Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0A017808.265ON35235210671e-145
Smik_4.3588.265ON371931408e-09
Kpol_543.418.265ON306671282e-07
SAKL0H16962g8.265ON336931255e-07
YDR113C (PDS1)8.265ON373861221e-06
Suva_2.2738.265ON376941167e-06
Skud_4.3748.265ON373921141e-05
TDEL0F039208.265ON322741061e-04
KLTH0G13618g8.265ON302741033e-04
Ecym_43058.265ON31143970.002
CAGL0L12298g8.265ON28681890.011
NDAI0J013508.265ON42227900.012
KLLA0F19206g8.265ON26364860.025
Kwal_56.237818.265ON29358850.034
NCAS0B038308.265ON32586850.045
KNAG0H032308.265ON28157810.11
TBLA0E044608.265ON27733770.42
AGR083W8.265ON29541702.8
NOTE: 2 genes in the same pillar as TPHA0A01780 were not hit in these BLAST results
LIST: ZYRO0C01584g KAFR0B05510

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0A01780
         (352 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...   415   e-145
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...    59   8e-09
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    54   2e-07
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    53   5e-07
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    52   1e-06
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...    49   7e-06
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    49   1e-05
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    45   1e-04
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    44   3e-04
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    42   0.002
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    39   0.011
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    39   0.012
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    38   0.025
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    37   0.034
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    37   0.045
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    36   0.11 
TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {...    34   0.42 
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    32   2.8  

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score =  415 bits (1067), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 241/352 (68%), Positives = 241/352 (68%)

Query: 1   MPNRDTLNVNSDKENDIAYKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTLSTAVFKD 60
           MPNRDTLNVNSDKENDIAYKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTLSTAVFKD
Sbjct: 1   MPNRDTLNVNSDKENDIAYKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTLSTAVFKD 60

Query: 61  AQQSKEXXXXXIKLNRLPLASKDXXXXXXXXXFIXXXXXXXXXXXXXXXXXXXXXXXXRK 120
           AQQSKE     IKLNRLPLASKD         FI                        RK
Sbjct: 61  AQQSKENNNNNIKLNRLPLASKDNNNSRRSNSFILQNNKLVLNKQLSLLNNNQTSNKLRK 120

Query: 121 YGSIXXXXXXXXXXXXXXXPVKSLILKXXXXXXXXXXXXXXXXXXXXXTLNLKNALQSKK 180
           YGSI               PVKSLILK                     TLNLKNALQSKK
Sbjct: 121 YGSILGVNNNGNNTNKTLNPVKSLILKDIPDNGNENDDDDDDDDDNIITLNLKNALQSKK 180

Query: 181 EPLLNQLKNAKKNSYSDSEEEEIGLFGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSAA 240
           EPLLNQLKNAKKNSYSDSEEEEIGLFGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSAA
Sbjct: 181 EPLLNQLKNAKKNSYSDSEEEEIGLFGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSAA 240

Query: 241 YPDLSYSPEGYIPFNNEDIKKLNTFKSPYSNLNVXXXXXXXXXXXXXXXXXXXXXVGXXX 300
           YPDLSYSPEGYIPFNNEDIKKLNTFKSPYSNLNV                     VG   
Sbjct: 241 YPDLSYSPEGYIPFNNEDIKKLNTFKSPYSNLNVNDSLLADHNNNNNSGLLELENVGSSD 300

Query: 301 XXXXXXXXXXXXXQDGRGSRQTNDNETFIDFEIQPSYNDGLDANELENLLDI 352
                        QDGRGSRQTNDNETFIDFEIQPSYNDGLDANELENLLDI
Sbjct: 301 DDDDNNLLNISNIQDGRGSRQTNDNETFIDFEIQPSYNDGLDANELENLLDI 352

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 52/93 (55%), Gaps = 6/93 (6%)

Query: 183 LLNQLKNAKKNSYSDSEEEE----IGLFGKGNGLQKLISQSMNHKTKIEAEIIP--EIET 236
           L  +L+NA    +S  +E E    IGLF    GLQ+LI  S+ +++K +++     EIE 
Sbjct: 200 LSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNSVQNESKSKSDNADGYEIEI 259

Query: 237 KSAAYPDLSYSPEGYIPFNNEDIKKLNTFKSPY 269
                  L Y P+GY PF  EDI+KL +F SPY
Sbjct: 260 APQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPY 292

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 23/45 (51%), Gaps = 8/45 (17%)

Query: 9  VNSDKENDIAYKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTL 53
           N DKEN+I Y  N         SN   PQTP   LLKR+HS  L
Sbjct: 3  ANEDKENNIVYSGN-------GSSNLNFPQTPA-HLLKRSHSNVL 39

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 39/67 (58%), Gaps = 9/67 (13%)

Query: 203 IGLFGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSAAYPDLSYSPEGYIPFNNEDIKKL 262
           IGL   GN LQ+LI  +         E + EIE KS A+PD  Y P+ ++PF+  DI KL
Sbjct: 172 IGLLSGGN-LQQLIRDA--------NEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKL 222

