KSFKITRKGPGSVPEKKQIDIQMKPGWKAGTKITFKNEGDYNQQTGGRQT--MQFVIQE- 251

Query: 264 DDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKV--IRFGD 321
                  KR G+ +LI  L +S  +++ GF +   ++T+DGR L    P+ +V  I+  +
Sbjct: 252 -KLHPHFKRDGN-NLIYTLPLSFKESLLGFSK--TIQTIDGRTL----PISRVQPIQPSE 303

Query: 322 ILKVEGEGWPLNKNATRSGDLYIKFNIEFP 351
                G+G PL K   + GDL IK+ +++P
Sbjct: 304 TSTYPGQGMPLPKTPAQRGDLIIKYKVDYP 333

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 54/115 (46%), Gaps = 20/115 (17%)

Query: 6   DPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEII 65
           DP  KD Y IL V       E++K Y  L  KYHPDK++    D+ +   E      +I 
Sbjct: 538 DPK-KDYYKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHE---TMSQIN 593

Query: 66  SAYEILSDEEKRKQYDLQKN----------------FRDANQGSDYGDGINTAFG 104
            AYE LSDE+KRK+YDL K+                F++   G  +G+     FG
Sbjct: 594 EAYETLSDEDKRKEYDLSKSNPRRNTFAQGPRQNNMFKNPGNGFPFGNSFKMNFG 648

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           Y +L+VDE  +  ++KK YRK+A+K HPDK +     E          FK++  A+E+L
Sbjct: 25 FYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRAAE---------AFKKVNRAFEVL 75

Query: 72 SDEEKRKQYD 81
          SDE+KR+ YD
Sbjct: 76 SDEKKRRVYD 85

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           Y +L+++   + +E+KK YRKLA+K HPDK +     E          FK I  A+E+L
Sbjct: 23 FYEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRASE---------AFKRINRAFEVL 73

Query: 72 SDEEKRKQYD 81
          SDE+KR+ +D
Sbjct: 74 SDEQKRRIFD 83

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  +    E+KK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          SD+ KR+ YD
Sbjct: 56 SDKNKREVYD 65

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 82/161 (50%), Gaps = 11/161 (6%)

Query: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKAD--QELGKFKTGDLIFVLEEI 263
           K+F +   G+G I     I + +  G      I   ++ D   + G  KT  L F+L+E 
Sbjct: 206 KSFKIGRKGQGGIPEKTQIDIQLKPGWKAGTKITYKSQGDYNPQTGGRKT--LQFMLQEK 263

Query: 264 DDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDIL 323
           +      KR GD DL   L ++  +++ GF ++  ++T+DGR L +S    + I+  +  
Sbjct: 264 N--HPVFKREGD-DLTCTLPLTFKESLLGFNKQ--IQTIDGRTLPIS--RTQPIQPSETS 316

Query: 324 KVEGEGWPLNKNATRSGDLYIKFNIEFPADNWNSEMNDIIK 364
              G+G P+ K  ++ G+L +++ I++P    +++ N I++
Sbjct: 317 VYPGQGMPIPKTPSQRGNLIVRYKIDYPITLNDAQKNAILQ 357

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 41/70 (58%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  T  + ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          +D   R+ YD
Sbjct: 56 NDPNTREVYD 65

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 71/146 (48%), Gaps = 7/146 (4%)

Query: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD 265
           K+F +   G G  +    I + +  G      +   N+ D          L FV++E   
Sbjct: 174 KSFKIGRKGPGGSQEKTQIDIQLRPGWKAGTKVTYKNQGDYNPRSGGRKTLQFVIQE--K 231

Query: 266 EQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKV 325
                KR GD DLI  L +S  +++ GF +   + T+DGR L LS    + I+  +I   
Sbjct: 232 AHPDFKRDGD-DLIYILRLSFKESLLGFSK--TINTIDGRKLPLS--RSQPIQPTEISTY 286

Query: 326 EGEGWPLNKNATRSGDLYIKFNIEFP 351
            G+G P++KN ++ G+L IK+ I++P
Sbjct: 287 PGQGMPVSKNPSQRGNLIIKYKIDYP 312

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 41/70 (58%), Gaps = 9/70 (12%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           Y IL+V++T   +E+KK YRKLA+K HPDK       E          FK I  A+E+L
Sbjct: 23 FYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKASE---------AFKIINRAFEVL 73

Query: 72 SDEEKRKQYD 81
          SD EKR+ YD
Sbjct: 74 SDVEKRQLYD 83

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 9/70 (12%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           Y IL+VD+T   +E+KK YRKLA+K HPDK       E          FK I  A+E+L
Sbjct: 25 FYDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKASE---------AFKRINRAFEVL 75

Query: 72 SDEEKRKQYD 81
           DE+KR  +D
Sbjct: 76 GDEKKRVLFD 85

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 46/73 (63%), Gaps = 7/73 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L VD T T  ELKK YRK AL++HPDK      + D+V+   E+ F  I SAYE+LS
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDK------NPDNVEEATEI-FATIRSAYEVLS 58

Query: 73 DEEKRKQYDLQKN 85
          D ++R  YD  KN
Sbjct: 59 DPQERAWYDAHKN 71

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           Y +L++D+  +  ++KK YRKLA+K HPDK +     E          FK+I  A+E+L
Sbjct: 25 FYELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRAAE---------AFKKINRAFEVL 75

Query: 72 SDEEKRKQYD 81
          SDE KRK YD
Sbjct: 76 SDENKRKVYD 85

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 92/223 (41%), Gaps = 34/223 (15%)

Query: 138 CEKCVGLGWRSRKNGKQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGR 197
           C+ C G G +   +        +EC +C G G       +  GF  +    C +C G G 
Sbjct: 225 CKTCTGSGMKPGSH-------RSECSSCHGTG---TTVHVRAGF--QMASTCMSCGGTGE 272

Query: 198 YYKKPASSKNFCLKCNGKGI--IEISESITVNIPRGSSDKDTIIIDNKA----------D 245
              +    ++ C  C+G+G     +  ++ V +P G  D D I +  +            
Sbjct: 273 NIAR----EDVCRNCDGEGTEPRPVQRTVQVELPPGLVDGDVIRVAGQGGYPNIAIAPEQ 328

Query: 246 QELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGR 305
           ++  K   GDL+  +    D+  +++     +L     I +  A+ G     ++ TLDG 
Sbjct: 329 RDQVKVTRGDLLVRIRVKQDKVFSIRN--GNELWQTREIPVTTAVLG--GNVVIPTLDGN 384

Query: 306 LLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNI 348
            LRL +  G   R G+ + V G+G P  +     GD+ +++ +
Sbjct: 385 QLRLRVRSG--TRDGETVSVPGQGVPRGRGGLSRGDMKVQWRV 425

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 44/74 (59%), Gaps = 9/74 (12%)

Query: 8   STKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISA 67
           S KD Y +L +++     E+KK Y KLA KYHPD  +    D+         KF +I +A
Sbjct: 44  SFKDPYKVLGLNKDAKASEIKKAYYKLAKKYHPDINKDKGSDK---------KFHDITNA 94

Query: 68  YEILSDEEKRKQYD 81
           YEILSDE+K+ QYD
Sbjct: 95  YEILSDEKKKMQYD 108

>KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 473

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 99/245 (40%), Gaps = 45/245 (18%)

Query: 162 CKTCDGAGYKQ--------------VRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKN 207
           C TCDG+G K                R  I  GF  +    C  C G+G   +      +
Sbjct: 206 CGTCDGSGLKPGASRTTCPGCSGTGTRVHIRAGF--QMASTCNQCGGEGSVVR----DSD 259

Query: 208 FCLKCNGKGI-IEISESITVNIPRGSSDKDTIIIDNK----------ADQELGKFKTGDL 256
            C  C+G+G  +    +I V++P G  D D I I  +          A ++  +   GD+
Sbjct: 260 TCATCHGEGASLNKDHAIKVDLPHGLQDGDVIRISGQGSYPNIAVDPAMKDTVRLSRGDV 319

Query: 257 IFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKV 316
           +  +    D +  +K   D  L  ++ I+ A A+ G    P   T+DG  +RL +  G  
Sbjct: 320 LLRIRVDKDPRFQIKNKYDIWLTQDIPITTA-ALGGIVTVP---TVDGEQVRLKVAPG-- 373

Query: 317 IRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPADNWNSEMNDIIKIRNLLPAISDAK 376
            +  D++ +  +G P     +R GD+ +++ I        +E       R L  A++D  
Sbjct: 374 TQHNDVVSISQKGVPRGAFGSR-GDMKVQYKISIKKPQSQAE-------RCLWEALADVT 425

Query: 377 ADILG 381
            D L 
Sbjct: 426 GDTLA 430

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 9/72 (12%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           KD YA L V ++ +  E+KK Y KLA KYHPD  +  D  +         KF ++ +AYE
Sbjct: 39  KDPYATLGVSKSASGSEIKKAYYKLAKKYHPDINKAEDAQK---------KFHDLQNAYE 89

Query: 70  ILSDEEKRKQYD 81
           ILSD+ KR+Q+D
Sbjct: 90  ILSDDSKRQQWD 101

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 40/70 (57%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V       ELKK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          +D  KR+ YD
Sbjct: 56 NDPNKREVYD 65

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 70/146 (47%), Gaps = 7/146 (4%)

Query: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD 265
           K+F +   G   I   + I + +  G      I   N+ D          L F+++E   
Sbjct: 194 KSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQTLQFIIQE--K 251

Query: 266 EQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKV 325
               LKR G+ DL   L +S  +++ GF +   V T+DGR + +S    + ++  +  + 
Sbjct: 252 MHDFLKRDGN-DLTYTLPLSFKESLLGFSK--TVHTIDGRQIFIS--KTQPVQPSEESRY 306

Query: 326 EGEGWPLNKNATRSGDLYIKFNIEFP 351
            G+G PL+KN +  GDL +K+ I++P
Sbjct: 307 PGQGMPLSKNPSERGDLIVKYKIDYP 332

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 41/72 (56%), Gaps = 9/72 (12%)

Query: 10 KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           D Y +L+V+ +  + E+KK YRKLA+K HPDK       E          FK I  A+E
Sbjct: 21 HDFYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKASE---------AFKVINRAFE 71

