Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0A017608.271ON89389343790.0
Kpol_543.438.271ON86683624550.0
Skud_12.1608.271ON89390524090.0
NCAS0B050508.271ON92383424080.0
YLR092W (SUL2)8.271ON89390224040.0
Smik_12.1518.271ON89390523920.0
TDEL0F039808.271ON86783423830.0
Suva_10.1768.271ON89390323820.0
Skud_2.424na 1ON86390023820.0
Suva_4.554na 1ON85083123780.0
YBR294W (SUL1)na 1ON85989323740.0
CAGL0L12342g8.271ON89189523730.0
KNAG0G020708.271ON89992123700.0
Smik_2.435na 1ON86383123690.0
KAFR0B027508.271ON83483023650.0
NDAI0B020208.271ON90589923550.0
TPHA0J008008.271ON91791823410.0
SAKL0H16830g8.271ON86289423050.0
KLLA0F19338g8.271ON89191623070.0
ZYRO0C01452g8.271ON90690022580.0
KLTH0G13486g8.271ON90284122440.0
AGR077C8.271ON84889520770.0
Kwal_56.237598.271ON86182820720.0
Ecym_42998.271ON87488719180.0
TBLA0F030508.271ON89751012041e-150
Ecym_7084na 2ON6894783022e-27
NCAS0B048008.99ON7245262711e-23
AGR213Cna 2ON6894752692e-23
KNAG0D023908.99ON7164642631e-22
TPHA0H007208.99ON7874832585e-22
YPR003C8.99ON7544622569e-22
TBLA0C052708.99ON7764712442e-20
Suva_16.3228.99ON7425532407e-20
NDAI0B022108.99ON7061751899e-14
CAGL0L09207g8.99ON7251791834e-13
SAKL0H08800gna 2ON6204381825e-13
Smik_16.2418.99ON7442421692e-11
Kpol_467.118.99ON7441411692e-11
ZYRO0F04796g8.99ON7351431631e-10
SAKL0B03124g8.99ON7442061593e-10
KLLA0E14059g8.99ON7061441584e-10
TDEL0C012808.99ON7271411575e-10
Kwal_27.110398.99ON7261501576e-10
Skud_16.2868.99ON7451791541e-09
KLTH0G16764g8.99ON7101441513e-09
ACR257C1.215ON25980724.9
Smik_14.2782.266ON54892735.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0A01760
         (893 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...  1691   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...   950   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...   932   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271    932   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...   930   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...   926   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...   922   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...   922   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...   922   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...   920   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...   919   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...   918   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...   917   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...   917   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...   915   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271    911   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....   906   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...   892   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...   893   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...   874   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...   868   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   804   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...   802   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   743   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   468   e-150
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...   120   2e-27
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   108   1e-23
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...   108   2e-23
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   105   1e-22
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   103   5e-22
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   103   9e-22
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    99   2e-20
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    97   7e-20
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...    77   9e-14
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    75   4e-13
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    75   5e-13
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    70   2e-11
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    70   2e-11
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    67   1e-10
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    66   3e-10
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    65   4e-10
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    65   5e-10
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    65   6e-10
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    64   1e-09
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    63   3e-09
ACR257C Chr3 complement(808667..809446) [780 bp, 259 aa] {ON} Sy...    32   4.9  
Smik_14.278 Chr14 (512181..513827) [1647 bp, 548 aa] {ON} YNL048...    33   5.1  

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score = 1691 bits (4379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 830/893 (92%), Positives = 830/893 (92%)

Query: 1   MTASINGSIDLERFELEYDHGKRGDDTHDRVEARDLYSKVDIEEVTFQCDNYSGRLDVNS 60
           MTASINGSIDLERFELEYDHGKRGDDTHDRVEARDLYSKVDIEEVTFQCDNYSGRLDVNS
Sbjct: 1   MTASINGSIDLERFELEYDHGKRGDDTHDRVEARDLYSKVDIEEVTFQCDNYSGRLDVNS 60

Query: 61  SLSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAG 120
           SLSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAG
Sbjct: 61  SLSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAG 120

Query: 121 ITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKV 180
           ITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKV
Sbjct: 121 ITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKV 180

Query: 181 IERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGS 240
           IERVTSGLTADEQ               CGIISTGIGFLRLGFLIEFISLNAVAGFMTGS
Sbjct: 181 IERVTSGLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTGS 240

Query: 241 AFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFF 300
           AFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFF
Sbjct: 241 AFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFF 300

Query: 301 SSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSS 360
           SSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSS
Sbjct: 301 SSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSS 360

Query: 361 TSVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYK 420
           TSVPISILGTVPKGLKEVAVFKVPGGLFEK                    KSFGRVNDYK
Sbjct: 361 TSVPISILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGRVNDYK 420

Query: 421 IVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCL 480
           IVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCL
Sbjct: 421 IVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCL 480

Query: 481 TGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGI 540
           TGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGI
Sbjct: 481 TGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGI 540

Query: 541 YFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDD 600
           YFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDD
Sbjct: 541 YFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDD 600

Query: 601 SVKNRLDQNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKNDYHREVNPLIKIT 660
           SVKNRLDQNENP                 NSKTTNLSYYVRWVPMKNDYHREVNPLIKIT
Sbjct: 601 SVKNRLDQNENPKSSEKEYSEFKSYEMSSNSKTTNLSYYVRWVPMKNDYHREVNPLIKIT 660

Query: 661 PPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECP 720
           PPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECP
Sbjct: 661 PPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECP 720

Query: 721 KSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATA 780
           KS           TDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATA
Sbjct: 721 KSLKNLFNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATA 780

Query: 781 IQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYH 840
           IQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYH
Sbjct: 781 IQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYH 840

Query: 841 VSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
           VSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL
Sbjct: 841 VSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score =  950 bits (2455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/836 (56%), Positives = 598/836 (71%), Gaps = 41/836 (4%)

Query: 58  VNSSLSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDL 117
           +NSS ++P Y E+ VT+K++Y   I  Y +      YL S+FP++KWLP YN  WLI DL
Sbjct: 72  LNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLISDL 131

Query: 118 IAGITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQT 177
           IAGIT+GCVLVPQSMSYAQIATL PQYGLYSSF+GA+ YS FATSKDVCIGPVAVMSLQT
Sbjct: 132 IAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSLQT 191

Query: 178 AKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFM 237
           AKVI+ V S LT +++               CGIIS G+G LRLGFL+E ISLNAV GFM
Sbjct: 192 AKVIQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTGFM 251

Query: 238 TGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCK 297
           TGSA NII GQVPALMGY  +VNTR +TY+V+INTLKHLPDTK+DA+FGLIPL ILY  K
Sbjct: 252 TGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYFWK 311

Query: 298 WFFSSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRG 357
           W+FSS+GP    KL +R     + +K IK    ++FY NAMR+G++IIV T+ISW++TRG
Sbjct: 312 WWFSSMGP----KLVDRYYPNSKYKKYIK---AFYFYGNAMRSGIIIIVMTSISWSVTRG 364

Query: 358 KSSTSVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVN 417
           KS +  PISILGTVP GL+EV VF  P GL  K                    KSFGRVN
Sbjct: 365 KSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVN 424

Query: 418 DYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLAL 477
           DYK+VPDQELIAIG++NLIGTFF +YP TGSFSRSALKAKC+VKTPLSG+F+G+CVLLAL
Sbjct: 425 DYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLAL 484

Query: 478 YCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIE 537
           YCLTGAF+YIPKATLSAVIIHAVSDL+ASYKTT +F+KMNPLDF+CFITTVFITVF+SIE
Sbjct: 485 YCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIE 544

Query: 538 YGIYFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENT 597
            GIYF +C+S A L+FK  FP G FLGY+KIAE++NP +  +DY  L++ + + +     
Sbjct: 545 DGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIVDSDY--LVEKAETSVQYSTV 602

Query: 598 KDDSVKNRLDQNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKNDYHREVNPLI 657
             +  K  L                        S  + L Y+++W+P  + Y +E+NP +
Sbjct: 603 LMNPEKGELSYLS------------------SKSSESQLKYHIKWIPYDHAYTKEMNPNV 644

Query: 658 KITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEW 717
           ++TPPP G+IVYR  +SFTY+NCSR+Y+ +YD+VK+ TR G    + +K DRPWND G+W
Sbjct: 645 EVTPPPDGVIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDW 704

Query: 718 ECPKSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTD 777
           + PK             +   +++KD +E    ++K    D +P LKIIC DFSQV QTD
Sbjct: 705 KPPK-------FLKNIINWRKNKNKD-DEPTTFDNKV--VDTRPILKIICLDFSQVAQTD 754

Query: 778 ATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQ 837
           +TA+QSL DLR+A+N+Y+++Q+E+HFSGI+S WVKK L+ +GFGTVN  YSD+SIIIGH 
Sbjct: 755 STALQSLLDLRRAINKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHT 814

Query: 838 SYHVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
           SYHV K  + E+     + E    P+ +  Y+I   TGTN+PFFHI+IPDFS W +
Sbjct: 815 SYHVVKTEDLENNPMTTVEE----PNQNSSYYIHAGTGTNFPFFHIEIPDFSKWNI 866

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/905 (53%), Positives = 608/905 (67%), Gaps = 58/905 (6%)

Query: 10  DLERFELEYDHGKRGDD----THDRVEARDLYSKV---DIEEVTFQCDNYSGRLDVN-SS 61
           +L+  ELEYD  K  ++    + + +E+  + ++    D + V      Y    DV+   
Sbjct: 26  NLDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKGVKGSKIEYFDPSDVSLYD 85

Query: 62  LSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGI 121
            S+  + E  V++K++Y   I  + ++     YL S+FP++ WLPHYN +W I DLIAGI
Sbjct: 86  NSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGI 145

Query: 122 TVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVI 181
           T+GCVLVPQSMSYAQ+ATL  QYGLYSSFIGA+ YSFFATSKDVCIGPVAVMSLQTAKVI
Sbjct: 146 TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVI 205

Query: 182 ERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSA 241
             V +    D                 CGIIS  +GFLRLGFL+E ISLNAVAGFMTGSA
Sbjct: 206 AEVQAKY-PDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSA 264

Query: 242 FNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFS 301
           FNI+ GQVPALMGYNK VNTRA+TY+VVI TLKHLPDTKLDAVFGLIPL +LY+ KW+  
Sbjct: 265 FNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCG 324

Query: 302 SLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSST 361
           + GP+ LN   N +N   R  KI+K+    +FY+ A RNG++IIVFT I WAITRGKSS+
Sbjct: 325 TYGPR-LNDRYNSKN--ARLHKIVKWT---YFYAQASRNGIIIIVFTCIGWAITRGKSSS 378

Query: 362 SVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKI 421
             PISILG+VP GLKEV VF VP GL  K                    KSFGR+NDYK+
Sbjct: 379 ERPISILGSVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLLLEHIAISKSFGRINDYKV 438

Query: 422 VPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLT 481
           VPDQELIAIGV+NL+GTFF AYPATGSFSRSALKAKC+V+TPLSGLFSG+CVLLALYCLT
Sbjct: 439 VPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLT 498

Query: 482 GAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIY 541
           GAF+YIPKATLSAVIIHAVSDLLASY+TT NF+KMNPLDF+CFI TV ITVF+SIE GIY
Sbjct: 499 GAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIY 558