Query: 263 NTFKSPY 269
            TF SP+
Sbjct: 223 KTFNSPF 229

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 20/22 (90%)

Query: 331 FEIQPSYNDGLDANELENLLDI 352
            +I+PSY +GLD+N+LE+LLD+
Sbjct: 285 LDIEPSYGEGLDSNDLEDLLDL 306

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 45/93 (48%), Gaps = 10/93 (10%)

Query: 182 PLLNQLKNAKKNSYSDSEEE-EIGLFGKGNGLQKLISQ---SMNHKTKIEAEIIPEIETK 237
           PL  +L  A  N   D +EE  IGL G   GLQ+L+          +  E EI+P     
Sbjct: 166 PLAAKLLKALNNHNEDDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFEIEIVP----- 220

Query: 238 SAAYPDLSYSPEGYIPFNNEDIKKLNTFKSPYS 270
                +L + P GY PF   D+ KLNTF SP+S
Sbjct: 221 -PHSEELPHVPNGYSPFKESDVIKLNTFTSPFS 252

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 44/86 (51%), Gaps = 8/86 (9%)

Query: 192 KNSYSDSEEE---EIGLFGKGNGLQKLISQSMNHKTKIEAEIIP-----EIETKSAAYPD 243
           K   SD E E    +GLF +  GLQ+LI  S  ++ K + +        +IE        
Sbjct: 209 KQDSSDGENELNGGLGLFNEQGGLQQLIKNSTKNEQKTKNDKSDKTDDYDIEIAPQRQEP 268

Query: 244 LSYSPEGYIPFNNEDIKKLNTFKSPY 269
           L Y PEGY PF  +DI+KL TF SPY
Sbjct: 269 LPYVPEGYSPFQQDDIEKLKTFNSPY 294

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 37/97 (38%), Gaps = 30/97 (30%)

Query: 9  VNSDKENDIAYKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTLSTAV----------- 57
           N DKEN+I Y  N+        S    PQTP   LLKR+HS  L   V           
Sbjct: 4  ANEDKENNIVYTGNES-------SGINFPQTPA-HLLKRSHSNILKPPVRLDQLKRDANS 55

Query: 58 -----------FKDAQQSKEXXXXXIKLNRLPLASKD 83
                      K+   +K       +  RLPLA+KD
Sbjct: 56 NNGNTLKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKD 92

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 183 LLNQLKNAKKNSYSDSEEEE----IGLFGKGNGLQKLISQSMNHKTKIEAEII--PEIET 236
           L  +L++A    +S  +E E    IGLF    GLQ+LI  +   K     E     +IE 
Sbjct: 200 LSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNTAKGKEGPGKEDGDDHDIEI 259

Query: 237 KSAAYPDLSYSPEGYIPFNNEDIKKLNTFKSPYS 270
                  L Y P+GY PF  EDI KL TF SPY 
Sbjct: 260 APQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYG 293

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 8/52 (15%)

Query: 9  VNSDKENDIAYKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTLSTAVFKD 60
           N DKEN+I Y  N+        S+ + PQTP   LLKR+HS  L   V  D
Sbjct: 3  ANEDKENNIVYTGNES-------SSTSFPQTPA-HLLKRSHSNVLKPPVRLD 46

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 46/92 (50%), Gaps = 8/92 (8%)

Query: 186 QLKNAKKNSYSDSEEEE----IGLFGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSAAY 241
           +L+NA    +S  +E E    IGLF    GLQ+LI  +   K   + E   + + +    
Sbjct: 203 KLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNTTKGKQGSKEEDDDDDDYEIEIA 262

Query: 242 PD----LSYSPEGYIPFNNEDIKKLNTFKSPY 269
           P     L Y P+GY  F  EDI+KL TF SPY
Sbjct: 263 PQRQEPLPYVPDGYPSFQREDIEKLRTFNSPY 294

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 37/97 (38%), Gaps = 30/97 (30%)

Query: 9  VNSDKENDIAYKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTLSTAV----------- 57
           N DKEN+I Y  N+        S    PQTP   LLKR+HS  L   V           
Sbjct: 3  ANEDKENNIVYTGNES-------SGINFPQTPA-HLLKRSHSNVLKPPVRLDQLKKDLNS 54

Query: 58 -----------FKDAQQSKEXXXXXIKLNRLPLASKD 83
                      K+   +K       +  RLPLA+KD
Sbjct: 55 NNGKGLKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKD 91

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 36/74 (48%), Gaps = 3/74 (4%)

Query: 196 SDSEEEEIGLFGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSAAYPDLSYSPEGYIPFN 255
           SD E EE+G     +GL  L+  S   +   E     EIE     +  L Y PEG++   
Sbjct: 179 SDEEGEEVGGLFDKSGLLHLVRDSKKDEDDWEDR---EIEYGPQRHEPLPYIPEGHLSLA 235