Query: 70 ILSDEEKRKQYD 81
          +LSD EKR+ +D
Sbjct: 72 VLSDNEKREIFD 83

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 9/71 (12%)

Query: 11 DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
          + Y +L+V+ T + +E+KK YR+LA+K HPDK       E          FK I  A+E+
Sbjct: 23 EFYEVLQVERTASDNEIKKAYRRLAIKLHPDKNGHPRSAE---------AFKVINRAFEV 73

Query: 71 LSDEEKRKQYD 81
          L DE+KR+ +D
Sbjct: 74 LGDEDKRRLFD 84

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 51.6 bits (122), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 9/67 (13%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           Y +L V++  +  E+KK YRKLA+K HPDK +     E          FK I  A+E+L
Sbjct: 23 FYEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRASE---------AFKRINRAFEVL 73

Query: 72 SDEEKRK 78
          SDE+KR+
Sbjct: 74 SDEQKRR 80

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 40/70 (57%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  +    E+KK YRK ALKYHPDK   T   E         KFKEI  A+EIL
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALKYHPDK--PTGNTE---------KFKEISEAFEIL 55

Query: 72 SDEEKRKQYD 81
          SD  KR+ YD
Sbjct: 56 SDSNKREVYD 65

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 67/149 (44%), Gaps = 11/149 (7%)

Query: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDD 265
           K F +   G+  ++    + + +  G      I   N  D          L FV++E   
Sbjct: 202 KTFKIGRKGQNGVQEKVQVDIQLKAGWKAGTKITFKNYGDYNPSTGGRKTLQFVIKE--K 259

Query: 266 EQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKV--IRFGDIL 323
                KR  D  L+  L ++  +++ GF++   ++T+DGR L    P+ +V  ++  D  
Sbjct: 260 VHPNFKR-EDDTLVYYLPLTFKESLLGFQK--TIQTIDGRTL----PISRVQPVQPNDSS 312

Query: 324 KVEGEGWPLNKNATRSGDLYIKFNIEFPA 352
              G+G P+ K   + GD+ +K+ IE+P 
Sbjct: 313 TYPGQGMPMTKKPGQRGDMIVKYKIEYPT 341

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 41/70 (58%), Gaps = 11/70 (15%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
          LY +L V  +    E+KK YRK AL+YHPDK     G+ +        KFK+I  AYEIL
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALQYHPDK---PTGNTE--------KFKQISEAYEIL 55

Query: 72 SDEEKRKQYD 81
          SD  KR+ YD
Sbjct: 56 SDSNKREVYD 65

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 72/148 (48%), Gaps = 11/148 (7%)

Query: 206 KNFCLKCNGKGIIEISESITVNIPRGSSDKDTIIIDNKAD--QELGKFKTGDLIFVLEEI 263
           K+F +   G G  +  + I + + RG      I   N+ D     G  KT  L FVL+E 
Sbjct: 187 KSFKIGRKGPGGSQEKKQIDIQLKRGWKAGTKITYKNEGDFNPRTGGRKT--LQFVLQE- 243

Query: 264 DDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDIL 323
                  KR G+ +L+  + +S  +++ GF +   V+T+DGR L LS    + I+  +  
Sbjct: 244 -KAHPLFKRDGE-NLLYTVPLSFQESLLGFSK--TVQTIDGRSLSLS--RTQPIQPTETT 297

Query: 324 KVEGEGWPLNKNATRSGDLYIKFNIEFP 351
              G+G P  KN  + GDL I + I++P
Sbjct: 298 TYPGQGMPNPKNPNQRGDLIITYKIDYP 325

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
           similarities with uniprot|P48353 Saccharomyces
           cerevisiae YMR161W
          Length = 232

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 20/107 (18%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           + Y +L+V++  + +E+KK YRKLA++ HPDK       E          FK I  A+E+
Sbjct: 24  EFYELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASE---------AFKRINRAFEV 74

Query: 71  LSDEEKRKQYD-----------LQKNFRDANQGSDYGDGINTAFGNQ 106
           LSD  KR+ +D            Q+++      +    G N  F  Q
Sbjct: 75  LSDVGKRRMFDQLGRDPDDRAAAQESYSSGTTSAGAASGFNAGFPPQ 121

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 7/72 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +LEV E  +  ELKK YRK AL+YHPDK +    +   +       F EI +AYE+LS
Sbjct: 6  YELLEVSEYASDLELKKAYRKKALQYHPDKNRENPEEATAI-------FSEIRAAYEVLS 58

Query: 73 DEEKRKQYDLQK 84
          D ++R  YD  K
Sbjct: 59 DPQERAWYDSHK 70

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 104/257 (40%), Gaps = 51/257 (19%)

Query: 162 CKTCDGAGYKQ--------------VRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKN 207
           C TCDG+G K                R  +  GF  +    C  C G+G   +      +
Sbjct: 210 CNTCDGSGLKPGASRSTCPGCSGTGTRVHVRAGF--QMASTCNQCGGEGSVLR----DAD 263

Query: 208 FCLKCNGKGI-IEISESITVNIPRGSSDKDTIIIDNK----------ADQELGKFKTGDL 256
            C  C+G+G  ++ +  + V++P G  D D I I  K          A ++  +   GDL
Sbjct: 264 TCQTCHGEGAKLDKNHELKVDLPHGLQDGDVIRISGKGSYPNIAVDPAMKDTVRLSRGDL 323

Query: 257 IFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKV 316
           +  +    D +  +K   D     ++ I+ A A+ G    P   T+DG  +RL +  G  
Sbjct: 324 LLRIRVDKDPRFQIKNKYDIWFTQDIPITTA-ALGGVVTIP---TVDGEQVRLKVSPG-- 377

Query: 317 IRFGDILKVEGEGWPLNKNATRSGDLYIKFNIEFPADNWNSEMNDIIKIRNLLPAISD-- 374
            +  D++ +  +G P     TR GD+ +++ +        +E       + L  A++D  
Sbjct: 378 TQHHDVVSIPQKGVPRGSFGTR-GDMKVQYRVVIKKPQSQAE-------KCLWEALADIS 429

Query: 375 ----AKADILGDMPKDD 387
               AK  +L   P+ D
Sbjct: 430 GDSSAKRSVLSSQPQQD 446

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (59%), Gaps = 9/72 (12%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           KD Y+ L V  + T  E+KK Y KLA KYHPD  +  D  +         KF ++ +AYE
Sbjct: 38  KDPYSTLGVSNSATSSEIKKAYYKLAKKYHPDINKAADAQK---------KFHDLQNAYE 88

Query: 70  ILSDEEKRKQYD 81
           ILSD+ KR+Q+D
Sbjct: 89  ILSDDCKRQQWD 100

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 38/70 (54%), Gaps = 9/70 (12%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           Y IL+V+ T   +E+KK YRKLA++ HPDK       E          FK I  A+E+L
Sbjct: 23 FYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRASE---------AFKLINRAFEVL 73

Query: 72 SDEEKRKQYD 81
           D EKR  YD
Sbjct: 74 GDSEKRSLYD 83

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%), Gaps = 9/71 (12%)

Query: 11 DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
          + Y +L+V ++ ++ ++KK YRKLA+K HPDK +     E          FK+I  A+E+
Sbjct: 22 EFYEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRASE---------AFKKINRAFEV 72

Query: 71 LSDEEKRKQYD 81
          LSD+ KR+ +D
Sbjct: 73 LSDDSKRRIFD 83

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 44/72 (61%), Gaps = 7/72 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L VD T T  ELKK YRK AL++HPDK      + D+V    E+ F  I SAYE+LS
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDK------NPDNVDEATEI-FATIRSAYEVLS 58

Query: 73 DEEKRKQYDLQK 84
          D ++R  YD  K
Sbjct: 59 DPQERAWYDAHK 70

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 49/77 (63%), Gaps = 3/77 (3%)

Query: 5   NDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEI 64
           N  + KD Y IL VD++ T  ++++ Y +L  K+HPDK +  +   D+ + + E K  EI
Sbjct: 522 NIKTDKDYYKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLN---DEQRQKNEEKMAEI 578

Query: 65  ISAYEILSDEEKRKQYD 81
             AYEILSD++KR +YD
Sbjct: 579 NEAYEILSDDDKRTKYD 595

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 45/80 (56%), Gaps = 4/80 (5%)

Query: 6   DPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEII 65
           DP  KD Y  L V  + T  E++K Y  L  KYHPDK++    D+ +   E      +I 
Sbjct: 534 DPK-KDYYKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHE---TMSQIN 589

Query: 66  SAYEILSDEEKRKQYDLQKN 85
            AYE LSD+ KRK+YDL ++
Sbjct: 590 EAYEALSDDNKRKEYDLSRS 609

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 38/70 (54%), Gaps = 9/70 (12%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           Y IL V ++    E+KK YRKLA+K HPDK       E          FK I  A+E+L
Sbjct: 25 FYDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKAGE---------AFKVINRAFEVL 75

Query: 72 SDEEKRKQYD 81
          SD+EKR  +D
Sbjct: 76 SDDEKRSVFD 85

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 59/110 (53%), Gaps = 3/110 (2%)

Query: 8   STKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISA 67
           S  D Y IL +  + ++ E+K  YRKL++K+HPDK+     +++   +E    + +I  A
Sbjct: 116 SLFDPYDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEE--AYVQITKA 173

Query: 68  YEILSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGNQTSKDISIPLKV 117
           YE L+DE  R+ + L+    D  Q + +G  + +   + TS  I + + +
Sbjct: 174 YEALTDELTRQNF-LKYGHPDGPQSTSHGIALPSFLIDSTSSPILVAIYI 222

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 67/137 (48%), Gaps = 11/137 (8%)

Query: 2   SNE--NDPSTK--DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEY 57
           SNE   D +TK  D Y IL +  + +  ++K  YRKL++K+HPDKV    G   D K   
Sbjct: 112 SNEAIQDAATKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKV--AKGLTSDEKSVM 169

Query: 58  ELKFKEIISAYEILSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGNQTSKDISIPLKV 117
           E  + +I  AYE L+DE  R+ Y L+    D  Q + +G  +     + +S     PL V
Sbjct: 170 EETYVQITKAYESLTDELVRQNY-LKYGHPDGPQSTSHGIALPRFLVDGSSS----PLLV 224