Query: 542 FAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDS 601
           FA+C+SCA L+ K  FP G FLG ++IAEV      T+ Y     D+ S + E N +  +
Sbjct: 559 FAMCWSCAMLLLKVAFPAGKFLGRVEIAEV------TDAYVKADSDAVSYVSENNNRIST 612

Query: 602 VKNRLDQNENPXXXXXXXXXXXXXXXXXNSKTTNLS------------YYVRWVPMKNDY 649
           ++   +  E+                  N +T   +            Y+ +W+P  + Y
Sbjct: 613 LE---ENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHKY 669

Query: 650 HREVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDR 709
            RE+NP + I PPP  ++VYR  +S+TYLNCSRHY+II DEVK+ TR+G    +++K DR
Sbjct: 670 TRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDR 729

Query: 710 PWNDVGEWECPKSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFD 769
           PWND G WE P             +D+      +  +   +NS     D +P LKI+C D
Sbjct: 730 PWNDPGPWEAPAFLKNLKFWKKKESDL------EFTQNAPNNSIDAERDERPLLKILCLD 783

Query: 770 FSQVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSD 829
           FSQV QTDATA+QSL DLRKA+N+Y+++Q+E+HF GIIS WVK+ LI  GFGT+N+ YSD
Sbjct: 784 FSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSD 843

Query: 830 KSIIIGHQSYHVSKI-NNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDF 888
           +SI+ GH SYHV+++  N+E+            PD    Y + T +GTN PFFHIDIPDF
Sbjct: 844 ESIVAGHTSYHVARVPRNKEN------------PDK---YSVYTASGTNLPFFHIDIPDF 888

Query: 889 SNWEL 893
           + W++
Sbjct: 889 AKWDI 893

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/834 (56%), Positives = 576/834 (69%), Gaps = 26/834 (3%)

Query: 64  IPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITV 123
           IP Y+EK V+IKD+Y   I +  ++  +  Y  S+FP+ +WLPHYNL W   DLIAGITV
Sbjct: 112 IPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITV 171

Query: 124 GCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIER 183
           GCVLVPQSMSYAQIATL  QYGLYSSFIGAF YS FATSKDVCIGPVAVMSL+TAKV+ +
Sbjct: 172 GCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTK 231

Query: 184 VTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFN 243
           V +    D                 CGI++ G+G LRLGFL+E ISLNAV GFMTGSA N
Sbjct: 232 VLAKY-PDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALN 290

Query: 244 IICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSL 303
           I+ GQVP LMGYN KVNTR + Y+V+I TLKHLPDTKLDAVFGLIPL +LYL KW+  ++
Sbjct: 291 ILWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNM 350

Query: 304 GPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTSV 363
           GP+ ++K    +N  ER      Y   ++FY+ A +N ++IIVFTAISW+ITRGK+    
Sbjct: 351 GPKLVDKWF-PKNKNERANF---YFKKFYFYAQAAKNAIIIIVFTAISWSITRGKAKADR 406

Query: 364 PISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIVP 423
           PISILGTVPKGLKEV V K+P GL  K                    KSFGR+NDYK+VP
Sbjct: 407 PISILGTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVP 466

Query: 424 DQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGA 483
           DQELIAIGVTNLIGTFF AYPATGSFSRSALKAKC V+TPLSG+F+GACVLLALYCLTGA
Sbjct: 467 DQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGA 526

Query: 484 FYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYFA 543
           F+YIPKATLSAVII AVSDL+ASYK T NF+KMNPLD +CF+ TVFITVFSSIE GIYFA
Sbjct: 527 FFYIPKATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFA 586

Query: 544 ICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDSVK 603
           +C+SCA L+ K  FP G FLG I++AEV++  +   D +I   +S++     +    S  
Sbjct: 587 VCWSCAILLLKVCFPAGKFLGRIEVAEVIDGYV---DNSI---ESATTAEYSSASSPSSD 640

Query: 604 NRLDQNENPXXXXXXXXXXXXXXXXXNSKT---TNLSYYVRWVPMKNDYHREVNPLIKIT 660
           N  D  +                    S       + YY +WVP  + Y RE+NP + I 
Sbjct: 641 NETDTKKIQKTSSISFGKDAKAVAVSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNIL 700

Query: 661 PPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECP 720
           PPPPG+IVYR  DSFTY+NCSRHYD+I+DEVK+ TR+G    +++K DRPWND GEWE P
Sbjct: 701 PPPPGVIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAP 760

Query: 721 KSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATA 780
           +            +        D   A++ +  ++  DN+P LKI+C DFSQV Q DA+A
Sbjct: 761 QFLKNLFHRKKKNS-------TDEESAVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASA 813

Query: 781 IQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYH 840
           IQSL DLRK++NRY+++Q+E+HF+GI+S WVK+ LI  GFGT+ND +SD SII GH SYH
Sbjct: 814 IQSLVDLRKSINRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYH 873

Query: 841 VSKINNQED-GLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
           +++     D  LE+   + Y +      YH+   TGTN PFFHIDIPDFS W+L
Sbjct: 874 LTRTLPDSDFDLESNFRDTYSRSQ----YHVFAATGTNLPFFHIDIPDFSKWDL 923

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score =  930 bits (2404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/902 (53%), Positives = 602/902 (66%), Gaps = 52/902 (5%)

Query: 10  DLERFELEYDHGKRGDDTHDRVEARDLYSKVDIEEVTFQCD--------NYSGRLDVN-S 60
           DL+  ELEYD  K  ++ +D    +DL S    +               +Y    DV+  
Sbjct: 26  DLDDLELEYDQYKN-NENNDTFNDKDLESNSVAKHNAVNSSKGVKGSKIDYFNPSDVSLY 84

Query: 61  SLSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAG 120
             S+  + E  V++K++Y   I  + ++     YL S+FP++ WLPHYN  W   DLIAG
Sbjct: 85  DNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAG 144

Query: 121 ITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKV 180
           IT+GCVLVPQSMSYAQ+ATL  QYGLYSSFIGA+ YSFFATSKDVCIGPVAVMSLQTAKV
Sbjct: 145 ITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKV 204

Query: 181 IERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGS 240
           I  VT+    D                 CGIIS  +GFLRLGFL+E ISLNAVAGFMTGS
Sbjct: 205 IADVTAKY-PDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGS 263

Query: 241 AFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFF 300
           AFNI+ GQVPALMGYN  VNTRA+TY+VVI TLKHLPDTKLDAVFGLIPL +LY+ KW+ 
Sbjct: 264 AFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWC 323

Query: 301 SSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSS 360
            + GP+ LN   N +N   R  KIIK+    +FY+ A RNG++IIVFT I WAITRGKS 
Sbjct: 324 GTYGPR-LNDRYNSKN--PRLHKIIKWT---YFYAQASRNGIIIIVFTCIGWAITRGKSK 377

Query: 361 TSVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYK 420
           +  PISILG+VP GLKEV VF VP GL  K                    KSFGR+NDYK
Sbjct: 378 SERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYK 437

Query: 421 IVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCL 480
           +VPDQELIAIGV+NL+GTFF AYPATGSFSRSALKAKC+V+TPLSGLFSG+CVLLALYCL
Sbjct: 438 VVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCL 497

Query: 481 TGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGI 540
           TGAF+YIPKATLSAVIIHAVSDLLASY+TT NF+KMNPLDF+CFI TV ITVF+SIE GI
Sbjct: 498 TGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGI 557

Query: 541 YFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEEN---- 596
           YFA+C+SCA LI K  FP G FLG +++AEV      T+ Y     D  S + E N    
Sbjct: 558 YFAMCWSCAMLILKVAFPAGKFLGRVEVAEV------TDAYVRPDSDVVSYVSENNNGIS 611

Query: 597 TKDDSVKNRLDQNENPXXXXXXXXXXXXXXXXXNSKTTNLS-----YYVRWVPMKNDYHR 651
           T +D  ++  + +                    +S ++++S     Y+ +W+P  + Y R
Sbjct: 612 TLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKWIPFDHKYTR 671

Query: 652 EVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPW 711
           E+NP ++I PPP G++VYR  +S+TYLNCSRHY+II +EVKK TR+G    +++K DRPW
Sbjct: 672 ELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPW 731

Query: 712 NDVGEWECPKSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFS 771
           ND G WE P                  + D +  E   S S     D++P LKI+C DFS
Sbjct: 732 NDPGPWEAPAFLKNLKFWKKR------ENDPESMENAPSTSVDVERDDRPLLKILCLDFS 785

Query: 772 QVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKS 831
           QV QTDATA+QSL DLRKA+N+Y+++Q+E+HF GIIS WVK+ LI  GFGT+N+ YSD+S
Sbjct: 786 QVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDES 845

Query: 832 IIIGHQSYHVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNW 891
           I+ GH SYHV+++   E+  E               Y + T +GTN PFFHIDIPDF+ W
Sbjct: 846 IVAGHTSYHVARVPQGEENPEK--------------YSVYTASGTNLPFFHIDIPDFAKW 891

Query: 892 EL 893
           ++
Sbjct: 892 DI 893

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/905 (53%), Positives = 596/905 (65%), Gaps = 58/905 (6%)

Query: 10  DLERFELEYDHGKRGDDTHDRVEARDLYSKVDIEEVTFQCDNY--SGRLDVNSSL----- 62
           DL+  ELEYD  K         E  D +   D+E  +    N   +G+    S +     
Sbjct: 26  DLDDLELEYDQYKNN-------ENNDAFKDNDLESNSVAKPNAVGNGKGAKGSKIEYFNP 78

Query: 63  --------SIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLI 114
                   S+  + E  V++K++Y   I  + ++     YL S+FP++ WLPHYN +W  
Sbjct: 79  SDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFT 138

Query: 115 QDLIAGITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMS 174
            DLIAGIT+GCVLVPQSMSYAQ+ATL  QYGLYSSFIGA+ YSFFATSKDVCIGPVAVMS
Sbjct: 139 ADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMS 198

Query: 175 LQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVA 234
           LQTAKVI  VT+    D                 CGIIS  IGFLRLGFL+E ISLNAVA
Sbjct: 199 LQTAKVIADVTAKY-PDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVA 257

Query: 235 GFMTGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILY 294
           GFMTGSAFNI+ GQVPALMGYN  VNTRA+TY+VVI TLKHLPDTKLDAVFGLIPL +LY
Sbjct: 258 GFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLY 317

Query: 295 LCKWFFSSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAI 354
           + KW+  + GP  LN   N +N   R  KI+K+    +FY+ A RNGV+I+VFT I WAI
Sbjct: 318 VWKWWCGTYGP-ILNDRYNSKN--PRLHKILKWT---YFYAQASRNGVIIVVFTCIGWAI 371

Query: 355 TRGKSSTSVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFG 414
           TRGKS +  PISILG+VP GLKEV VF VP GL  K                    KSFG
Sbjct: 372 TRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFG 431

Query: 415 RVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVL 474
           R+NDYK+VPDQELIAIGV+NL+GTFF AYPATGSFSRSALKAKC+V+TPLSGLFSG+CVL
Sbjct: 432 RINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVL 491

Query: 475 LALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFS 534
           LALYCLTGAF+YIPKATLSAVIIHAVSDLLASY+TT NF+KMNPLDF+CFI TV ITVF+
Sbjct: 492 LALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFA 551