Query: 256 NEDIKKLNTFKSPY 269
            ED  KL TF+SPY
Sbjct: 236 QEDYDKLKTFRSPY 249

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 197 DSEEEEIGLFGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSAAYPDLSYSPEGYIPFNN 256
           D+E E+ GL G   GLQ L+   ++ + + E++   E+E        L + PEGY PF  
Sbjct: 144 DAEGEQTGLLGATGGLQSLLGPKLSQRAE-ESDSDQEVEVIPPRPEPLPHVPEGYTPFGE 202

Query: 257 EDIKKLNTFK-SPY 269
           ++I KL     SP+
Sbjct: 203 QEIAKLQGVDVSPF 216

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%)

Query: 227 EAEIIPEIETKSAAYPDLSYSPEGYIPFNNEDIKKLNTFKSPY 269
           + E +P+IET     P+L + P GY  F +E+I KL T+ SP+
Sbjct: 187 DTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPF 229

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 10/81 (12%)

Query: 182 PLLNQLKNAKKNSYSDSEEEEIGLFGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSAAY 241
           PL  ++K A  +S + S E + GL    +GL+K+ +         + ++  EIE  S   
Sbjct: 119 PLALKIKQALTHSIA-SAEGKTGLLNGKSGLRKIFN---------DRDLDREIEVASVRE 168

Query: 242 PDLSYSPEGYIPFNNEDIKKL 262
           P+  Y PEGY P ++ D++KL
Sbjct: 169 PEKPYEPEGYEPLDDSDLEKL 189

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 244 LSYSPEGYIPFNNEDIKKLNTFKSPYS 270
           L Y P+GY PF NEDI KL  + SP++
Sbjct: 286 LPYIPQGYTPFTNEDINKLKVYHSPFA 312

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 9/64 (14%)

Query: 206 FGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSAAYPDLSYSPEGYIPFNNEDIKKLNTF 265
            G GNGL+ LI +        E E+   IE       +L Y P GY PF+ E I+KL   
Sbjct: 138 LGFGNGLKALIREK-------EDEL--NIEYAPKRQKELPYIPNGYDPFDKESIEKLQHH 188

Query: 266 KSPY 269
           +SP+
Sbjct: 189 RSPF 192

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 9/58 (15%)

Query: 214 KLISQSMNHKTKIEAEIIPEIETKSAAYPD-LSYSPEGYIPFNNEDIKKL-NTFKSPY 269
           KL S++++  + +E E+IP         P+ L + P GY PF +EDI KL +T  SP+
Sbjct: 163 KLHSETLDSDSDLEVEVIP-------PRPEPLPHIPHGYTPFTDEDIGKLQDTEASPF 213

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 38/86 (44%), Gaps = 19/86 (22%)

Query: 203 IGLF--------GKGNGLQKLISQSMNHKT--KIEAEIIP---------EIETKSAAYPD 243
           IGLF         K  GLQ+LI ++   ++  KI + +           EIE        
Sbjct: 165 IGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPIREEP 224

Query: 244 LSYSPEGYIPFNNEDIKKLNTFKSPY 269
           L + P GY PF  EDI KL TF S Y
Sbjct: 225 LPFVPFGYTPFTPEDINKLKTFHSSY 250

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 6  TLNVNSDKENDIAYKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTL---STAVFKDAQ 62
          +L+ N DKEN   Y+++    V     +  +P+TP   LLKR+ S  L   S     +  
Sbjct: 2  SLDTNEDKENKTTYESH----VHSTKQSHLMPETPAHLLLKRSLSTVLKPNSVNATDELG 57

Query: 63 QSKEXXXXXIKL-NRLPLASKD 83
                   ++L NRLPLA KD
Sbjct: 58 NISPRRRQLLQLQNRLPLAKKD 79

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 10/57 (17%)

Query: 209 GNGLQKLISQSMNHKTKIEAEIIPEIETKSAAYPDLSYSPEGYIPFNNEDIKKLNTF 265
           G GL +L+ QS N           E+E +  A  +L Y P+G+I  +  DI KL  +
Sbjct: 156 GGGLDRLVRQSQNR----------ELEIRPQAQDELPYIPDGHIILHEADIAKLRDY 202

>TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {ON}
           Anc_8.265 YDR113C
          Length = 277

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 233 EIETKSAAYPDLSYSPEGYIPFNNEDIKKLNTF 265
           EIET+S    +L Y PE Y  FN E+I  LN +
Sbjct: 142 EIETRSYEPKELDYEPENYFGFNQEEIDGLNDY 174

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 229 EIIPEIETKSAAYPDLSYSPEGYIPFNNEDIKKLNTFKSPY 269
           E +P +E      P+L + P GY    + D+ KL  + SP+
Sbjct: 175 EDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPF 215

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.129    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,738,602
Number of extensions: 1051452
Number of successful extensions: 3562
Number of sequences better than 10.0: 31
Number of HSP's gapped: 3620
Number of HSP's successfully gapped: 37
Length of query: 352
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 242
Effective length of database: 40,868,139
Effective search space: 9890089638
Effective search space used: 9890089638
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)