Query: 118 TIKDLYNGKIIRYDIKR 134
                  G I+ Y + R
Sbjct: 225 ICYVSLLGLILPYFVSR 241

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 3/79 (3%)

Query: 6   DPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEII 65
           D + KD Y IL V +     E++K Y  L  KYHPDK      +E +   +   K ++I 
Sbjct: 599 DMANKDYYKILGVKKNSQLKEIRKSYLSLTKKYHPDKQGQLSEEEQERNHK---KMEQIN 655

Query: 66  SAYEILSDEEKRKQYDLQK 84
            AYE LSDE KRK+YDL +
Sbjct: 656 EAYECLSDESKRKEYDLSR 674

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 52/98 (53%), Gaps = 7/98 (7%)

Query: 8   STKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISA 67
           S KD Y IL+V +     +++K Y  L  K+HPDK Q    +++  K++   K  EI  A
Sbjct: 524 SNKDYYKILDVSKDAGAKDIRKSYLNLTKKFHPDK-QGQLSEKEQKKIQE--KMSEINEA 580

Query: 68  YEILSDEEKRKQYDLQKNFRDANQ-GSDYGDGINTAFG 104
           YE+LSDE KR +YDL    R  N  G   G   N  FG
Sbjct: 581 YEVLSDETKRNEYDLN---RSGNHNGMANGGAQNFDFG 615

>TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.297
           YJL073W
          Length = 604

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 59/119 (49%), Gaps = 23/119 (19%)

Query: 5   NDPST-KDLYAILEVDETITQDELKKQYRKLALKYHPDKV-QTTDGDEDDVKLEYELKFK 62
           N P T +D Y IL + +T T  ++++ Y     KYHPDK  Q ++ +E  +      K  
Sbjct: 487 NTPRTDRDYYKILGLPKTATSKDIRRAYLDFTKKYHPDKQGQLSEKEESKI----HEKMS 542

Query: 63  EIISAYEILSDEEKRKQYDLQKN------------FRDAN----QGSD-YGDGINTAFG 104
           +I  AYE LSD+ +RK+YD  ++            FR AN    QGS  +G+     FG
Sbjct: 543 QINEAYETLSDDTRRKEYDQARSSGSRSGPMNPNMFRHANAREGQGSSHFGNNFKMNFG 601

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 51/98 (52%), Gaps = 8/98 (8%)

Query: 7   PSTK-DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEII 65
           PSTK + Y IL +       ++++ Y  L  KYHPDK Q    D +  K+E   K   I 
Sbjct: 504 PSTKKNYYKILGIGNDANAKDIRRAYLHLTKKYHPDK-QGNMSDAERAKVEE--KMSSIN 560

Query: 66  SAYEILSDEEKRKQYDLQKNFRDANQGSDYGDGINTAF 103
            AYE+LSDE KRK+YD+ +    +  GS +  G    F
Sbjct: 561 EAYEVLSDESKRKEYDMLR----SGGGSQHAGGNGQQF 594

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 67/142 (47%), Gaps = 18/142 (12%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D YA+L V  + T  ++K  YRKL++K+HPDK+    G E+  ++E    + +I  AYE 
Sbjct: 123 DPYALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEE--MYVQISKAYEA 180

Query: 71  LSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGNQTSKDISIPLKVTIKDLYNGKIIRY 130
           L+DE  +  Y L     D  Q   +G  + +   ++    ++ P+ + I  +    ++ Y
Sbjct: 181 LTDEITKANY-LTYGHPDGPQTVSHGIALPSFLVDR----VASPVVILIYAVMLSIVLPY 235

Query: 131 DIKRNVICEKCVGLGWRSRKNG 152
            + +           W SR N 
Sbjct: 236 FVTK-----------WWSRTNS 246

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 43/72 (59%), Gaps = 9/72 (12%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           +D Y  L V +  +  ++KK Y KLA ++HPD +   +G E         KF ++ +AYE
Sbjct: 40  RDPYETLGVAKDASASQIKKAYYKLAKQFHPD-INKDEGAEK--------KFHDLQNAYE 90

Query: 70  ILSDEEKRKQYD 81
           ILSDE KR+QYD
Sbjct: 91  ILSDENKRRQYD 102

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 92/214 (42%), Gaps = 40/214 (18%)

Query: 161 ECKTCDGAGYKQVRQQ--------------IAPGFFTKQNLVCKNCDGKGRYYKKPASSK 206
           +C TC G+G K   Q+              +  GF  +    C  C G+G   ++     
Sbjct: 202 QCGTCSGSGLKAGAQRSVCGGCHGTGTQVHVRAGF--QMASTCSQCSGEGYSIRR----G 255

Query: 207 NFCLKCNGKGII-EISESITVNIPRGSSDKDT-----------IIIDNKADQELGKFKTG 254
           + C  C+G+G++   ++ + ++ P G  D D            I +D K    + + + G
Sbjct: 256 DRCGTCSGEGVVFNRNKEVKMDFPHGLQDGDVVKVPGQGSFPHIQVDPKTAHTM-RLRRG 314

Query: 255 DLIFVLEEIDDEQTALKRYGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVG 314
           DL+  ++   D +  +K   D   + E+ I+ A A+ G    P   T+DG  +RL +  G
Sbjct: 315 DLLVQVQVERDPRFQIKNNYDIWYVQEIPITTA-ALGGTVSIP---TVDGDQIRLKVIPG 370

Query: 315 KVIRFGDILKVEGEGWPLNKNATRSGDLYIKFNI 348
              +   ++ +  +G P   +  R GD+ +++ I
Sbjct: 371 --TQPDQVVSIPNKGVPRGLSGAR-GDMKVQYRI 401

>AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YGL128C (CWC23)
          Length = 273

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (56%), Gaps = 15/79 (18%)

Query: 10 KDLYAILEVD-------ETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFK 62
          KDLYA+LEV        E +   +L+ Q+R+LAL+YHPDK +  D  ++D       KF 
Sbjct: 14 KDLYALLEVSISSPEELEAVDAAQLRAQFRRLALRYHPDK-RRDDTQQND-------KFV 65

Query: 63 EIISAYEILSDEEKRKQYD 81
           +  AY+ILS+   R  Y+
Sbjct: 66 SVQKAYDILSNSSLRATYN 84

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 63/125 (50%), Gaps = 9/125 (7%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKV-QTTDGDEDDVKLEYELKFKEIISAYE 69
           D Y IL +  + +  ++K  YRKL++K+HPDK+ +    DE DV    E  + +I  AYE
Sbjct: 125 DPYEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDV---MEETYVQITKAYE 181

Query: 70  ILSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGNQTSKDISIPLKVTIKDLYNGKIIR 129
            L+DE  R+ Y L+    D  Q + +G  +     + ++     PL V    +  G I+ 
Sbjct: 182 SLTDELVRQNY-LKYGHPDGPQSTSHGIALPRFLVDGSAS----PLLVVCYFVLLGLILP 236

Query: 130 YDIKR 134
           Y + R
Sbjct: 237 YFVSR 241

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%), Gaps = 7/73 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L+V+ T +  +LKK YR+ AL+YHPDK      +  D+       F  I +AYEILS
Sbjct: 6  YELLDVEMTASDADLKKAYRRKALQYHPDKNINNIKEATDI-------FANIRTAYEILS 58

Query: 73 DEEKRKQYDLQKN 85
          D ++R  YD  KN
Sbjct: 59 DPQERVWYDSHKN 71

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (63%), Gaps = 8/69 (11%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y IL+V    +  E+KK YRKLA+K HPDK      + DD   + + KF+E+  AY++L 
Sbjct: 8  YDILQVSVDASPQEIKKSYRKLAIKTHPDK------NPDDP--QAQTKFQELAKAYQVLI 59

Query: 73 DEEKRKQYD 81
          D++ RK+YD
Sbjct: 60 DDDLRKKYD 68

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 64/131 (48%), Gaps = 9/131 (6%)

Query: 6   DPSTK--DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKE 63
           D +TK  D Y IL +  + +  ++K  YRKL++K+HPDK+    G   D K   E  + +
Sbjct: 118 DAATKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKL--AKGLTPDEKSVMEETYVQ 175

Query: 64  IISAYEILSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGNQTSKDISIPLKVTIKDLY 123
           I  AYE L+DE  R+ Y L+    D  Q + +G  +     + ++     PL V      
Sbjct: 176 ITKAYESLTDELVRQNY-LKYGHPDGPQSTSHGIALPRFLVDGSAS----PLLVVCYVAL 230

Query: 124 NGKIIRYDIKR 134
            G I+ Y + R
Sbjct: 231 LGLILPYFVSR 241

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 56/112 (50%), Gaps = 3/112 (2%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D Y +L V  T +  E+K  YRKL+LK+HPDKV     +E+   LE E+ + +I  AYE 
Sbjct: 120 DPYDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLE-EM-YVQISKAYEA 177

Query: 71  LSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGNQTSKDISIPLKVTIKDL 122
           L+DE  ++ Y L     D  Q   +G  + +   N     I +   V +  L
Sbjct: 178 LTDELVKQNY-LMYGHPDGPQSQTHGIALPSFLVNGLVTPIVVIFYVLVLSL 228

>KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.92
           YGL128C
          Length = 370

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 10/87 (11%)

Query: 11  DLYAILEVDET----ITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIIS 66
           DLY +L +D      IT +E+K+ Y+KL L+YHPDK     G ED   +    +F  + S
Sbjct: 82  DLYDVLGLDSAKLDEITVEEVKRCYKKLVLQYHPDK--NVSGAEDASFVAS--RFHSLRS 137

Query: 67  AYEILSDEEKRKQYD--LQKNFRDANQ 91
           A++IL D   R QYD  L+ +  D N+
Sbjct: 138 AFQILCDSSLRTQYDQWLRASLADNNE 164

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 7/124 (5%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D Y IL V  + +  ++K  YRKL++K+HPDK+    G   D K   E  + +I  AYE 
Sbjct: 125 DPYEILGVSTSASDRDIKSAYRKLSVKFHPDKL--AKGLTPDEKNVVEEAYVQITKAYES 182

Query: 71  LSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGNQTSKDISIPLKVTIKDLYNGKIIRY 130
           L+DE  R+ Y L+    D  Q + +G  +     + ++     PL V    +  G I+ Y
Sbjct: 183 LTDELVRQNY-LKYGHPDGPQSTSHGIALPRFLVDGSAS----PLLVVCYFVLLGLILPY 237