Query: 535 SIEYGIYFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDS------ 588
           SIE GIYFA+C+SCA L+ K  FP G FLG ++IAEV +  +  N   +           
Sbjct: 552 SIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIR 611

Query: 589 SSVLGEENTKDDSVKNRLDQNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKND 648
           +S  G+E  KD S K   + ++                     +   + Y+ +WVP  + 
Sbjct: 612 TSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPR---MKYHTKWVPFDHK 668

Query: 649 YHREVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQD 708
           Y RE+NP I+I PPP G++VYR  +S+TYLNCSRHY+II ++VK+ TR+G    +++K D
Sbjct: 669 YTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSD 728

Query: 709 RPWNDVGEWECPKSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICF 768
           RPWND G WE P                  + D +  E    NS     D++P LKI+C 
Sbjct: 729 RPWNDPGPWEAPAFLKNLKFWKKR------ESDSEFLENAPDNSIGTERDDRPLLKILCL 782

Query: 769 DFSQVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYS 828
           DFSQV QTDATA+QSL DLRK +N+Y+++Q+E+HF GIIS WVK+ L+  GFGT+N+ YS
Sbjct: 783 DFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYS 842

Query: 829 DKSIIIGHQSYHVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDF 888
           D+SI+ GH SYHV+++   ++  +               Y + T +GTN PFFHIDIPDF
Sbjct: 843 DESIVAGHTSYHVARVPQSKENSDK--------------YSVYTASGTNLPFFHIDIPDF 888

Query: 889 SNWEL 893
           + W++
Sbjct: 889 AKWDI 893

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score =  922 bits (2383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/834 (56%), Positives = 583/834 (69%), Gaps = 44/834 (5%)

Query: 63  SIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGIT 122
           +IP + E  V++KD+Y + I +  ++     Y+ SLFP++KW PHYNL W   DL+AGIT
Sbjct: 75  NIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGIT 134

Query: 123 VGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIE 182
           VGCVLVPQSMSYAQIA+L PQYGLYSSFIGAFIYS FATSKDVCIGPVAVMSLQTAKVI 
Sbjct: 135 VGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA 194

Query: 183 RVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAF 242
           +V++    ++                CGI++ G+G LRLGFL+E ISLNAVAGFMTGSAF
Sbjct: 195 QVSAKYPENDPIVTAPVIATALSLL-CGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAF 253

Query: 243 NIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSS 302
           NI+ GQVPALMGY+ KVNTRASTY+VVI++LKHLPDTKLDAVFGL+PL +LYL KW+  +
Sbjct: 254 NILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGT 313

Query: 303 LGPQYLNKLSNRR-NLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSST 361
            GP    KL++R+   + ++++I+K    ++FYSNAMRN V+IIVFTAISW IT+ K   
Sbjct: 314 YGP----KLADRQLAHSPKKQRILK---RFYFYSNAMRNAVIIIVFTAISWRITKNKDKE 366

Query: 362 SVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKI 421
             PI +LGTVP GL++V V K+P GL  K                    KSFGR+NDYK+
Sbjct: 367 HRPIKVLGTVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKV 426

Query: 422 VPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLT 481
           VPDQELIAIG TNLIGTFF AYPATGSFSRSALKAKC+V+TP SG+F+G CVL+A+YCLT
Sbjct: 427 VPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLT 486

Query: 482 GAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIY 541
            AF++IP ATLSAVIIHAVSDLLASYKTT NF+KMNPLD   FI TV ITVFSSIE GIY
Sbjct: 487 DAFFFIPSATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIY 546

Query: 542 FAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDS 601
           FA+C+SCA L+ K+ FP G FLG +++AEV+NPT+  +   I ++D       E +   S
Sbjct: 547 FAMCWSCAMLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISINDQI-----EGSVGKS 601

Query: 602 VKNRLDQNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKNDYHREVNPLIKITP 661
              + D+                      S  +N  ++ +WV  +  Y+RE+NP +KI P
Sbjct: 602 KSLKADKG-----------------AISASSGSNYKFHSKWVAEQYAYNRELNPDVKILP 644

Query: 662 PPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWE-CP 720
           PPPG++VYR  DSFTY+NCSRHYD I+D +KK+TR+G     ++K DRPWND GEWE  P
Sbjct: 645 PPPGVVVYRMSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISP 704

Query: 721 KSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATA 780
                         DI   E +D + AI+     N  D +P LKIIC DFSQVVQ D+TA
Sbjct: 705 SIKKFFKLGKKNQNDI---ESQDEDVAID-----NTRDERPLLKIICLDFSQVVQVDSTA 756

Query: 781 IQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYH 840
           IQSL DLRKAV++Y+++Q+E+HF+GIIS+WVK+SL+ MGFGTVN +YSD+SII GH SYH
Sbjct: 757 IQSLVDLRKAVHKYADRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYH 816

Query: 841 VSKINNQ-EDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
           ++K      D      +          IY     TGTN PFFH+DIPDFS W+L
Sbjct: 817 IAKTTKPLADDFTTDSSGSSQLQQSQEIY---AATGTNMPFFHLDIPDFSKWDL 867

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/903 (53%), Positives = 603/903 (66%), Gaps = 54/903 (5%)

Query: 10  DLERFELEYDHGKRGDDT----HDRVEARDLYSKVDIEE---VTFQCDNYSGRLDVN-SS 61
           DL+  ELEYD  K  ++      + +E+  L +     E   V      Y    D++   
Sbjct: 26  DLDDLELEYDQYKNNENNGAFNDNDLESNSLTNHNTASEAKGVKGSKVEYFNTSDISLYD 85

Query: 62  LSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGI 121
            S+  ++E  V+ K++Y   I  + ++     YL S+FP++ WLPHYN++W I DLIAGI
Sbjct: 86  NSVSQFDEPTVSFKEYYDHSIRSHLTLKAAGNYLKSVFPIIYWLPHYNVNWFIADLIAGI 145

Query: 122 TVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVI 181
           T+GCVLVPQSMSYAQ+ATL  QYGLYSSFIGA+ YSFFATSKDVCIGPVAVMSLQTAKVI
Sbjct: 146 TIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVI 205

Query: 182 ERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSA 241
             VT+    D                 CGIIS  +GFLRLGFL+E ISLNAVAGFMTGSA
Sbjct: 206 ADVTARY-PDGDTTITGPIIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSA 264

Query: 242 FNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFS 301
           FNI+ GQVPALMGYNK VNTR +TY++VI++LKHLPDT LDA FGLIPL ILY  KW+  
Sbjct: 265 FNILWGQVPALMGYNKLVNTRVATYKIVIDSLKHLPDTTLDAAFGLIPLFILYTWKWWCG 324

Query: 302 SLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSST 361
           + GP+  ++ ++++    R  KI+K+     FY+ A RNG++IIVFT I+WAITRGKSS 
Sbjct: 325 TYGPRLNDRFNSKK---PRLHKIVKWTC---FYAQASRNGIIIIVFTCIAWAITRGKSSA 378

Query: 362 SVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKI 421
             PISILG+VP GLKEV VF VP GL  K                    KSFGRVNDYK+
Sbjct: 379 DRPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRVNDYKV 438

Query: 422 VPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLT 481
           VPDQELIAIGV+NL+GTFF AYPATGSFSRSALKAKC+V+TPLSGLFSG+CVLLALYCLT
Sbjct: 439 VPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLT 498

Query: 482 GAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIY 541
           GAF+YIPKATLSAVIIHAVSDLLASY+TT NF+KMNPLDF+CFI TV ITVFSSIE GIY
Sbjct: 499 GAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFSSIENGIY 558

Query: 542 FAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDS 601
           FA+C+SCA  I K  FP G FLG ++IAEV      T+ Y     DS S   E N +  +
Sbjct: 559 FAMCWSCAIFILKVAFPAGKFLGRVEIAEV------TDAYVRADSDSVSFTSENNNRIST 612

Query: 602 V-KNRLDQNENPXXXXXXXXXXXXXXXXXNSKTT--------NLSYYVRWVPMKNDYHRE 652
           + ++ + + E P                     +         + Y+ +W+P  + Y +E
Sbjct: 613 LEEDGVGEKEGPTNYIINSFKKLETKVQTKGFESPSASIGQPRIKYHTKWLPFDHKYTKE 672

Query: 653 VNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWN 712
           +NP + I PPP G++VYR  +S+TY+NCSRHY++I DE+KK TR+G    +++K DRPWN
Sbjct: 673 LNPDVNILPPPEGVLVYRLSESYTYINCSRHYNVITDEIKKVTRRGQLIRHRKKSDRPWN 732

Query: 713 DVGEWECPKSXXXXXXXXXXXTDIGGDEDKDGN--EAIESNSKANNTDNKPELKIICFDF 770
           D G WE P             TDI   E+   N  +A+         D++P LKI+C DF
Sbjct: 733 DPGPWEPPTFFKNLKFWKKKETDIESSENAVNNPTDAVR--------DDRPLLKILCLDF 784

Query: 771 SQVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDK 830
           SQV QTDATA+QSL DLRKA+N+Y+++Q+E+HF GIIS WVK+ LI  GFGT+N+ YSD+
Sbjct: 785 SQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDE 844

Query: 831 SIIIGHQSYHVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSN 890
           SI+ GH SYHV+++   E+            PD    Y + T +GTN PFFHIDIPDF+ 
Sbjct: 845 SIVAGHTSYHVARVPQNEE-----------TPDK---YSVYTASGTNLPFFHIDIPDFAK 890

Query: 891 WEL 893
           W++
Sbjct: 891 WDI 893

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/900 (53%), Positives = 591/900 (65%), Gaps = 74/900 (8%)

Query: 10  DLERFELEY------------DHGKRGDDTHDRVEARDLY--SKVDIEEVTFQCDNYSGR 55
           D+E FE EY            D+ + GDD   ++  +  Y  +K ++ +V +        
Sbjct: 22  DIEVFESEYRTYRESEAAENRDNFQNGDDQSWKINGKQKYEVTKSEVSDVAYD------- 74

Query: 56  LDVNSSLSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQ 115
                  SIP Y E  VT+K++Y   I    ++     YL SLFP++KWLPHYN  W   
Sbjct: 75  -------SIPAYEESTVTLKEYYDHSIKSSLTVKSAGDYLYSLFPIIKWLPHYNFTWGYA 127

Query: 116 DLIAGITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSL 175
           DL+AGITVGCVLVPQSMSYAQIA+L+P+YGLYSSFIGAFIYS FATSKDVCIGPVAVMSL
Sbjct: 128 DLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSL 187

Query: 176 QTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAG 235
           QTAKVI  V      + Q               CG++ST +G LRLGFL+E ISLNAVAG
Sbjct: 188 QTAKVIAEVLKKY-PEGQTEVTGPIIATALCFLCGVVSTALGVLRLGFLVELISLNAVAG 246

Query: 236 FMTGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYL 295
           FMTGSAF+II GQ+PALMGYN  VNTR +TY+VVINTLKHLP+TKLDAVFGLIPL ILY+
Sbjct: 247 FMTGSAFSIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYV 306

Query: 296 CKWFFSSLGPQYLNKLSNR--RNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWA 353
            KW+  + G      L++R  RN    Q KI   L +++FY+ AMRN VVIIVFTAISW 
Sbjct: 307 WKWWCGTFGIT----LADRYYRN----QPKIANRLKSFYFYAQAMRNAVVIIVFTAISWR 358

Query: 354 ITRGKSSTSVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSF 413
           ITR KSS   PISILGTVP GL EV V K+P GL                       KSF
Sbjct: 359 ITRNKSSKERPISILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSF 418

Query: 414 GRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACV 473
           GR+NDYK++PDQELIAIGVTNLIGTFF +YPATGSFSRSALKAKC+V+TP SG+F+GACV
Sbjct: 419 GRINDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGIFTGACV 478

Query: 474 LLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVF 533
           LLALYCLT AF++IPKATLSAVIIHAVSDLL SYKTT  F+K NPLD + FI TVFITVF
Sbjct: 479 LLALYCLTSAFFFIPKATLSAVIIHAVSDLLTSYKTTWIFWKTNPLDCISFIATVFITVF 538

Query: 534 SSIEYGIYFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLG 593
           SSIE GIYFA+C+SCA L+ K  FP G FLG +++AEVLNPT+      +    SS+ L 
Sbjct: 539 SSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEGINAV---TSSNELP 595

Query: 594 EENTKDDSVKNRLDQNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKNDYHREV 653
            E +K   VK+ +D    P                         + V+W+P  +DY RE+
Sbjct: 596 NELSKQ--VKSTVDVLPAP----------------------EYKFSVKWIPFDHDYSREL 631

Query: 654 NPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWND 713
           N   K+ PPPPG+IVYR  DSFTY+NCSRHYDII+D +K+ TR+G     ++K DRPWND
Sbjct: 632 NRYTKVRPPPPGVIVYRLADSFTYVNCSRHYDIIFDRIKEETRRGQLISLRKKSDRPWND 691

Query: 714 VGEWECPKSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQV 773
            GEW+ P S                    D    + S      +  KP LK++C DFSQV
Sbjct: 692 PGEWKMPNSFKALFKFKRKSA------TTDNELPVSSGRNNQESYEKPLLKVVCLDFSQV 745

Query: 774 VQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSII 833
            Q D+TA+QSL DLRKAVN+Y+++Q+E+HF+GIIS W+K+SL+ + FGT N+ YSD SII
Sbjct: 746 AQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSII 805

Query: 834 IGHQSYHVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
            GH S+HV+K+   +D ++    +  +    S    +   TGTN PFFHIDIPDFS W++
Sbjct: 806 AGHSSFHVAKV--LKDDVDYTEEDSRISTSYSNYETLCAATGTNLPFFHIDIPDFSKWDV 863

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score =  920 bits (2378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/831 (56%), Positives = 568/831 (68%), Gaps = 45/831 (5%)

Query: 63  SIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGIT 122
           SIP Y E  VT+K++Y   I +  +      Y++SLFP++KWLPHYN  W   DL+AGIT
Sbjct: 65  SIPRYEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYNFTWCYADLVAGIT 124

Query: 123 VGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIE 182
           VGCVLVPQSMSYAQIA+L+P+YGLYSSF+GAFIYS FATSKDVCIGPVAVMSLQTAKVI 
Sbjct: 125 VGCVLVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA 184

Query: 183 RVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAF 242
            V      D Q               CGI++T +G LRLGFL+E ISLNAVAGFMTGSAF
Sbjct: 185 EVLKKYPQD-QTEVTGPIIATALCLLCGIVTTALGVLRLGFLVELISLNAVAGFMTGSAF 243

Query: 243 NIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSS 302
           +II GQVPALMGYNK VNTR STY+VVINTLKHLP+TKLDAVFGLIPL ILY+ KW+  +
Sbjct: 244 SIIWGQVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVFGLIPLVILYVWKWWCGT 303

Query: 303 LGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTS 362
            G      L+NR    +   KI   L +++FY+ AMRN VVI+VFTAISW+ITR K+S  
Sbjct: 304 YGIT----LANRH--YQNHPKIANNLKSFYFYAQAMRNAVVIVVFTAISWSITRNKASED 357

Query: 363 VPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIV 422
            PISILGTVP GL EV V K+P GL                       KSFGR+NDYK+V
Sbjct: 358 RPISILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVV 417

Query: 423 PDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTG 482
           PDQELIAIGVTNL+GTFF +YPATGSFSRSALKAKC+V+TP SGLF+G CVLLALYCLT 
Sbjct: 418 PDQELIAIGVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVLLALYCLTD 477

Query: 483 AFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYF 542
           AF++IPKATLSAVIIHAVSDLL SY+TT  F+K NPLD V FI TVFITVFSSIE GIYF
Sbjct: 478 AFFFIPKATLSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFITVFSSIENGIYF 537

Query: 543 AICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDSV 602
           A+C+SCA L+ K  FP G FLG +++AE+LNPTL  N          S +   N  +  V
Sbjct: 538 AMCWSCAILLLKQAFPAGRFLGRVEVAEILNPTLQNN---------VSAVVSLNESNKQV 588

Query: 603 KNRLDQNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKNDYHREVNPLIKITPP 662
           K  +D                        +++   +  +WVP  ++Y RE+N   KI PP
Sbjct: 589 KTTVDV----------------------LRSSEYRFTTKWVPFDHEYSRELNRCAKICPP 626

Query: 663 PPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECPKS 722
           PPG+IVYR  DSFTY+NCSRHYDII+D VK+ TR+G     ++K DRPWND GEW+ P S
Sbjct: 627 PPGVIVYRLSDSFTYVNCSRHYDIIFDHVKEETRRGQLVNLRKKSDRPWNDPGEWKMPTS 686

Query: 723 XXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATAIQ 782
                              ++   ++ + S    +  KP LK+IC DFSQV Q D+TAIQ
Sbjct: 687 LKTLFRFKRKSVT------ENEEPSVSNGSTNRGSYEKPLLKVICLDFSQVAQVDSTAIQ 740

Query: 783 SLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYHVS 842
           SL DLRKAVN+Y+++Q+E+HF+GIIS W+K+SL  + FGTVN+ YSD+S+I GH S HV+
Sbjct: 741 SLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLSSVDFGTVNEEYSDESVIAGHSSVHVT 800

Query: 843 KINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
           K ++ +D  +    E ++    S    +   TGTN PFFHIDIPDFS W++
Sbjct: 801 KFSSDDDA-DYTDEESHISAPYSNYGTLCAATGTNLPFFHIDIPDFSKWDI 850

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score =  919 bits (2374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/893 (54%), Positives = 589/893 (65%), Gaps = 59/893 (6%)

Query: 10  DLERFELEYDHGKRGDDTHDRVEARDLYSKVDIEEVTFQCDNYSGRLDVNSSL------- 62
           D+E FE EY    R     +  E RD     D  E  ++ ++   +  V  +        
Sbjct: 17  DIEVFESEY----RTYRESEAAENRDGLHNGD--EENWKVNSSKQKFGVTKNELSDVLYD 70

Query: 63  SIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGIT 122
           SIP Y E  VT+K++Y   I +  +      YL SLFP++KW PHYN  W   DL+AGIT
Sbjct: 71  SIPAYEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWFPHYNFTWGYADLVAGIT 130

Query: 123 VGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIE 182
           VGCVLVPQSMSYAQIA+L+P+YGLYSSFIGAFIYS FATSKDVCIGPVAVMSLQTAKVI 
Sbjct: 131 VGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA 190

Query: 183 RVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAF 242
            V      D Q               CGI++TG+G LRLGFL+E ISLNAVAGFMTGSAF
Sbjct: 191 EVLKKYPED-QTEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISLNAVAGFMTGSAF 249

Query: 243 NIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSS 302
           NII GQ+PALMGYN  VNTR +TY+VVINTLKHLP+TKLDAVFGLIPL ILY+ KW+  +
Sbjct: 250 NIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWWCGT 309

Query: 303 LGPQYLNKLSNR--RNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSS 360
            G      L++R  RN    Q K+   L +++FY+ AMRN VVI+VFTAISW+ITR KSS
Sbjct: 310 FGIT----LADRYYRN----QPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSITRNKSS 361

Query: 361 TSVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYK 420
              PISILGTVP GL EV V K+P GL                       KSFGR+NDYK
Sbjct: 362 KDRPISILGTVPSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFGRINDYK 421

Query: 421 IVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCL 480
           +VPDQELIAIGVTNLIGTFF +YPATGSFSRSALKAKC+V+TP SG+F+G CVLLALYCL
Sbjct: 422 VVPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYCL 481

Query: 481 TGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGI 540
           T AF++IPKATLSAVIIHAVSDLL SYKTT  F+K NPLD + FI TVFITVFSSIE GI
Sbjct: 482 TDAFFFIPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENGI 541

Query: 541 YFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDD 600
           YFA+C+SCA L+ K  FP G FLG +++AEVLNPT+  +   ++   SS+ L  E  K  
Sbjct: 542 YFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEDIDAVI---SSNELPNELNKQ- 597

Query: 601 SVKNRLDQNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKNDYHREVNPLIKIT 660
            VK+ ++    P                         + V+WVP  + Y RE+N    + 
Sbjct: 598 -VKSTVEVLPAP----------------------EYKFSVKWVPFDHGYSRELNINTTVR 634

Query: 661 PPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECP 720
           PPPPG+IVYR GDSFTY+NCSRHYDII+D +K+ TR+G     ++K DRPWND GEW+ P
Sbjct: 635 PPPPGVIVYRLGDSFTYVNCSRHYDIIFDRIKEETRRGQLITLRKKSDRPWNDPGEWKMP 694

Query: 721 KSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATA 780
            S                D        I + S    T  KP LK++C DFSQV Q D+TA
Sbjct: 695 DSLKSLFKFKRHSATTNSD------LPISNGSSNGETYEKPLLKVVCLDFSQVAQVDSTA 748

Query: 781 IQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYH 840
           +QSL DLRKAVNRY+++Q+E+HF+GIIS W+K+SL+ + FGT N+ YSD SII GH S+H
Sbjct: 749 VQSLVDLRKAVNRYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEYSDDSIIAGHSSFH 808

Query: 841 VSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
           V+K+   +D ++    +  +    S    +   TGTN PFFHIDIPDFS W++
Sbjct: 809 VAKV--LKDDVDYTDEDSRISTSYSNYETLCAATGTNLPFFHIDIPDFSKWDV 859

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score =  918 bits (2373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/895 (52%), Positives = 599/895 (66%), Gaps = 17/895 (1%)

Query: 10  DLERFELEYDHGKRGDDTHDRVEARDLYSKVDIEEVTFQCDNYSGRLDVNSSLSIPMYNE 69
           +L+  ELEY+  K  +   +     D+   +D ++  F+            S SIP Y E
Sbjct: 3   ELDNLELEYNQFKNNERPSNTNAGADIEKGLDTKKY-FERSITDNSTYGKKSYSIPSYEE 61

Query: 70  KPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCVLVP 129
             +T+KD+Y   + DYF+   +V Y+ SLFP++ WLP YN  W + DLIAGITVG VLVP
Sbjct: 62  DTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLVP 121

Query: 130 QSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERVTSGLT 189
           QSMSYAQIATL P+YGLYSSFIGA +YSFFATSKDVCIGPVAVMSLQTAKVI RV     
Sbjct: 122 QSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEK-H 180