Query: 131 DIKR 134
            + R
Sbjct: 238 FVSR 241

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 54/107 (50%), Gaps = 3/107 (2%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D Y +L +  + +  ++K  YRKL+LK+HPDK+     + D   LE +  + +I  AYE 
Sbjct: 121 DPYELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQ--YVQITKAYES 178

Query: 71  LSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGNQTSKDISIPLKV 117
           L+DE  R  Y L     D  Q   +G  + +   + TS  I + L +
Sbjct: 179 LTDELIRFNY-LTYGHPDGPQSETHGIALPSFLVDATSSPIIVTLYI 224

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 9/70 (12%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           Y IL+V+ T    E+KK YRKLA+K HPDK       E          FK I  A+E+L
Sbjct: 23 FYEILKVNRTANDSEIKKAYRKLAIKLHPDKNPHPKAAE---------AFKLINRAFEVL 73

Query: 72 SDEEKRKQYD 81
           + EKR+ ++
Sbjct: 74 GNSEKREIFN 83

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 7/73 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L V+ T +  +LKK YR+ AL+YHPDK      + D+V+ E    F  I SAYE+L+
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDK------NPDNVE-EATTVFATIRSAYEVLA 58

Query: 73 DEEKRKQYDLQKN 85
          D ++R  YD  K 
Sbjct: 59 DPQERAWYDSHKQ 71

>Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}
           similar to Ashbya gossypii ADR124C
          Length = 624

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 48/87 (55%), Gaps = 3/87 (3%)

Query: 5   NDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEI 64
           ND S KD Y  L V +     ++++ Y +L  KYHPDK      +E   +L+ + K   I
Sbjct: 498 NDYSKKDYYKELGVSKNANNKDIRRAYLQLTKKYHPDKQGQLSQEE---RLKVDEKMSAI 554

Query: 65  ISAYEILSDEEKRKQYDLQKNFRDANQ 91
             AYE L D+ KRK+YD+ ++   +NQ
Sbjct: 555 NEAYETLRDDSKRKEYDMVRSEGASNQ 581

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 41/72 (56%), Gaps = 7/72 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L VD   +  ELKK YRK AL+YHPDK  T   +  ++       F  I +AYE+LS
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDKNPTKVEEATEI-------FATIRTAYEVLS 58

Query: 73 DEEKRKQYDLQK 84
          D ++R  YD  K
Sbjct: 59 DPQERAWYDSHK 70

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 44/72 (61%), Gaps = 7/72 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L V+   +  ELKK YRK AL+YHPDK      + D+V+   E KF  I +AYE+LS
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDK------NPDNVEEATE-KFAIIRAAYEVLS 58

Query: 73 DEEKRKQYDLQK 84
          D ++R  YD  K
Sbjct: 59 DSQERAWYDSHK 70

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 44/72 (61%), Gaps = 7/72 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L V+   +  ELKK YRK AL+YHPDK      + D+V+ E   KF  I +AYE+LS
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDK------NPDNVE-EATQKFAVIRAAYEVLS 58

Query: 73 DEEKRKQYDLQK 84
          D ++R  YD  K
Sbjct: 59 DPQERAWYDSHK 70

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 44/72 (61%), Gaps = 7/72 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L V+   +  ELKK YRK AL+YHPDK      + D+V+ E   KF  I +AYE+LS
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDK------NPDNVE-EATQKFAIIRAAYEVLS 58

Query: 73 DEEKRKQYDLQK 84
          D ++R  YD  K
Sbjct: 59 DSQERAWYDSHK 70

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 43/73 (58%), Gaps = 7/73 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L V+   +  ELKK YRK ALKYHPDK      + ++V+ E    F  I  AYE+LS
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDK------NPNNVE-EATQAFATIRLAYEVLS 58

Query: 73 DEEKRKQYDLQKN 85
          D ++R  YD  KN
Sbjct: 59 DPQERAWYDSHKN 71

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 48/89 (53%), Gaps = 16/89 (17%)

Query: 11 DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
          + Y +L V  T T  E+KK YRK A++ HPDK      + DD   E E KF+ +  AY++
Sbjct: 6  EYYDVLGVSPTATAMEIKKAYRKKAMQTHPDK------NPDDP--EAETKFQAVGEAYQV 57

Query: 71 LSDEEKRKQYDL--------QKNFRDANQ 91
          LSD E R +YD         Q+ F DA +
Sbjct: 58 LSDTELRSRYDQFGKDDAVPQQGFEDAEE 86

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 51/90 (56%), Gaps = 5/90 (5%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKV-QTTDGDEDDVKLEYELKFKEIISAYE 69
           D YA+L++  + T  E++  YRKL++K+HPDK+ +    DE  V    E ++  I  AY+
Sbjct: 115 DPYALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTV---LEEQYVMITKAYK 171

Query: 70  ILSDEEKRKQYDLQKNFRDANQGSDYGDGI 99
            L+DE  R+ Y L+    D  Q + +G  +
Sbjct: 172 ALTDEITRENY-LRYGHPDGPQATSHGIAL 200

>NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {ON}
           Anc_5.4 YGR285C
          Length = 431

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 47/79 (59%), Gaps = 8/79 (10%)

Query: 6   DPSTKDLYAILEVDE---TITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFK 62
           D  T DLYA + + +     T++++ K +RK  +KYHPDK Q+  G    V LE +  FK
Sbjct: 92  DWKTADLYAAMGLSKLRFKATENQIIKAHRKQVVKYHPDK-QSAAG----VGLEQDAFFK 146

Query: 63  EIISAYEILSDEEKRKQYD 81
            I  A+E L+D  KR+QYD
Sbjct: 147 IIQKAFETLTDSTKRQQYD 165

>KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly
           similar to uniprot|P32527 Saccharomyces cerevisiae
           YGR285C ZUO1 Cytosolic ribosome-associated chaperone
           contains a DnaJ domain together with Ssz1p acts as a
           chaperone for nascent polypeptide chains
          Length = 428

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 46/84 (54%), Gaps = 12/84 (14%)

Query: 4   ENDP---STKDLYAIL---EVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEY 57
           E+DP    T DLYA +   ++    T  ++ K +RK  LK+HPDK   + G      LE 
Sbjct: 86  EHDPRDWKTADLYAAMGLSKLRHKATDAQVIKAHRKQVLKHHPDKKSASGG------LEQ 139

Query: 58  ELKFKEIISAYEILSDEEKRKQYD 81
           +  FK I  AYE L+D  KRKQYD
Sbjct: 140 DGFFKIIQKAYETLTDPTKRKQYD 163

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 39/70 (55%), Gaps = 9/70 (12%)

Query: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71
           Y IL V+ + +  ++KK YRKLA+K HPDK       E          FK I  A+E+L
Sbjct: 22 FYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKAHE---------AFKLINRAFEVL 72

Query: 72 SDEEKRKQYD 81
          SD +KR+ YD
Sbjct: 73 SDSQKRQIYD 82

>Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON}
          (110867..111739) [873 nt, 291 aa]
          Length = 290

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 16/79 (20%)

Query: 11 DLYAILEVD--------ETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFK 62
          DLY  LE+D          IT  E++K+YR+LALKYHPDK   ++ D D +       F 
Sbjct: 15 DLYKALEIDLVGNRRQPNEITLTEIRKEYRRLALKYHPDK-NISNVDIDSI-------FH 66

Query: 63 EIISAYEILSDEEKRKQYD 81
          +I  A +IL D   R+QYD
Sbjct: 67 DISLANQILCDSSLREQYD 85

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {ON}
           Anc_7.217 YER048C
          Length = 366

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 55/108 (50%), Gaps = 25/108 (23%)

Query: 9   TKDL--YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIIS 66
            KDL  Y +L V    +  E+KK YRK A++ HPDK      D+ D     + KF+ +  
Sbjct: 2   VKDLEYYDVLGVSPKASAIEIKKAYRKRAMETHPDK----HPDDPDA----QAKFQRVGE 53

Query: 67  AYEILSDEEKRKQYDL--------QKNFRDANQ-------GSDYGDGI 99
           AY++LSDEE RK+YD         Q+ F DA +       G  +GD I
Sbjct: 54  AYQVLSDEELRKRYDEFGKDYAIPQQGFTDAQEYFTAIFGGESFGDWI 101

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 87/186 (46%), Gaps = 28/186 (15%)

Query: 13  YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
           Y +L VD   +  +LKK YR+ AL+YHPDK      +  +V+   E+ F  I +AYE+LS
Sbjct: 6   YELLGVDSGASDTDLKKAYRRKALQYHPDK------NIGNVQQATEI-FASIRAAYEVLS 58

Query: 73  DEEKRKQYDLQK----NFRDANQGSDYGDGINTAFGNQTSKDI----SIPLKVTIKD--- 121
           D ++R  YD  +    N    N   DY   +++A    T+++I    +  L   I D   
Sbjct: 59  DAQERAWYDAHREQILNDDFENDEEDY--TVDSAVTGVTTEEILHFFNSGLYTRIDDTPA 116

Query: 122 -LYN--GKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTE---CKTCDGAGYKQVRQ 175
            LY   GK+     K  +IC +  GL   S  N  Q+   + E    + C+   Y+   Q
Sbjct: 117 GLYQIAGKVFAKLAKDELICGRRQGLAEYSALNDDQFEKDIIELGYVQACE--KYQYPDQ 174

Query: 176 QIAPGF 181
            + P F
Sbjct: 175 TVFPVF 180

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 44/72 (61%), Gaps = 7/72 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L V+   +  ELKK YRK AL+YHPDK      + D+V+   E KF  I +AYE+LS
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDK------NPDNVQEATE-KFAIIRAAYEVLS 58

Query: 73 DEEKRKQYDLQK 84
          D ++R  YD  K
Sbjct: 59 DPQERAWYDSHK 70

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 42/73 (57%), Gaps = 7/73 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L+V    T  +LK+ YRK AL YHPDK +    +  +V       F +I +AYE+LS
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDKNRNNIEEATEV-------FAQIRAAYEVLS 58

Query: 73 DEEKRKQYDLQKN 85
          D ++R  YD  K+
Sbjct: 59 DAQERAWYDAHKD 71

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (59%), Gaps = 7/72 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L V+ T +  ELKK YRK AL++HPDK      + D+V    E  F  I +AYE+LS
Sbjct: 6  YELLGVEVTASDAELKKAYRKKALQFHPDK------NPDNVDEATE-NFATIRAAYEVLS 58