Query: 190 ADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNIICGQV 249
            D                 CGII+TG+G LRLGFL+E ISLNAVAGFMTGSAFNII GQ+
Sbjct: 181 PDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQI 240

Query: 250 PALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSLGPQYLN 309
           P LMGY+KKVNTR STY VVI++LKHLPDTKLDA FGLIPL  L+  KW+ +S+GP    
Sbjct: 241 PGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGP---- 296

Query: 310 KLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTSVPISILG 369
           KL++R      + +  KY   ++FY  A RNG++II+FTA+S+ IT+G +     IS+LG
Sbjct: 297 KLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLG 356

Query: 370 TVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIVPDQELIA 429
           TVPKGL+   V K+P G+                       KSFGRVNDYKI P+QE+IA
Sbjct: 357 TVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIA 416

Query: 430 IGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGAFYYIPK 489
           IGV+NL+GTFF AYPATGSFSRSALKAKC+V TPLSG+FS ACVLLA+YCLTGAF+YIPK
Sbjct: 417 IGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPK 476

Query: 490 ATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYFAICFSCA 549
           ATLSAVIIHAV DL+ASY TT + +KMN  DF+ FITTVFITVFSSIE GIYFA+C+SCA
Sbjct: 477 ATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCA 536

Query: 550 QLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDSV-KNRLDQ 608
            L++ N FP G FLG I+IAEV+NP +  +D     + + S   E    D+SV +++L  
Sbjct: 537 ILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAEDKLGT 596

Query: 609 NENPXXXXXX-XXXXXXXXXXXNSKT-TNLSYYVRWVPMKNDYHREVNPLIKITPPPPGI 666
           + N                   N +T +++ YY +WVP  + Y +E+NP ++ITPPPPG+
Sbjct: 597 SSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPPGV 656

Query: 667 IVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECP------ 720
           IVYR  DS+TY+NCSRHYD+I+DE+K+ TR+G    ++ K DRPWND GEWE P      
Sbjct: 657 IVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLKKFF 716

Query: 721 KSXXXXXXXXXXXTDIGGDEDKDGNEAIESNS--KANNTDNKPELKIICFDFSQVVQTDA 778
                        TD+   E+++  E I      K N+ D +P L+++C DFSQV  TDA
Sbjct: 717 NVKKFVSVFKRKVTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANTDA 776

Query: 779 TAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQS 838
           TA+QSL DLRKAVN+Y+++Q+E+HF GI S W+K+ L  +GFGT N+ YSD+SII GH S
Sbjct: 777 TALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGHSS 836

Query: 839 YHVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
           YH+S+    E    N+++    Q +      +   +GTN PFFH+DIPDFS W++
Sbjct: 837 YHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/921 (52%), Positives = 604/921 (65%), Gaps = 84/921 (9%)

Query: 5   INGSIDLERFELEYDHGKRGDDTHDRVEA--------RDLYSKVDIEEVTFQCDNYSGR- 55
           ++ + DL+  ELEYD  K  D+ H +           R+  + V +EE + +  N     
Sbjct: 31  VSSTPDLDNLELEYDQYK-ADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNIPSAS 89

Query: 56  --------LDVNSSLSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPH 107
                    + + +  IP Y E  VT  +F+   +   F++     Y+ S+FP++ WLPH
Sbjct: 90  IEELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIHWLPH 149

Query: 108 YNLDWLIQDLIAGITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCI 167
           YN+ W IQDLIAGITVGCVLVPQSMSYAQIATL PQYGLYSSFIGAFIYS FATSKDVCI
Sbjct: 150 YNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSKDVCI 209

Query: 168 GPVAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEF 227
           GPVAVMSL+TAK+I RV      D                 CG I+ G+GFLRLGFL+E 
Sbjct: 210 GPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALL--CGGIAAGVGFLRLGFLVEL 267

Query: 228 ISLNAVAGFMTGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGL 287
           ISLNAVAGFMTGSA NII GQVPALMGY K VNTR +TY+V++NTLKHLPDTKLDAVFGL
Sbjct: 268 ISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVFGL 327

Query: 288 IPLSILYLCKWFFSSLGPQYLNKL---SNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVI 344
           IPL ILY  +W+ +  GP+  ++     +R N   ++         ++FY+ A R+G++I
Sbjct: 328 IPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKK---------FYFYAQASRSGIII 378

Query: 345 IVFTAISWAITRGKSSTSVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXX 404
           IVFTAISW+ITR   S    ISILGTVPKGLK+V   KVP  L  K              
Sbjct: 379 IVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLL 438

Query: 405 XXXXXXKSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPL 464
                 KSFGR+NDYK+VPDQELIAIGVTNLIGTFF AYP TGSFSRSALKAKC+VKTPL
Sbjct: 439 EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPL 498

Query: 465 SGLFSGACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCF 524
           SGLF+G+CVLLALYCLTGAF+YIPKATLSAVIIH+VSDL+ASY TT NFYKMNPLDFVCF
Sbjct: 499 SGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCF 558

Query: 525 ITTVFITVFSSIEYGIYFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLN-PTLSTNDYTI 583
           +TT+ ITVFSSIE GIYFAIC+SCA L+FK  FP G FLG ++IAEV++   ++ N   +
Sbjct: 559 LTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVM 618

Query: 584 LLDDSSSVLG--EENTKDDS-------VKNRLDQNENPXXXXXXXXXXXXXXXXXNSKTT 634
             DD  S  G  +E +KD         VK++LD   +                  +    
Sbjct: 619 TTDDCVSEFGGNKEFSKDKLNGKSDFIVKDKLDSTAS----------------SSSIAEN 662

Query: 635 NLSYYVRWVPMKNDYHREVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKN 694
            L YY +WVP  + Y RE+NP + I PPPPG+IVYR  DS+TY+N S HYDII DE+K+ 
Sbjct: 663 KLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRV 722

Query: 695 TRKGISNVYKRKQDRPWNDVGEWECPKSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKA 754
           TR+G    +++K DRPWND GEW+ PK                 ++ K+    +ES    
Sbjct: 723 TRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHWRK-------NKKKNQTADVESLETG 775

Query: 755 NNTDNKPELKIICFDFSQVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKS 814
              D +P LK++C DFSQV Q D+T++QSL DLRKAVN Y+++Q+E+HF+GIIS W+K+ 
Sbjct: 776 IVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWIKRG 835

Query: 815 LIEMGFGTVNDNYSDKSIIIGHQSYHVSK--INNQEDGLENQINEKYLQPDGSYIYHIQT 872
           L+++GFGTVN+ +SD+SII GH SYH+ K  I + E+G                 Y ++T
Sbjct: 836 LVKIGFGTVNEEFSDESIIAGHSSYHLVKNTIGDIENG-----------------YQVKT 878

Query: 873 VTGTNYPFFHIDIPDFSNWEL 893
            TGTN PFFHIDIPDF  W++
Sbjct: 879 ATGTNLPFFHIDIPDFKKWDI 899

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/831 (55%), Positives = 573/831 (68%), Gaps = 42/831 (5%)

Query: 63  SIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGIT 122
           SIP Y E  VT+KD+Y   I D  ++     YL SLFP++KWLPHYN  W   DL+AGIT
Sbjct: 75  SIPAYEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKWLPHYNFTWGYADLVAGIT 134

Query: 123 VGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIE 182
           VGCVLVPQSMSYAQIA+L+P+YGLYSSFIGAFIYS FATSKDVCIGPVAVMSLQTAKVI 
Sbjct: 135 VGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA 194

Query: 183 RVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAF 242
            V      D Q               CG+++TG+G LRLGFL+E ISLNAVAGFMTGSAF
Sbjct: 195 EVLKKYPED-QVEVTGPIIATTLCLLCGLVATGLGVLRLGFLVELISLNAVAGFMTGSAF 253

Query: 243 NIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSS 302
           +II GQ+PALMGYNK VNTR +TY+VVINTLKHLP+TKLDAVFGLIPL ILYL KW+  S
Sbjct: 254 SIIWGQIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYLWKWWCGS 313

Query: 303 LGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTS 362
            G     KL +R      Q K    + +++FY+ AMRN VVIIVFTAIS+ ITR KS   
Sbjct: 314 FGI----KLVDRH--YSNQPKTANRIKSFYFYAQAMRNAVVIIVFTAISFRITRNKSKEK 367

Query: 363 VPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIV 422
            PISILGTVP GL EV V K+P GL                       KSFGR+NDYK++
Sbjct: 368 RPISILGTVPSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVI 427

Query: 423 PDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTG 482
           PDQELIAIGVTNLIGTFF +YPATGSFSRSALKAKC+V+TP SG+F+GACVLLALYCLT 
Sbjct: 428 PDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGACVLLALYCLTS 487

Query: 483 AFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYF 542
           AF+YIPKATLSAVIIHAVSDLLASY+TT NF+KMNPLD + FI TV ITVFSSIE GIYF
Sbjct: 488 AFFYIPKATLSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVLITVFSSIENGIYF 547

Query: 543 AICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDSV 602
           A+C+SCA L+ K  FP G FLG +++AEVLNPT+  +  +I+  + S      N     V
Sbjct: 548 AMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTIQGHIDSIVSPNES-----PNEFSKQV 602

Query: 603 KNRLDQNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKNDYHREVNPLIKITPP 662
           K+ +D                         ++   + V+WVP  + Y RE+N   ++ PP
Sbjct: 603 KSSVDA----------------------LPSSEYKFSVKWVPFDHAYTRELNSYTRVRPP 640

Query: 663 PPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECPKS 722
           PPG+IVYRF DSFTY+NCSRHYD+I+D +K+ TR+G     ++K DRPWND GEW+ P S
Sbjct: 641 PPGVIVYRFSDSFTYVNCSRHYDVIFDRIKEETRRGQLVSLRKKSDRPWNDPGEWKLPNS 700

Query: 723 XXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATAIQ 782
                          G   K+      +++  + +  KP LK++C DFSQV Q D+TA+Q
Sbjct: 701 FKNIFRVKR------GLATKNSELPAVNDNTNSESYEKPLLKVVCLDFSQVAQVDSTAVQ 754

Query: 783 SLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYHVS 842
           SL DLRKAVN+Y+++Q+E+HF+GIIS W+K+SL+ + FGT+N+ +SD SII GH S+H++
Sbjct: 755 SLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTINEEFSDTSIITGHSSFHIA 814

Query: 843 KINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
           K+   +D ++    +  +    S    +   TGTN PFFHIDIPDFS W++
Sbjct: 815 KV--LKDEVDYTDEDSPISVTCSNYDTLCAATGTNLPFFHIDIPDFSKWDV 863

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/830 (56%), Positives = 567/830 (68%), Gaps = 65/830 (7%)

Query: 64  IPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITV 123
           +P Y E  +TI D+Y   +  YF+   I  Y+ SLFP+  WLPHYNL W I DLIAGITV
Sbjct: 70  VPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLPHYNLTWFISDLIAGITV 129

Query: 124 GCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIER 183
           GCVLVPQSMSYAQIATL+PQ+GLYSSFIGAF YS FATSKDVCIGPVAVMSLQTAKVI R
Sbjct: 130 GCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVCIGPVAVMSLQTAKVIAR 189

Query: 184 VTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFN 243
           V   L +D                 CGII+TG+G LRLGFL+E ISLNAVAGFMTGSA N
Sbjct: 190 VQDKLPSDTDITASEIATTLALL--CGIIATGVGLLRLGFLVELISLNAVAGFMTGSALN 247

Query: 244 IICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSL 303
           II GQVP LMGYN +VNTR STY+V+I+TLKHLPDTKLDAVFGLIPL +L+  KW    L
Sbjct: 248 IISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLIPLFLLFAWKWVCDVL 307

Query: 304 GPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTSV 363
           GP+ LN+         R  +I+K   N++FY+   +N ++IIVFT ISWAITRGK+S + 
Sbjct: 308 GPR-LNERHFGNGKNPRAHRIMK---NFYFYAQTTKNAIIIIVFTCISWAITRGKTSETR 363

Query: 364 PISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIVP 423
           PIS+LG+VPKGLK+V  F VP GL  K                    KSFGR+NDYKIVP
Sbjct: 364 PISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKSFGRINDYKIVP 423

Query: 424 DQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGA 483
           DQE++AIG+TNL+GTFF AYPATGSFSRSALKAKC+V+TPLSGLFSGACVLLALYCLTGA
Sbjct: 424 DQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGACVLLALYCLTGA 483

Query: 484 FYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYFA 543
           F+YIPKATL AVIIHAVS+L+ASYK T+NF+KMNPLD  CF+ TV ITVF+SIE GIYFA
Sbjct: 484 FFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITVFASIEDGIYFA 543

Query: 544 ICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDSVK 603
           +C+S A L+FK  FP G FLG I+I EVL+  L  +   +   D +S +        SV+
Sbjct: 544 MCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDENSEILPTTKAGYSVE 603

Query: 604 NRLDQNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKNDYHREVNPLIKITPPP 663
              + NEN                      TN  YY +WVP    Y +E+NP   I PPP
Sbjct: 604 VVSNHNEN----------------------TN--YYTKWVPFDFSYTKELNPDAHIKPPP 639

Query: 664 PGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECPKSX 723
           PG+IVYR  DSFTY+NCSRH+DI++DE+K++T++G      RK DRPWND G+WE P+  
Sbjct: 640 PGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWE-PRVF 698

Query: 724 XXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATAIQS 783
                          DED   N  IE        D++P LKIIC DFSQV Q DATAIQ 
Sbjct: 699 IKKYLRRENY-----DED---NVDIEDRV----IDDRPFLKIICLDFSQVSQIDATAIQC 746

Query: 784 LNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYHVSK 843
           L DLRK+VN+Y+++Q+E+HF GIIS W+KKSL   GFGT+N+ YSD+SII+GH SYH++K
Sbjct: 747 LYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTK 806

Query: 844 INNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
                DG                   I+  TGTN PFFHIDIP+F+ W++
Sbjct: 807 ---DVDG-------------------IKAATGTNLPFFHIDIPNFNKWDI 834

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score =  911 bits (2355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/899 (52%), Positives = 594/899 (66%), Gaps = 39/899 (4%)

Query: 8   SIDLERFELEYDHGKRGDDTHDRVEARDLYSKVDIEEVTFQCDNYSG---------RLDV 58
           S +L   ELEYD  K  +  +      DL  + +  +V F     +G         ++ +
Sbjct: 33  SQNLADLELEYDQYKASETNNKSNHGPDL--ETNNLDVQFSNTYNTGDKKNSIKNHQIQI 90

Query: 59  NS----SLSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLI 114
           N+    S+ IP + E  ++ KD+Y   + + FS+  + +Y  S+FP+++WLPHYNL W  
Sbjct: 91  NTFNADSVIIPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSIFPIIRWLPHYNLAWFS 150

Query: 115 QDLIAGITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMS 174
            DLIAGITVGCVLVPQSMSYAQIATL PQYGLYSSFIGAF YS FATSKDVCIGPVAVMS
Sbjct: 151 SDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSLFATSKDVCIGPVAVMS 210

Query: 175 LQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVA 234
           L+T KVI +V +    +                 CG+I+ GIGFLRLGFL+E ISLNAV 
Sbjct: 211 LETGKVITKVLAKY-PEADPNITAPVIATVLAFLCGVITAGIGFLRLGFLVELISLNAVT 269

Query: 235 GFMTGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILY 294
           GFMTGSA NI+ GQ+PALMGY  KVNTR STY+V+I +LKHLPDTKLDAVFGLIPL ILY
Sbjct: 270 GFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDTKLDAVFGLIPLFILY 329

Query: 295 LCKWFFSSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAI 354
           L KW+  ++GP+  +K            K   YL  ++FY+ A +N V+IIVFTAI+W+I
Sbjct: 330 LWKWWCGNMGPRMADKW------FANNEKGNFYLKKFYFYAQAAKNAVIIIVFTAIAWSI 383

Query: 355 TRGKSSTSVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFG 414
           T+GK+    PISILG+VPKGLKEV V K+P GL  K                    KSFG
Sbjct: 384 TKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLEHIAIAKSFG 443

Query: 415 RVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVL 474
           R+NDYK+VPDQELIAIGVTNLIGTFF AYPATGSFSRSALKAKC+V+TPLSGLF+G+CVL
Sbjct: 444 RINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGLFTGSCVL 503

Query: 475 LALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFS 534
           LALYCLTG F YIPKATLSAVIIHAVSDL+ASY TT NF+KMNPLD   FI TVFITVFS
Sbjct: 504 LALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCFSFIVTVFITVFS 563

Query: 535 SIEYGIYFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGE 594
           SIE GIYFA+C+SCA L+ K  FP G FLG ++IAEV+N  +   D +  + D SS    
Sbjct: 564 SIENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCV---DDSFEVTDYSSNSNL 620

Query: 595 ENTKDDSVKNRLDQNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKNDYHREVN 654
             + D    N+  +  +                    K + + YY +W+P  + Y +E+N
Sbjct: 621 SLSADTINHNKKLKILHIPLLKTLKDQLFSDISSIQGK-SKIRYYTKWLPFDHAYTKELN 679

Query: 655 PLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDV 714
           P + I PPPPG+IVYR  DSFTY+NCS+HYD+I++E+KK T++G    +++K DRPWND 
Sbjct: 680 PNVIILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIRHRKKSDRPWNDP 739

Query: 715 GEWECPKSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVV 774
           GEWE P                    + D  E    +   +  D++P LK++C DFSQV 
Sbjct: 740 GEWEAPNFSKLWKKLSFRR----NKNNNDNEETHIPDVPVSKRDDRPLLKVLCLDFSQVA 795

Query: 775 QTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIII 834
           Q DATA+QSL DLRKA+N+Y+++Q+E+HF+GI+S W+KK LI +GFGT+N+ YSD+SII 
Sbjct: 796 QVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINEEYSDESIIA 855

Query: 835 GHQSYHVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
           GH SYH+++I   +  L                Y + T TGTN PFFHIDIPDF  W++
Sbjct: 856 GHTSYHLARIPGDDLELPTMRGGN---------YKVYTATGTNLPFFHIDIPDFYQWDV 905

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score =  906 bits (2341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/918 (52%), Positives = 606/918 (66%), Gaps = 53/918 (5%)

Query: 4   SINGSIDLERFELEYDHGKRGDD--------------THDRVEARDLYSKVDIEEVTFQC 49
           S + ++DLE  E EYD  K+ ++               +  V +   Y +    +   Q 
Sbjct: 25  SNSNTVDLEALEEEYDQYKKEEEIEYISGNYLNSSPTQNINVTSNPKYEEYKKLKHLDQS 84

Query: 50  DNYSGRLDVNSSLSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYN 109
            NY     +++   IP +NE  +T K++Y   + +YF+      Y  S+FP++ WLP YN
Sbjct: 85  YNYVSTEYLDTDYLIPAHNENIITFKEYYNHSLKEYFTFNAAKNYALSIFPIIHWLPFYN 144

Query: 110 LDWLIQDLIAGITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGP 169
            +W I DLIAGIT+GCVLVPQSMSYAQIATL PQYGLYSSFIGAF+Y+ FATSKDVCIGP
Sbjct: 145 FNWFISDLIAGITIGCVLVPQSMSYAQIATLDPQYGLYSSFIGAFVYALFATSKDVCIGP 204

Query: 170 VAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFIS 229
           VAVMSL+TAKVI  V+S    D                 CG I+  +GFLRLGFL+E IS
Sbjct: 205 VAVMSLETAKVIADVSSHFQNDPDVTGPIIATTLALL--CGGIAAAVGFLRLGFLVELIS 262

Query: 230 LNAVAGFMTGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIP 289
           LNAV GFMTGSAFNI+ GQVP LMGY+K VNTR +TY+VVI+TLKHLPDTKLDAVFGLIP
Sbjct: 263 LNAVTGFMTGSAFNILWGQVPGLMGYSKLVNTRQATYKVVIDTLKHLPDTKLDAVFGLIP 322

Query: 290 LSILYLCKWFFSSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTA 349
           L ILY+ KW+ ++ G Q   K   + +  ER R    YL  ++FY+NAMRN VVII+FTA
Sbjct: 323 LFILYVVKWWCTNYGLQLAEK---QFSSNERYRF---YLKKFYFYTNAMRNAVVIIIFTA 376

Query: 350 ISWAITRGKSSTSVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXX 409
           ISW+ITR KSS+  PI++LGTVP GLK++ VFK    + +K                   
Sbjct: 377 ISWSITRNKSSSERPITVLGTVPSGLKDIGVFKPQTKIVQKIGPQLPASIIVLLLEHIAI 436

Query: 410 XKSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFS 469
            KSFGR+NDYKIVPDQELIAIG++NL+GTFF AYPATGSFSRSAL AKC+VKTPLSG+F+
Sbjct: 437 AKSFGRINDYKIVPDQELIAIGISNLVGTFFSAYPATGSFSRSALNAKCNVKTPLSGIFT 496

Query: 470 GACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVF 529
           G CVLLALYCLTGAF+YIPKATLSAVIIHAVSDL+ASY+TTL+F+ MNPLD +CF+ TV 
Sbjct: 497 GGCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLIASYQTTLSFWNMNPLDTLCFLVTVL 556

Query: 530 ITVFSSIEYGIYFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSS 589
           ITVFSSIE GIYFA+C+SCA  IF++ FP G FLG I+IAEV+N T   +D+ +   +  
Sbjct: 557 ITVFSSIENGIYFAMCYSCALFIFRSAFPAGKFLGRIEIAEVINAT-PKDDFQMDNFNGF 615

Query: 590 SVLGEENTKDDSVKNRLD-QNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKND 648
                 N   D    + D  N+N                  NS   + ++Y +WVP  + 
Sbjct: 616 ETSEYNNFPADQSYGKFDIANKN--------------THKYNSPHCSKNFYTKWVPFDHT 661

Query: 649 YHREVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKG--ISNVYKRK 706
           Y +E+N  ++I  PPPG+IVYR  DSF YLNCSRH+D I+DEVK+ T++G  I N+  +K
Sbjct: 662 YTKELNKDVEILEPPPGVIVYRLSDSFIYLNCSRHFDTIFDEVKRKTKRGKFIGNI--KK 719

Query: 707 QDRPWNDVGEWECPKSXXXXXXXXXXXTDIGGDEDKDGNEAIE-----SNSKANNTDNKP 761
             RPWND GEWE P                   E    NE        SN+K  + D++P
Sbjct: 720 SQRPWNDPGEWEAPTWMTKKFSIRNLFKRKQEAESNVPNEDASTDLDISNNKDIDMDHRP 779