Query: 73 DEEKRKQYDLQK 84
          D ++R  YD  K
Sbjct: 59 DPQERAWYDAHK 70

>KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {ON}
           Anc_5.4 YGR285C
          Length = 433

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 47/79 (59%), Gaps = 8/79 (10%)

Query: 6   DPSTKDLYAILEVDE---TITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFK 62
           D  T DLYA + + +     T++++ K +RK  +KYHPDK Q+  G    V LE +  FK
Sbjct: 92  DWKTADLYAAMGLSKLRYNATENQIIKAHRKQVVKYHPDK-QSAAG----VGLEQDAFFK 146

Query: 63  EIISAYEILSDEEKRKQYD 81
            I  A+E L+D+ KR QYD
Sbjct: 147 IIQKAFETLTDKTKRMQYD 165

>NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92
          Length = 276

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 45/75 (60%), Gaps = 12/75 (16%)

Query: 10 KDLYAILEVDETITQ----DELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEII 65
          KDLY  LE+ + +T+     E+K+QYR LALKYHPDK        +D  L +  KF EI 
Sbjct: 13 KDLYEDLEITDALTRRISIQEIKRQYRTLALKYHPDK------HPNDSNLIH--KFHEIS 64

Query: 66 SAYEILSDEEKRKQY 80
           A  IL+DE+  ++Y
Sbjct: 65 IATNILTDEKLSEEY 79

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 49/89 (55%), Gaps = 3/89 (3%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D YA+L+V  + T  E++  YRKL++K+HPDK+       +   LE +  +  I  AY+ 
Sbjct: 117 DPYALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQ--YVMITKAYKA 174

Query: 71  LSDEEKRKQYDLQKNFRDANQGSDYGDGI 99
           L+DE  R+ Y L+    D  Q + +G  +
Sbjct: 175 LTDEVTRENY-LKYGHPDGPQATSHGIAL 202

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 51/89 (57%), Gaps = 3/89 (3%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D Y +L +  + T+ E++  YRKL++K+HPDK+      E+  +L+ E ++  I  AY+ 
Sbjct: 115 DPYELLGIGTSATEREVRSSYRKLSVKFHPDKLSKDLSQEE--RLQLEEQYVLITKAYKA 172

Query: 71  LSDEEKRKQYDLQKNFRDANQGSDYGDGI 99
           L++E  R+ Y L+    D  Q + +G  +
Sbjct: 173 LTEEVTRENY-LKYGHPDGPQSTSHGIAL 200

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 52/97 (53%), Gaps = 3/97 (3%)

Query: 9   TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
           T D Y IL V  + T+ E+KK YR L+LK+HPDK+     +++  +L  E  F +I  AY
Sbjct: 119 TFDPYEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKE--RLSMEEIFVQISKAY 176

Query: 69  EILSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGN 105
           E L++   ++ Y L  +  D  Q   +G  + +   N
Sbjct: 177 EALTNPATKENYLLYGH-PDGPQSQIHGIALPSFLVN 212

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 7/72 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +LEV    +  +LKK YR+ AL+YHPDK      + D+V+ E    F EI +AYE+LS
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDK------NPDNVE-EATTIFAEIRAAYEVLS 58

Query: 73 DEEKRKQYDLQK 84
          D ++R  YD  K
Sbjct: 59 DPQERAWYDSHK 70

>Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR285C
           (ZUO1) - Zuotin, putative Z-DNA binding protein [contig
           73] FULL
          Length = 428

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 46/84 (54%), Gaps = 12/84 (14%)

Query: 4   ENDP---STKDLYAILEVDE---TITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEY 57
           E+DP    T DLYA + + +     T+ ++ K +RK  LK+HPDK   + G      LE 
Sbjct: 86  EHDPRDWKTADLYAAMGLSKLRYRATEAQIIKAHRKQVLKHHPDKKSASGG------LEQ 139

Query: 58  ELKFKEIISAYEILSDEEKRKQYD 81
           +  FK I  AYE L+D  KR QYD
Sbjct: 140 DGFFKIIQKAYETLTDSNKRAQYD 163

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 47/87 (54%), Gaps = 16/87 (18%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L V  T T  E+KK YR+ A++ HPDK        DD   E + KF+E+  AY++LS
Sbjct: 8  YDVLGVQPTATPAEIKKAYRRRAMQTHPDK------HPDDP--EAQAKFQEVGEAYQVLS 59

Query: 73 DEEKRKQYD--------LQKNFRDANQ 91
          D   R +YD         Q+ F DAN+
Sbjct: 60 DPGLRSRYDEFGKDEAVPQQGFEDANE 86

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 49/89 (55%), Gaps = 3/89 (3%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D Y IL V  +    E+K  YRKL++K+HPDK+      E   K+E E+ + +I  AYE 
Sbjct: 122 DPYEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKME-EM-YVQITKAYES 179

Query: 71  LSDEEKRKQYDLQKNFRDANQGSDYGDGI 99
           L+DE  ++ Y L+    D  Q + +G  +
Sbjct: 180 LTDENVKENY-LRYGHPDGPQSTSHGIAL 207

>KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON}
          Anc_1.113 YJR097W
          Length = 163

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 33/69 (47%), Gaps = 9/69 (13%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L V   +T DELKK YR L L  HPDK   T           +    +I  AY ILS
Sbjct: 7  YEVLNVPAQVTPDELKKSYRVLLLSTHPDKSNVTTS---------KYSIDQIKEAYRILS 57

Query: 73 DEEKRKQYD 81
          D   RK YD
Sbjct: 58 DPVSRKTYD 66

>NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {ON}
           Anc_5.4 YGR285C
          Length = 431

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 8/79 (10%)

Query: 6   DPSTKDLYAIL---EVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFK 62
           D  T DLYA +   +V    T++++ K +RK  +KYHPDK Q+  G    V LE +  FK
Sbjct: 92  DWKTADLYAAMGLSQVRFKATENQIIKAHRKQVVKYHPDK-QSAAG----VGLEQDGFFK 146

Query: 63  EIISAYEILSDEEKRKQYD 81
            I  A+E L+D  KR QYD
Sbjct: 147 IIQKAFETLTDSNKRAQYD 165

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (59%), Gaps = 7/72 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L V+ T +  +LKK YRK AL YHPDK      + D+V+ E    F  I +AYE+L+
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDK------NRDNVE-EATAIFATIRAAYEVLA 58

Query: 73 DEEKRKQYDLQK 84
          D ++R  YD  K
Sbjct: 59 DPQERAWYDSHK 70

>CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar to
           uniprot|P47138 Saccharomyces cerevisiae YJR097w
          Length = 175

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 51/91 (56%), Gaps = 6/91 (6%)

Query: 13  YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
           Y +L V    + DE+K  YRK+ L  HPDK +T   D   +K+   +   +I  AY +LS
Sbjct: 12  YEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPID-STIKIRSGVSINQIQEAYRVLS 70

Query: 73  DEEKRKQYDLQKNFRDANQGS---DYGDGIN 100
           +++ R  Y+  +   D+N+ +   ++GDG++
Sbjct: 71  NDQLRAAYN--RALNDSNKLAGFNNFGDGLD 99

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 5/77 (6%)

Query: 6   DPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKV-QTTDGDEDDVKLEYELKFKEI 64
           D + KD Y +L + +  +  E++K Y  L  KYHPDK  Q ++ +++ +      K  ++
Sbjct: 517 DHTGKDYYKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKI----HEKMSQV 572

Query: 65  ISAYEILSDEEKRKQYD 81
             AYEILSDE K++ YD
Sbjct: 573 NEAYEILSDEGKKRDYD 589

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {ON}
           Anc_7.157 YIR004W
          Length = 470

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 48/94 (51%), Gaps = 10/94 (10%)

Query: 13  YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
           Y IL +  T TQ E+KK YRK ++K HPDK        D    E   +F++I  AY++LS
Sbjct: 8   YDILGITPTATQAEIKKAYRKKSIKEHPDK-----NPNDPTATE---RFQQISEAYQVLS 59

Query: 73  DEEKRKQYD-LQKNFRDANQG-SDYGDGINTAFG 104
           DE  R  YD   K      +G  D GD  +  FG
Sbjct: 60  DEHLRNNYDQFGKEQAIPKEGFEDAGDLFSVIFG 93

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 8/69 (11%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L V    T +++KK YRK A++ HPDK      + +D   E + KF+E+  AY++LS
Sbjct: 8  YDVLGVQPDATAEQIKKAYRKKAIQTHPDK------NPNDP--EAQAKFQEVSKAYKVLS 59

Query: 73 DEEKRKQYD 81
          D E R +YD
Sbjct: 60 DGELRSRYD 68

>Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON}
          similar to Ashbya gossypii AFR659W
          Length = 270

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 38/60 (63%), Gaps = 9/60 (15%)

Query: 22 ITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILSDEEKRKQYD 81
          ++  +L+KQYR++ALKYHPDK    +  E         KF +I  A+++LSD + RK+Y+
Sbjct: 31 VSISQLRKQYRQMALKYHPDKSTAPNAQE---------KFLKIKLAFDVLSDSDSRKRYN 81

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 7/72 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L+V      +ELKK YR+ AL+YHPDK      + ++V+   E+ F  I +AYE+LS
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDK------NPENVEEATEI-FASIRAAYEVLS 58

Query: 73 DEEKRKQYDLQK 84
          D ++R  YD  K
Sbjct: 59 DPQERAWYDSHK 70

>KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa]
          {ON} conserved hypothetical protein
          Length = 283

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 51/87 (58%), Gaps = 9/87 (10%)

Query: 11 DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
          D Y +L V++++T+ ELKK YRKL L+ HPDK +       D   E + KF +I  A+E+
Sbjct: 14 DPYEVLGVNKSVTEKELKKCYRKLMLRCHPDKTK-------DWTPEAKEKFHKIQFAFEV 66

Query: 71 LSDEEKRKQYDLQKNFRDANQGSDYGD 97
          L  ++ ++ YD   +     +GSD+ D
Sbjct: 67 L--DKFKETYDKTGSVEACFKGSDFAD 91

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/88 (39%), Positives = 46/88 (52%), Gaps = 10/88 (11%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           KD Y IL + +  T  +++K Y +L  +YHPDK       E + K  +E K  EI  AYE
Sbjct: 558 KDYYKILGISKEATSKDIRKAYLQLTKRYHPDK--QGHLSESEQKKNHE-KMSEINEAYE 614

Query: 70  ILSDEEKRKQYDL-------QKNFRDAN 90
            LSDE K+ +YD        Q  FR AN
Sbjct: 615 TLSDEAKKSEYDSVRSGKSNQNMFRGAN 642

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (59%), Gaps = 7/72 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L V+   T  ELKK YR+ AL++HPDK      + D+V+ E    F  + +AYE+L+
Sbjct: 6  YELLGVETNATDVELKKAYRRKALQFHPDK------NPDNVE-ETTAIFASVRAAYEVLA 58

Query: 73 DEEKRKQYDLQK 84
          D ++R  YD  K
Sbjct: 59 DPQERAWYDDHK 70

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 49/100 (49%), Gaps = 11/100 (11%)

Query: 4   ENDPST-KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFK 62
           E  P T KD Y IL V +      ++K Y  L  KYHPDK       E +   E   K  
Sbjct: 546 EPPPKTDKDYYKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHE---KMS 602

Query: 63  EIISAYEILSDEEKRKQYDLQK------NFRDANQGSDYG 96
           EI  AYEIL DE K+K+YD  +      +FR   QG+ +G
Sbjct: 603 EINEAYEILGDESKKKEYDDGRLGNGNAHFRQ-QQGAPFG 641

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 47/89 (52%), Gaps = 16/89 (17%)

Query: 11 DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
          + Y  L +  T T  E+KK YR+ A++ HPDK        DD   E E KF+ +  AY++
Sbjct: 6  EYYDRLGISPTATPTEIKKAYRRKAMETHPDK------HPDDP--EAENKFQAVGEAYQV 57

Query: 71 LSDEEKRKQYD--------LQKNFRDANQ 91
          LSDE  R +YD         Q+ F DAN+
Sbjct: 58 LSDESLRARYDEYGKDDAVPQQGFEDANE 86

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa]
          {ON} Anc_1.92 YGL128C
          Length = 312

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 8/78 (10%)

Query: 4  ENDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKE 63
          EN  +  D+      + TIT +E+KK+YR LALKYHPDK   T  D   V+     KF +
Sbjct: 10 ENKVNLYDILGFHNNNSTITSNEIKKRYRSLALKYHPDK---TPNDLTLVE-----KFHK 61

Query: 64 IISAYEILSDEEKRKQYD 81
          I  A  IL++ + + +YD
Sbjct: 62 ITIALNILTNNQLKTEYD 79

>TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {ON}
           Anc_1.185 YJL162C
          Length = 492

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 53/97 (54%), Gaps = 16/97 (16%)

Query: 13  YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
           Y++L +  T + +++KK Y+KLA + HPDK ++ +  E          FK ++ AY ILS
Sbjct: 9   YSVLGLTPTASLNDIKKSYKKLARELHPDKSKSNESSE---------LFKIVVDAYSILS 59

Query: 73  DEEKRKQYD-------LQKNFRDANQGSDYGDGINTA 102
           D ++R++Y+       L  N++ +N      + +N +
Sbjct: 60  DVKEREEYNITLHRKGLYTNYKQSNNDKKTSNTVNKS 96

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 7/73 (9%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y +L V  T    ELKK +R+ AL+YHPDK      + D+V+   E  F +I +AYE+L+
Sbjct: 6  YELLGVSSTADDLELKKAFRRKALQYHPDK------NRDNVEEATET-FAQIRAAYEVLN 58

Query: 73 DEEKRKQYDLQKN 85
          D ++R  YD  K+
Sbjct: 59 DPQERAWYDSHKS 71

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 52/89 (58%), Gaps = 3/89 (3%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D Y +L +  + ++ ++K  YRKL++K+HPDK+     +++   +E E+ + +I  AYE 
Sbjct: 129 DPYELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTME-EM-YVQITKAYEA 186

Query: 71  LSDEEKRKQYDLQKNFRDANQGSDYGDGI 99
           L+DE  R+ + L+    D  Q + +G  +
Sbjct: 187 LTDEAMRENF-LKYGHPDGPQSTTHGIAL 214

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 8/69 (11%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y IL V  T T  E+KK YRK +++ HPDK       +D +  E   +F+ I  AY++LS
Sbjct: 8  YEILGVTPTATAVEIKKAYRKKSVQEHPDK-----NRDDPMATE---RFQAISEAYQVLS 59

Query: 73 DEEKRKQYD 81
          DE+ R +YD
Sbjct: 60 DEDLRGKYD 68

>NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON}
          Anc_1.185 YJL162C
          Length = 491

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 9/71 (12%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y+IL +    T +E++K Y KLA + HPDK ++    E          FK ++ A+ IL+
Sbjct: 9  YSILGLTPKATDNEIRKSYMKLARQLHPDKSKSDSCAE---------LFKLVVHAHSILT 59

Query: 73 DEEKRKQYDLQ 83
          DEE +++YD Q
Sbjct: 60 DEETKRKYDTQ 70

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 46/89 (51%), Gaps = 16/89 (17%)

Query: 11 DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
          + Y +L +    T  E+KK YRK+A+  HPDK        DD   E + KF+ +  AY++
Sbjct: 6  EFYDVLGISPEATPSEIKKAYRKMAMLTHPDK------HPDDP--EAQAKFQAVGEAYQV 57

Query: 71 LSDEEKRKQYDL--------QKNFRDANQ 91
          L+D   RKQYD         Q+ F DA +
Sbjct: 58 LNDPALRKQYDEFGKDNAVPQQGFEDAEE 86

>SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32527 Saccharomyces
           cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
           chaperone contains a DnaJ domain together with Ssz1p
           acts as a chaperone for nascent polypeptide chains
          Length = 432

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 42/79 (53%), Gaps = 9/79 (11%)

Query: 6   DPSTKDLYAILEVDE---TITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFK 62
           D  T DLYA + + +     T  ++ K +RK  LK+HPDK   + G      LE +  FK
Sbjct: 92  DWKTADLYAAMGISKLRYKATDAQIIKAHRKQVLKHHPDKKSASGG------LEEDGFFK 145

Query: 63  EIISAYEILSDEEKRKQYD 81
            I  AYE L+D  KR QYD
Sbjct: 146 IIQKAYETLTDSNKRAQYD 164

>Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {ON}
           YGR285C (REAL)
          Length = 474

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 8/79 (10%)

Query: 6   DPSTKDLYAILEVDE---TITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFK 62
           D  T DLYA + + +     TQ+++ K +RK  +KYHPDK     G      L+ +  FK
Sbjct: 133 DWKTADLYAAMGLSKLRFRATQNQIIKAHRKQVVKYHPDKQSAAGG-----SLDQDGFFK 187

Query: 63  EIISAYEILSDEEKRKQYD 81
            I  A+E L+D  K+ QYD
Sbjct: 188 IIQKAFETLTDSNKKAQYD 206

>TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.297
           YJL073W
          Length = 666

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           KD Y +L +  + T  E++K Y  L  KYHPDK       +   + +   K   I  AYE
Sbjct: 559 KDFYKVLSIPTSATDKEIRKAYLLLTKKYHPDKQGQLSPKQ---QAKNHAKMIAINEAYE 615

Query: 70  ILSDEEKRKQYD 81
           ILSDE KR+ YD
Sbjct: 616 ILSDENKRRDYD 627

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {ON}
           Anc_7.217 YER048C
          Length = 364

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 53/108 (49%), Gaps = 22/108 (20%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           + Y IL +  + T  E+KK YRK A++ HPDK      D+ D     + KF+ +  AY++
Sbjct: 6   EYYDILGIQPSATSTEIKKAYRKKAMETHPDK----HPDDPDA----QSKFQSVGEAYQV 57

Query: 71  LSDEEKRKQYDL--------QKNFRDANQGSDYGDGINTAFGNQTSKD 110
           LSD++ RK+YD         Q  F DA      G+     FG    KD
Sbjct: 58  LSDDDLRKRYDEFGKDNAVPQHGFEDA------GEYFTAIFGGDGFKD 99

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {ON}
           Anc_7.217 YER048C
          Length = 396

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 52/105 (49%), Gaps = 19/105 (18%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           + Y +L +  T T  E+KK YR+ A++ HPDK       +D    E   +F+++  AY++
Sbjct: 6   EYYDVLGIPPTATATEIKKAYRRKAMETHPDK-----HPDDPTASE---RFQQVGEAYQV 57

Query: 71  LSDEEKRKQYD--------LQKNFRDANQGSDY---GDGINTAFG 104
           LSD + RKQYD         Q+ F DA +       GDG     G
Sbjct: 58  LSDPDLRKQYDEFGKDNAVPQQGFEDAGEYFSMIFGGDGFTNWIG 102

>KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32527 Saccharomyces
           cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
           chaperone contains a DnaJ domain together with Ssz1p
           acts as a chaperone for nascent polypeptide chains
          Length = 433

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 41/79 (51%), Gaps = 8/79 (10%)

Query: 6   DPSTKDLYAILEVDE---TITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFK 62
           D  T DLYA + + +     T  ++ K +RK  LKYHPDK   +        L+ +  FK
Sbjct: 92  DWKTADLYAAMGLSKLRYRATNQQIIKAHRKQVLKYHPDKTSASGA-----SLDQDGFFK 146

Query: 63  EIISAYEILSDEEKRKQYD 81
            I  AYE L+D  KR QYD
Sbjct: 147 IIQKAYETLTDSNKRPQYD 165

>Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C
           (REAL)
          Length = 433

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 8/79 (10%)

Query: 6   DPSTKDLYAILEVDE---TITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFK 62
           D  T DLYA + + +     T++++ K +RK  +KYHPDK     G      L+ +  FK
Sbjct: 92  DWKTADLYAAMGLSKLRFRATENQIIKAHRKQVVKYHPDKQSAAGG-----SLDQDGFFK 146

Query: 63  EIISAYEILSDEEKRKQYD 81
            I  A+E L+D  KR QYD
Sbjct: 147 IIQKAFETLTDSNKRAQYD 165

>Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {ON}
           YGR285C (REAL)
          Length = 433