Query: 762 ELKIICFDFSQVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFG 821
            L++IC DFSQV QTD TA+QSL DLRK+VN Y+++Q+E+HF GIIS WVK+ LI++GFG
Sbjct: 780 VLQVICLDFSQVSQTDNTALQSLFDLRKSVNSYADRQVEFHFCGIISPWVKRGLIKLGFG 839

Query: 822 TVNDNYSDKSIIIGHQSYHVSK---INNQ---EDGLENQINEKYLQPDGSYIYHIQTVTG 875
           TVN+ YSD S I+GH SYH+ K     N+       E+ I++  ++      Y I+  +G
Sbjct: 840 TVNEAYSDASTIVGHVSYHIVKNPTFRNKSFSSHTSEDTISDMNIEAKDYNNYSIEAASG 899

Query: 876 TNYPFFHIDIPDFSNWEL 893
           TNYPFFHIDIP+FS W++
Sbjct: 900 TNYPFFHIDIPNFSKWDV 917

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/894 (52%), Positives = 598/894 (66%), Gaps = 67/894 (7%)

Query: 10  DLERFELEYDHGKRGDDTHDRVEARDLYSKVDIEEVTFQCDNYSGRLDVNSSLS------ 63
           +L+  E EYD+ K  +   +  E  D+     +   T Q D    + D  +++       
Sbjct: 26  NLDDLEAEYDNYKNAE--QNPREKSDVVET--LPPTTHQNDAKGLKNDGQTTVELYGTTS 81

Query: 64  ----IPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIA 119
               IP Y+E  V  KD+Y + ++   S     +YL SLFP+++W+PHYN  W+  D++A
Sbjct: 82  SGGVIPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWIPHYNFAWMYGDVVA 141

Query: 120 GITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAK 179
           G+TVGCVLVPQSMSYAQIA+L  QYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSL+TAK
Sbjct: 142 GVTVGCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAK 201

Query: 180 VIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTG 239
           VI RVT  L  D +               CG I+ GIG LRLGFL+E ISLNAVAGFMTG
Sbjct: 202 VIARVTEHLPDDTEITGPIIATALSLL--CGAITLGIGVLRLGFLVELISLNAVAGFMTG 259

Query: 240 SAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWF 299
           SAF+II GQ+PALMGYN+KVNTR +TY+VVINTLKHLPDTKLDAVFGLIPL ILYL K+ 
Sbjct: 260 SAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYG 319

Query: 300 FSSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKS 359
            +++GP ++++  N  +         K+  ++FFY+ A+RN  VI++FT I+W ITR K 
Sbjct: 320 CNTIGPNWVDRRMNPHSPRA------KFWKSFFFYAQALRNAFVIVLFTLIAWGITRHKK 373

Query: 360 STSVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDY 419
               PIS+L TVP GLK V V K P  L                       K+FGR+NDY
Sbjct: 374 KH--PISLLNTVPSGLKNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIAKAFGRINDY 431

Query: 420 KIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYC 479
           K+VPDQELIAIGVTNL+GTFF AYPATGSFSRSALKAKC+V+TPLSG+F+GACVLLALYC
Sbjct: 432 KVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYC 491

Query: 480 LTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYG 539
           LT AFYYIPKATLSAVIIHAVSDL+ASY+TT NF+KMNPLD +CF+ TVFIT+FSSIE G
Sbjct: 492 LTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENG 551

Query: 540 IYFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKD 599
           IYFAIC+SCA L+FK  FP G FLG ++++EV+NPT+   D  ++ D  S    E     
Sbjct: 552 IYFAICWSCAILLFKIAFPSGKFLGRVEVSEVINPTVR-EDLGVVEDFDS----ENINVA 606

Query: 600 DSVKNRLDQNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKNDYHREVNPLIKI 659
            S K +L  + +                  ++  + + ++ +W+P++N+Y RE N  I +
Sbjct: 607 SSTKPKLGLSAD--------------NSSISTGPSRVRFHTKWIPLENNYGREYNSGIVV 652

Query: 660 TPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWEC 719
            PPPPG+IVYR  +S+TY+NCSR YDII+DEVK+ TR+GI   + +K DRPWND G+WE 
Sbjct: 653 QPPPPGVIVYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEP 712

Query: 720 PKSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDAT 779
           P                     K G    +  S     D +P LKI+  D+SQV Q DAT
Sbjct: 713 PLFLKKLF--------------KRGKRLEQELSPELGRDERPVLKILAMDWSQVTQIDAT 758

Query: 780 AIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSY 839
            +Q+L DLRKA+N+Y+++Q+E+HFSGIIS W+K++L+ +GFGTVND ++D+S+I+GH SY
Sbjct: 759 GVQNLVDLRKAINKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSY 818

Query: 840 HVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
           H+ K   Q++  EN I        G   Y+I   +GTN PFFH+++PDFS W L
Sbjct: 819 HIVKTRPQDE--ENHI--------GQGRYNISAASGTNMPFFHVEMPDFSKWSL 862

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/916 (52%), Positives = 592/916 (64%), Gaps = 86/916 (9%)

Query: 10  DLERFELEYDHGKRGD----------------DTHDRVEARDLYSKVDIEEVTFQ-CDNY 52
           D ++ E EYD  K  +                  H   E R L S +D     F+  DN 
Sbjct: 30  DFDQLEQEYDDLKTSEIIAPHISNGHSISSSPRHHHLYEDRHLDSIIDTNTHGFKKHDNG 89

Query: 53  SGRL-DVN-------SSLSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKW 104
           +G+  DVN        SL +P Y E  V  K  Y EK+  Y +   IV+YLTSLFPLLKW
Sbjct: 90  NGKFADVNIEQIYNYDSLRVPNYEETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLLKW 149

Query: 105 LPHYNLDWLIQDLIAGITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKD 164
           + HYN +WL  DL+AGITVGCVLVPQSMSYAQIATL  QYGLYSSF+GAFIYSFFATSKD
Sbjct: 150 VHHYNFNWLYNDLVAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATSKD 209

Query: 165 VCIGPVAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFL 224
           VCIGPVAVMSL+TAKVI RV   +  D                 CG ++ G+G LRLGFL
Sbjct: 210 VCIGPVAVMSLETAKVIARVLEKVGEDNPEITAPIIATTLSLI-CGGVALGVGLLRLGFL 268

Query: 225 IEFISLNAVAGFMTGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAV 284
           +EFISLNAVAGFMTGSA NI+ GQVP LMGY+K VNTR STY+V+INTLKHLPDTKLDAV
Sbjct: 269 VEFISLNAVAGFMTGSAINIMSGQVPGLMGYSKNVNTRDSTYKVIINTLKHLPDTKLDAV 328

Query: 285 FGLIPLSILYLCKWFFSSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVI 344
           FGLIPL ILY  K+F  +LGP+ +++   R ++  ++    KY+    FY  A+RN  VI
Sbjct: 329 FGLIPLFILYSWKYFCGTLGPKLVDRYVARSDV--KRAAAYKYI---LFYLQALRNAFVI 383

Query: 345 IVFTAISWAITRGKSSTSVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXX 404
           I+FT ISW ITR K+   +PIS+LGTVP GLK V V K+P GL                 
Sbjct: 384 IIFTLISWGITRHKAKEDLPISLLGTVPSGLKNVGVMKLPDGLVSNLASELPSAIIILVL 443

Query: 405 XXXXXXKSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPL 464
                 K+FGRVN YK+VPDQELIAIGVTNLI TFF AYPATGSFSRSALKAKC+VKTPL
Sbjct: 444 EHIAISKAFGRVNGYKVVPDQELIAIGVTNLISTFFNAYPATGSFSRSALKAKCNVKTPL 503

Query: 465 SGLFSGACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCF 524
           SG+F+GACVLL+LYCLT AFY+IPKA LSA+IIHAVSDL+ASYKTT NF+ MNPLDFVCF
Sbjct: 504 SGIFTGACVLLSLYCLTDAFYFIPKAALSAIIIHAVSDLVASYKTTWNFWLMNPLDFVCF 563

Query: 525 ITTVFITVFSSIEYGIYFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTN-DYTI 583
           I TV IT+FSSIE GIYFA+C+SCA L+ K +FP G FLGY++I +V N  +  N D  +
Sbjct: 564 IVTVIITIFSSIENGIYFAVCWSCALLLLKVVFPTGQFLGYVEICQVSNAEVDENIDRIV 623

Query: 584 LLDDSSSVLGEEN-TKDD-SVKNRLDQNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVR 641
           L +DS     E+N TK++ +VK  +  NE                   +   + L Y+ +
Sbjct: 624 LSEDSQPKTIEDNVTKNNTAVKVGVVANE-------------------SFGHSQLQYHTK 664

Query: 642 WVPMKNDYHREVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISN 701
           W+P+ N Y RE+NP + +  PPPG+IVYR  +S+TY+NCSR YD I+D VK+ TR G   
Sbjct: 665 WLPLNNHYQRELNPDVVVQAPPPGVIVYRPSESWTYVNCSRQYDTIFDRVKELTRPGKLL 724

Query: 702 VYKRKQDRPWNDVGEWECPKSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKP 761
            +  K D+ WND GEWE P               +G   D +G E I         D +P
Sbjct: 725 KHVSKHDKMWNDPGEWEPP-------FLVKKLFKLGNKHDLEGGEVI---------DERP 768

Query: 762 ELKIICFDFSQVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFG 821
            LKI+  D+SQV Q D+T +Q+L DLRKA+N+Y+N+Q+E+HFSGIIS W+K+SLI  GFG
Sbjct: 769 VLKILAMDWSQVTQIDSTGVQNLVDLRKAINKYANRQVEFHFSGIISPWIKRSLINAGFG 828

Query: 822 TVNDNYSDKSIIIGHQSYHVSK----INNQEDGLENQINEKYLQPDGSYIYHIQTVTGTN 877
           TVN+ +SD+SII+GH SY + K    + + E  L   I              + T  G N
Sbjct: 829 TVNEEFSDESIIVGHTSYSLVKNRPDLQDPEAALPEPIA-------------LHTALGVN 875

Query: 878 YPFFHIDIPDFSNWEL 893
            PFFH+++P+F  W L
Sbjct: 876 LPFFHLEMPEFHKWHL 891

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/900 (52%), Positives = 588/900 (65%), Gaps = 44/900 (4%)

Query: 10  DLERFELEYDHGKRGDDTHDRVEAR--DLY------SKVDIEEVTFQCDNYSGRLD--VN 59
           +L+  E EYD  K  +D  +RV  R  D Y       KVD +E   +  N +      + 
Sbjct: 35  NLDDLEQEYDQYKAAED-RERVVGRGDDEYDDDLRKGKVDYKETELEYWNSTNGTTNLLA 93

Query: 60  SSLSIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIA 119
              ++P Y E  V   D +Y  + D  ++G +  Y  S FP++KWLP YN  W   DL+A
Sbjct: 94  PKATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFESAFPIIKWLPFYNWKWGYADLVA 153

Query: 120 GITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAK 179
           GITVGCVLVPQSMSYAQIATL PQYGLYSSF+GAFIYSFFATSKDVCIGPVAVMSL+TAK
Sbjct: 154 GITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAK 213