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 8/79 (10%)

Query: 6   DPSTKDLYAILEVDE---TITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFK 62
           D  T DLYA + + +     T++++ K +RK  +KYHPDK     G      L+ +  FK
Sbjct: 92  DWKTADLYAAMGLSKLRFRATENQIIKAHRKQVVKYHPDKQSAAGG-----SLDQDGFFK 146

Query: 63  EIISAYEILSDEEKRKQYD 81
            I  A+E L+D  KR QYD
Sbjct: 147 IIQKAFETLTDSNKRAQYD 165

>ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]
           {ON} weakly similar to uniprot|P40358 Saccharomyces
           cerevisiae YJL073W JEM1 DnaJ-like chaperone required for
           nuclear membrane fusion during mating localizes to the
           ER membrane exhibits genetic interactions with KAR2
          Length = 584

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 39/76 (51%), Gaps = 3/76 (3%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           KD Y IL + +     E++K Y      YHPDK      ++     E   K  EI  AYE
Sbjct: 474 KDYYKILNIPKNANAKEIRKAYLNFTKMYHPDKQGQLSEEQQKKNDE---KMSEINEAYE 530

Query: 70  ILSDEEKRKQYDLQKN 85
            LSDE KR++YD+ ++
Sbjct: 531 TLSDEGKRREYDMARS 546

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 3/86 (3%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D Y +L V  + T  E++  YRKL++K+HPDK+      E   + E E ++  I  AY+ 
Sbjct: 116 DPYTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQ--RSELEEQYVLITKAYKA 173

Query: 71  LSDEEKRKQYDLQKNFRDANQGSDYG 96
           L+DE  ++ Y L+    D  Q + +G
Sbjct: 174 LTDEITKENY-LKFGHPDGPQSTSHG 198

>CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly
          similar to uniprot|P52868 Saccharomyces cerevisiae
          YGL128c
          Length = 296

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 17/79 (21%)

Query: 11 DLYAILEV--------DETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFK 62
          DLY +LE+        D+  T   LKKQYRKL+L+YHPDK         +   EY  +F 
Sbjct: 14 DLYKLLELNYKDYKGNDDAATTHSLKKQYRKLSLRYHPDK---------NPGPEYIDRFH 64

Query: 63 EIISAYEILSDEEKRKQYD 81
           +  A  +L+D  K+ +YD
Sbjct: 65 LLNLAITVLADPAKKAEYD 83

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 16/73 (21%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDK----VQTTDGDEDDVKLEYELKFKEIISAY 68
          Y +L ++ + TQ E+KK YRK ++K HPDK     Q T+            +F+ I  AY
Sbjct: 8  YDLLGIEPSATQGEIKKAYRKKSIKEHPDKNPNDPQATE------------RFQAISEAY 55

Query: 69 EILSDEEKRKQYD 81
          ++LSDE  R +YD
Sbjct: 56 QVLSDESLRLKYD 68

>NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8.698
           YOR254C
          Length = 680

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 60/109 (55%), Gaps = 3/109 (2%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D Y IL +  + +  ++K  YRKL++K+HPDK+ + D   D+ ++  E K+ +I  AYE 
Sbjct: 122 DPYDILGISSSSSDKDIKSAYRKLSIKFHPDKL-SKDLSADE-RIVMEEKYVQITKAYEA 179

Query: 71  LSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGNQTSKDISIPLKVTI 119
           L+DE  R+ Y L+    D  Q + +G  + +     +S  I I   +++
Sbjct: 180 LTDETVRENY-LKYGHPDGPQSTSHGIALPSFMVEGSSSPILIMFYISL 227

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 12/91 (13%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKV-QTTDGDEDDVKLEYELKFKEIISAYEIL 71
          Y IL +    TQ+E+KK YR   L  HPDK+ + T+   + V +       +I  AY+IL
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTI------NKIQDAYKIL 63

Query: 72 SDEEKRKQYD--LQKNFRDANQG-SDYGDGI 99
          S+ +KR +YD  + +N++   QG  + GDG+
Sbjct: 64 SNNQKRGEYDKTILENYK--KQGFHNCGDGL 92

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 8/71 (11%)

Query: 11 DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
          + Y IL V    T  E+KK YR+ A++ HPDK    D +        + KF+ +  AY++
Sbjct: 6  EYYDILGVKPEATSAEIKKAYRRRAMETHPDK-HPNDPNA-------QAKFQAVGEAYQV 57

Query: 71 LSDEEKRKQYD 81
          LSD+E RK+YD
Sbjct: 58 LSDDELRKRYD 68

>YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}
           ZUO1Ribosome-associated chaperone, functions in ribosome
           biogenesis and, in partnership with Ssz1p and SSb1/2, as
           a chaperone for nascent polypeptide chains; contains a
           DnaJ domain and functions as a J-protein partner for
           Ssb1p and Ssb2p
          Length = 433

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 8/79 (10%)

Query: 6   DPSTKDLYAILEVDE---TITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFK 62
           D  T DLYA + + +     T+ ++ K +RK  +KYHPDK     G      L+ +  FK
Sbjct: 92  DWKTADLYAAMGLSKLRFRATESQIIKAHRKQVVKYHPDKQSAAGG-----SLDQDGFFK 146

Query: 63  EIISAYEILSDEEKRKQYD 81
            I  A+E L+D  KR QYD
Sbjct: 147 IIQKAFETLTDSNKRAQYD 165

>SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa]
          {ON} weakly similar to uniprot|P52868 Saccharomyces
          cerevisiae YGL128C
          Length = 281

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 11/82 (13%)

Query: 16 LEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILSDEE 75
          L+    ++  +++KQYRKLAL+YHPDK      +  D  L +  KF ++  A +ILSD  
Sbjct: 26 LDAVRAVSTLQVRKQYRKLALQYHPDK------NPHDTSLIH--KFHQVSVATKILSDSR 77

Query: 76 KRKQYDLQKNFRDANQGSDYGD 97
           R  YD   ++ + N  + +GD
Sbjct: 78 LRSLYD---SWFERNLLAHHGD 96

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 48/96 (50%), Gaps = 16/96 (16%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQT-------TDGDEDDVKLEYELKFKEII 65
          Y +L ++   T  E+KK Y++  L  HPDK  T       T  D   V +       +I 
Sbjct: 11 YEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSI------NQIQ 64

Query: 66 SAYEILSDEEKRKQYD--LQKNFRDANQGSDYGDGI 99
           AY+ILS+E  R+QYD  L + F+      ++GDG+
Sbjct: 65 QAYKILSNESTREQYDEELLETFKKLGY-HNHGDGL 99

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 45/74 (60%), Gaps = 2/74 (2%)

Query: 8   STKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISA 67
           + K+ Y IL +    +  E++K Y  L  KYHPDK      +E++ K + ++   EI  A
Sbjct: 538 TAKNYYQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMS--EINEA 595

Query: 68  YEILSDEEKRKQYD 81
           YE+L+DEEKRK+YD
Sbjct: 596 YEVLNDEEKRKEYD 609

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 48/89 (53%), Gaps = 3/89 (3%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D Y +L +  + +  ++K  YRKL++K+HPDK+      E+   +E   K+ +I  AYE 
Sbjct: 121 DPYELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEE--KYVQITKAYEA 178

Query: 71  LSDEEKRKQYDLQKNFRDANQGSDYGDGI 99
           L+DE  ++ + L+    D  Q   +G  +
Sbjct: 179 LTDEVIKENF-LKYGHPDGPQSMSHGIAL 206

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
           of unknown function, contains a CSL Zn finger and a
           DnaJ-domain; involved in diphthamide biosynthesis;
           ortholog human Dph4
          Length = 172

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 50/91 (54%), Gaps = 10/91 (10%)

Query: 13  YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
           Y IL +    TQDE+KK YR   L  HPDK+  +  D         +   +I  AY+ILS
Sbjct: 10  YEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVS-----NVTINKIQDAYKILS 64

Query: 73  DEEKRKQYD--LQKNFRDANQG-SDYGDGIN 100
           + + R++YD  + +N++   QG  + GDG++
Sbjct: 65  NIKTRREYDRLILENYK--RQGFHNCGDGLD 93

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa]
          {ON} Anc_1.185 YJL162C
          Length = 544

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 41/69 (59%), Gaps = 9/69 (13%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y++L V    T +E+ K YRKLA+K HPDK ++   +E          FK ++ A+ +L+
Sbjct: 11 YSLLGVHFDATNEEISKSYRKLAMKLHPDKSKSDKCEE---------LFKLVVHAHSVLT 61

Query: 73 DEEKRKQYD 81
          + E+R +Y+
Sbjct: 62 NGEERAKYN 70

>KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4
           YGR285C
          Length = 434

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 40/80 (50%), Gaps = 9/80 (11%)

Query: 5   NDPSTKDLYAILEVDE---TITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKF 61
            D  T DLYA + + +     T  ++ K +RK  +KYHPDK       E+D        F
Sbjct: 92  RDWKTADLYAAMGLSQLRYRATDVQIVKAHRKQVVKYHPDKQSAAGAAENDA------FF 145

Query: 62  KEIISAYEILSDEEKRKQYD 81
           K I  A+E L+D  KR QYD
Sbjct: 146 KIIQKAFETLTDRTKRMQYD 165

>SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar to
           uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
           Protein required along with Dph1p Dph2p Kti11p and Dph5p
           for synthesis of diphthamide which is a modified
           histidine residue of translation elongation factor 2
           (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 165

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 52/94 (55%), Gaps = 8/94 (8%)

Query: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
           K  Y +L V+   +  ++K+ YR+  L  HPDK    +G +   +   +   ++I  AY 
Sbjct: 3   KSHYEVLAVEAGASLSQIKRAYRERLLDTHPDK---KNGQQARSQAHTQASIEQIQQAYR 59

Query: 70  ILSDEEKRKQYD--LQKNFRDANQG-SDYGDGIN 100
           +L+D  +R+QYD  L K+++   QG  + GDG++
Sbjct: 60  VLADPTRREQYDAELAKSYK--MQGFHNTGDGLD 91

>TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4
           YGR285C
          Length = 433

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (54%), Gaps = 11/84 (13%)

Query: 4   ENDP---STKDLYAILEVDE---TITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEY 57
           E+DP    T DLYA + + +     T++++ K +RK  LK+HPDK   +        LE 
Sbjct: 87  EHDPRDWKTADLYAAMGLSKLRYRATENQIIKAHRKQVLKHHPDKKSASGAG-----LEQ 141

Query: 58  ELKFKEIISAYEILSDEEKRKQYD 81
           +  FK I  A+E L+D  KR QYD
Sbjct: 142 DGFFKIIQKAFETLTDNNKRAQYD 165

>CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32527 Saccharomyces cerevisiae
           YGR285c ZUO1
          Length = 433

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 52/97 (53%), Gaps = 11/97 (11%)

Query: 5   NDPSTKDLYAILEVDE---TITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKF 61
            D  T DLYA + + +     T++++ K +RK  +KYHPDK Q+  G      L+ +  F
Sbjct: 91  RDWKTADLYAAMGLSKLRFRATENQIIKSHRKQVVKYHPDK-QSAHG----AGLDQDGFF 145

Query: 62  KEIISAYEILSDEEKRKQY---DLQKNFRDANQGSDY 95
           K I  ++E L+D  KR+QY   D   +     +G+DY
Sbjct: 146 KIIQKSFETLTDVTKRRQYDSCDFNADVLPPKKGTDY 182

>AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR254C (SEC63)
          Length = 669

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%), Gaps = 3/86 (3%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D Y +L+V    T  E++  YRKL++K+HPDK+     D +   LE +  +  I  AY+ 
Sbjct: 115 DPYELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQ--YVLITKAYKA 172

Query: 71  LSDEEKRKQYDLQKNFRDANQGSDYG 96
           L+D+  R  + L+    D  Q + +G
Sbjct: 173 LTDDATRDNF-LRYGHPDGPQSTTHG 197

>TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa]
           {ON} Anc_5.4 YGR285C
          Length = 433

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 44/84 (52%), Gaps = 8/84 (9%)

Query: 1   MSNENDPSTKDLYAILEVDE---TITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEY 57
           + +  D  T DLYA + + +     T+ ++ K +RK  LKYHPDK   +        L+ 
Sbjct: 87  IHDPRDWKTADLYAAMGLSKLRYRATESQIIKAHRKQVLKYHPDKKSASGA-----SLDQ 141

Query: 58  ELKFKEIISAYEILSDEEKRKQYD 81
           +  FK I  A+E L+D  KR QYD
Sbjct: 142 DGFFKIIQKAFETLTDPTKRSQYD 165

>ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR061C
          Length = 305

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 42/74 (56%), Gaps = 9/74 (12%)

Query: 13  YAILEVDET-ITQDELKKQYRKLALKYHPD---KVQTTDGDEDDVKLEYELKFKEIISAY 68
           Y +L + +T +   +LKK+Y +LA  YHPD     Q   G+ + ++     +FK +  AY
Sbjct: 93  YEVLGLVKTGVDARQLKKRYHELAKLYHPDTAGAAQQGLGEHERLR-----RFKLVNEAY 147

Query: 69  EILSDEEKRKQYDL 82
            +LSD  +R+ YD+
Sbjct: 148 ALLSDASRRRMYDM 161

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 58/109 (53%), Gaps = 3/109 (2%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           D Y +L +  + +  ++K  YR+L+LK+HPDK+      E+   +E E+ + +I  A+E 
Sbjct: 125 DPYDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAME-EM-YVQISKAHEA 182

Query: 71  LSDEEKRKQYDLQKNFRDANQGSDYGDGINTAFGNQTSKDISIPLKVTI 119
           L+D   R+ Y L+    D  Q + +G  I +   + ++  + +   V++
Sbjct: 183 LTDPIVRENY-LKYGHPDGPQSTTHGIAIPSFMVSGSASPLLVIFYVSL 230

>TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa]
           {ON} Anc_5.4 YGR285C
          Length = 430

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 41/81 (50%), Gaps = 12/81 (14%)

Query: 6   DPSTKDLYAILEVDE---TITQDELKKQYRKLALKYHPDKVQTTDG--DEDDVKLEYELK 60
           D  T DLYA + + +        ++ K +RK  LKYHPDK     G  D+D +       
Sbjct: 92  DWKTADLYAAMGLSKLRYRANDTQVIKAHRKQVLKYHPDKTSAEGGSLDQDGI------- 144

Query: 61  FKEIISAYEILSDEEKRKQYD 81
           FK I  A+E L+D  KR QYD
Sbjct: 145 FKIIQKAFETLTDSTKRAQYD 165

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
           (REAL)
          Length = 172

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 12/92 (13%)

Query: 13  YAILEVDETITQDELKKQYRKLALKYHPDKV-QTTDGDEDDVKLEYELKFKEIISAYEIL 71
           Y IL +    TQ+E+K+ YR   L  HPDK+ + T G    V +       +I  AY IL
Sbjct: 10  YEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTI------NKIQDAYRIL 63

Query: 72  SDEEKRKQYD--LQKNFRDANQG-SDYGDGIN 100
           SD   R +YD  + +N++   QG  + GDG++
Sbjct: 64  SDIRSRCEYDRLILENYK--QQGFHNCGDGLD 93

>CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some
          similarities with uniprot|P46997 Saccharomyces
          cerevisiae YJL162c
          Length = 455

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 9/73 (12%)

Query: 9  TKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAY 68
          T   Y+IL V    + +E++K Y KLA K HPDK ++    E   +L     FK ++ A+
Sbjct: 10 TSTYYSILGVPTNASTNEIRKSYMKLAKKLHPDKTKS----EHTAEL-----FKLVVDAH 60

Query: 69 EILSDEEKRKQYD 81
           IL++++ R +YD
Sbjct: 61 SILNNDQLRAEYD 73

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 11 DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
          + Y +L++D T T  E+KK YRK ++K HPDK        D    E   +F+ I  AY++
Sbjct: 6  EYYDLLDIDITATAIEIKKAYRKKSIKEHPDK-----NPNDPTATE---RFQAISEAYQV 57

Query: 71 LSDEEKRKQYD 81
          LSD+  R  YD
Sbjct: 58 LSDKNLRANYD 68

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 10/102 (9%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           + Y IL V+   T  E+KK YR+ A++ HPDK      D+ D     + KF+ +  AY++
Sbjct: 6   EYYDILGVEPDATPTEIKKAYRRKAMQTHPDK----HPDDPDA----QAKFQAVGEAYQV 57

Query: 71  LSDEEKRKQYD-LQKNFRDANQG-SDYGDGINTAFGNQTSKD 110
           LSD   R +YD   K+     QG  D G+     FG    KD
Sbjct: 58  LSDPGLRSRYDEFGKDDAVPKQGFEDAGEYFTAIFGGDGFKD 99

>KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON}
          Anc_1.113 YJR097W
          Length = 185

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 10 KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69
          K  Y +L+V+  +   ELK +Y++L L  HPDK+ +   D + V  + ++    I  AY+
Sbjct: 5  KTHYEVLKVNSAVQLPELKLRYKELLLNTHPDKLGSAQ-DSESVWRDRKVTINHIQEAYK 63

Query: 70 ILSDEEKRKQYD 81
          +LSD   + +YD
Sbjct: 64 VLSDATLKAEYD 75

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {ON}
           similar to uniprot|P39101 YER048C Saccharomyces
           cerevisiae CAJ1 Nuclear type II J heat shock protein of
           the E. coli dnaJ family
          Length = 395

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 51/108 (47%), Gaps = 22/108 (20%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           + Y +L +    +  E+KK YRK A+  HPDK        DD   E + KF+ I  AY++
Sbjct: 6   EYYDLLGIQPDASATEIKKAYRKKAMLTHPDK------HPDDP--EAQAKFQAIGQAYQV 57

Query: 71  LSDEEKRKQYDL--------QKNFRDANQGSDYGDGINTAFGNQTSKD 110
           LSD E R +YD         Q+ F DA       +  +T FG    +D
Sbjct: 58  LSDPELRSRYDEFGKEDAVPQQGFEDA------AEFFSTIFGGDAFQD 99

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.157
           YIR004W
          Length = 434

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 50/108 (46%), Gaps = 22/108 (20%)

Query: 11  DLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEI 70
           + Y +L V+   T  E+KK YRK ++K HPDK      + D  K     KF+ I  AY++
Sbjct: 6   EYYDLLGVEPNSTDIEIKKAYRKKSIKLHPDK---NPNNPDATK-----KFQAISEAYQV 57

Query: 71  LSDEEKRKQYDL--------QKNFRDANQGSDYGDGINTAFGNQTSKD 110
           LSD+  R  YD         +  F DAN+           FG +  KD
Sbjct: 58  LSDKNLRSNYDKFGKDKAIPKGGFEDANE------QFTAMFGGEAFKD 99

>YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON}
          JJJ2Protein of unknown function, contains a J-domain,
          which is a region with homology to the E. coli DnaJ
          protein
          Length = 583

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 9/69 (13%)

Query: 13 YAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEILS 72
          Y+IL +    T  E+ K Y KLA   HPDK ++   +E          FK ++ A+ IL+
Sbjct: 15 YSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEE---------LFKAVVHAHSILT 65

Query: 73 DEEKRKQYD 81
          DE+++ +YD
Sbjct: 66 DEDQKLRYD 74

>NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON}
          Anc_1.92
          Length = 280

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 48/92 (52%), Gaps = 19/92 (20%)

Query: 1  MSNENDPSTKD---LYAILEVDETITQDEL--------KKQYRKLALKYHPDKVQTTDGD 49
          MS E D   KD   LY++LE+       EL        KK+YR LALKYHPDK      +
Sbjct: 1  MSTEFDQIIKDGVNLYSVLEIPTEPRAKELSKILPTDIKKRYRTLALKYHPDK----HPN 56

Query: 50 EDDVKLEYELKFKEIISAYEILSDEEKRKQYD 81
          E ++      KF ++  A  IL++E  +K+YD
Sbjct: 57 EPEI----VHKFYQLSVATHILTNEALKKRYD 84

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,810,553
Number of extensions: 2725267
Number of successful extensions: 8842
Number of sequences better than 10.0: 422
Number of HSP's gapped: 8422
Number of HSP's successfully gapped: 478
Length of query: 439
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 326
Effective length of database: 40,524,141
Effective search space: 13210869966
Effective search space used: 13210869966
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)