Query: 180 VIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTG 239
           VI+         E                CGI++ G G LRLGFL+E ISLNAVAGFMTG
Sbjct: 214 VIQETLEKF-PKEDHEVTGPLIATALALLCGIVAMGAGVLRLGFLVELISLNAVAGFMTG 272

Query: 240 SAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWF 299
           S+ NII GQVPALMG+ K V+TR STY+++IN+LK+L  T+LDAVFGLIPL +LY  KW+
Sbjct: 273 SSLNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKHTQLDAVFGLIPLVLLYTWKWW 332

Query: 300 FSSLGPQYLNKLSNRR-NLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGK 358
            SS GP    KL++R      ++R I+K    ++FY+ AMR+ V+IIVFTAIS+ IT+G+
Sbjct: 333 CSSYGP----KLADRHFKNNPKKRDILK---TFYFYAQAMRSAVIIIVFTAISYGITKGR 385

Query: 359 SSTSVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVND 418
            +    IS+LG VPKGLK+V V ++P GL  K                    KSFGRVN+
Sbjct: 386 KTPR--ISVLGKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIILLLEHISIAKSFGRVNN 443

Query: 419 YKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALY 478
           YK+VPDQELIAIG TNLIGTFF AYPATGSFSRSALKAKC+V+TPLSG+FSGACVLLALY
Sbjct: 444 YKVVPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFSGACVLLALY 503

Query: 479 CLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEY 538
           CLT  FYYIP ATLSAVIIHAVSDL ASYKT+ NFYKMNP DF+ FI TVFITVFSSI+Y
Sbjct: 504 CLTQTFYYIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAFIVTVFITVFSSIDY 563

Query: 539 GIYFAICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLG-EENT 597
           GIYFA+C+S A  + KNMF  G FLG +++AEV+N  +  N  ++     S + G +  +
Sbjct: 564 GIYFAMCWSAAMFLLKNMFAPGRFLGRVEVAEVVNAQVDPNVESVSESAGSHLDGFQAQS 623

Query: 598 KDDSVKNRLDQNENPXXXXXXXXXX--XXXXXXXNSKTTNLSYYVRWVPMKNDYHREVNP 655
             +S   +LD  +                     N     L Y+ +W+     Y RE NP
Sbjct: 624 SIESSSKKLDPLDKSAVHSNYLNGGDDGSDNNINNQIGQKLVYHTKWISYDRSYSREFNP 683

Query: 656 LIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVG 715
            + I PPPPG+IVYRFGDS+TYLNCSRHYDIIYDEV++ TR+G      +K DRPWND G
Sbjct: 684 EVPIQPPPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRGQMISAVKKVDRPWNDPG 743

Query: 716 EWECPKSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANN-TDNKPELKIICFDFSQVV 774
           EWE P+                  E+    EA ES +      DN+P LKIIC DFSQ  
Sbjct: 744 EWEAPRWFKKLTSKKKTA------EEWAETEAQESKAAEQKLQDNRPLLKIICLDFSQCS 797

Query: 775 QTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIII 834
           QTDATAIQ+L DLRK VNRY+++Q+E+H  G+ + WVK++L+  GFGTVN+ YSD+S++ 
Sbjct: 798 QTDATAIQNLTDLRKQVNRYADRQVEFHICGLYAPWVKRALVNFGFGTVNEEYSDESLLA 857

Query: 835 GHQSYHVSKI-NNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
           GH+SYHV++   + EDGL +              Y +   +GTN PFFH++IPDFS W+L
Sbjct: 858 GHRSYHVARAPTSLEDGLGSPAQ-----------YSVYPASGTNLPFFHVEIPDFSKWDL 906

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/841 (51%), Positives = 555/841 (65%), Gaps = 57/841 (6%)

Query: 67  YNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCV 126
           ++E+PVT+ +FY + +   F++     YL SL P+++WLPHYN  WL QDL+AGITVGCV
Sbjct: 101 FHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGITVGCV 160

Query: 127 LVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERVTS 186
           LVPQSMSYAQIATL+PQYGLYSSF+GAFIYSFFATSKDVCIGPVAVMSLQTAK I  V S
Sbjct: 161 LVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAISHVVS 220

Query: 187 GLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNIIC 246
            L  D +               CGIIS G+G LRLGFL+E IS  AVAGFMTGSA NII 
Sbjct: 221 SLPEDTEITSPMIATALALL--CGIISLGLGVLRLGFLVELISSTAVAGFMTGSALNIIA 278

Query: 247 GQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSLGPQ 306
           GQVPALMGYNK VNTR STY+V+IN+L+HLPDTKLDAVFGL+PL ILY+ KW  S+ GP+
Sbjct: 279 GQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTGGPR 338

Query: 307 YLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRG--KSSTSVP 364
            + +  +RR+         +   N F Y+ A+RN VVI+VFTAI+W ++    K   S  
Sbjct: 339 LVQRYGSRRS---------RMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSAR 389

Query: 365 ISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIVPD 424
           IS+LGTVP GLK+V V KVP GL  K                    K+FGRVNDY++VPD
Sbjct: 390 ISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPD 449

Query: 425 QELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGAF 484
           QELIAIG TNLIGTFF AYPATGSFSRSALKAKC+V TPLSGLFSGACVLLA+YCLT AF
Sbjct: 450 QELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAF 509

Query: 485 YYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYFAI 544
            +IPKATLSAVIIHAVSDL+ASYKTT +F++++P D VCF+ TV ITVFSSIE GIYFA+
Sbjct: 510 KFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAM 569

Query: 545 CFSCAQLIFKNMFPVGSFLGYIKIAE--VLNPTLSTNDYTILLDDSSSVLGEENTKDD-- 600
           C+S A L+F+  FP G FLG ++IAE  V N            + + + +  E  ++   
Sbjct: 570 CWSVAVLLFRTAFPAGKFLGRVQIAEARVTNSGAGAGVGMSSGNSAGTAVNREKERETTF 629

Query: 601 ---SVKNRLDQNENPXXXXXXXXXXXXXXXXXNSKTTN------LSYYVRWVPMKNDYHR 651
              SV +    +  P                     T+        ++ +WVP  + Y R
Sbjct: 630 TAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPF-DRYTR 688

Query: 652 EVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPW 711
           E+NP + + PPPPG+IV+R  +S+TY+NCSR YD I+DEV + TR+G   +  +   RPW
Sbjct: 689 ELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSSRPW 748

Query: 712 NDVGEWECPKSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFS 771
           ND GEW  PK                    K  +E +E+ + A   D +P L++I  D+S
Sbjct: 749 NDPGEWHPPKFLRKLF--------------KSSSEDLENRAVAR--DERPVLRVIAMDWS 792

Query: 772 QVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKS 831
           QV Q D+T +Q+L DLRKAVN+Y+++Q+E+HF+GII  WVK+ LI  GFGTVND ++D+S
Sbjct: 793 QVAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADES 852

Query: 832 IIIGHQSYHVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNW 891
           +++GH+S H+++     +  E+++                  TGTN PFFH+++PDFS W
Sbjct: 853 LLVGHKSCHIARSAEPTEDEESRL--------------AHPATGTNLPFFHLELPDFSEW 898

Query: 892 E 892
           +
Sbjct: 899 D 899

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/895 (48%), Positives = 558/895 (62%), Gaps = 91/895 (10%)

Query: 10  DLERFELEYDHGKRGD------DTHDRVEARDLYSKVDIEEVTFQCDNYSGRLDVNSSLS 63
           D+E  + EYD  K G+       TH  + +R  YS             Y G L+VNS  +
Sbjct: 30  DIEALQAEYDQLKAGEVHSAQGATHGDIGSRQ-YSGSGKPAA-----QYLG-LNVNSREA 82

Query: 64  IPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITV 123
           +P Y E  V++KD+Y  K+  + S+     Y  S+FPL +W+ HYN+ W+  D++AGITV
Sbjct: 83  VPEYEETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITV 142

Query: 124 GCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIER 183
           GCVLVPQSMSYAQ+A+L+PQYGLYSSF+GAFIYSFFATSKDVCIGPVAVMSL+TAKVI R
Sbjct: 143 GCVLVPQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIAR 202

Query: 184 VTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFN 243
           VT  L  D                 CG I+  IG LRLGFL+EFIS+ AV GFMTGSA +
Sbjct: 203 VTENLPEDTNITGPIIATALTLL--CGAIAMVIGILRLGFLVEFISITAVTGFMTGSALS 260

Query: 244 IICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSL 303
           II GQVP+LMGY+KKVNTRA+TY+V+I +LKHL DT ++A FGL+PL +L+L KW   SL
Sbjct: 261 IISGQVPSLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSL 320

Query: 304 GPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTSV 363
           GP+ ++     R L  +  +  ++    FFY  A+RN V+I+VFTAISW I+R K     
Sbjct: 321 GPRLVD-----RYLQFKPSRASRW-NAAFFYLQALRNAVIIVVFTAISWGISRHKLEKP- 373

Query: 364 PISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIVP 423
           PIS+LG VP GLK V   ++P GL EK                    KSFGR+N+YK+VP
Sbjct: 374 PISLLGKVPSGLKNVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVP 433

Query: 424 DQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGA 483
           DQELIAIGVTNL  TFF AYPATGSFSRSALKAKC+VKTPLSGLF+GACVLLALYCLT A
Sbjct: 434 DQELIAIGVTNLFATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEA 493

Query: 484 FYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYFA 543
           FY+IPKATLSAVIIHAV+DL+ASYK T  F++ NPLDF  FI TV ITVFSSIE+GIYF+
Sbjct: 494 FYFIPKATLSAVIIHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIITVFSSIEHGIYFS 553

Query: 544 ICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPT--LSTNDYTILLDDSSSVLGEENTKDDS 601
           I +SCA L+ K  FP G FLGYI +AEV+ P    S N    L    +S   ++  KD  
Sbjct: 554 ISWSCAVLLCKVAFPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNSATFQQIDKDGG 613

Query: 602 VKNRLDQN-ENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKNDYHREVNPLIKIT 660
             N ++    +P                      +  ++ RW+P+ + Y RE+NP   + 
Sbjct: 614 KLNTVESVLPDP----------------------HTRFHRRWIPLDHAYSRELNPEAVVN 651

Query: 661 PPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECP 720
           PPPPG+IVYR  DS+TYLNCSRH+DII D VK++TR G    +   ++R W D G W  P
Sbjct: 652 PPPPGVIVYRPTDSWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWRPP 711

Query: 721 KSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATA 780
           +                   DK    A+         D +P L+++  D+SQV Q D+T 
Sbjct: 712 RIFRRFI------------ADKRTGSAV--------ADARPVLRVLAMDWSQVSQVDSTG 751

Query: 781 IQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYH 840
           IQ+L DLR A+N+Y+++ +E+HF+GI+S W+K++L+  GFG      +D  +I    SYH
Sbjct: 752 IQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYH 806

Query: 841 VSKINNQEDGLENQINEKYLQPDGSYIYHIQTVT---GTNYPFFHIDIPDFSNWE 892
           + +                L  D  +I H  +V    GTN PFFH+D+PDF  W 
Sbjct: 807 LVR----------------LPADPPHIVHGHSVVFALGTNTPFFHLDMPDFETWR 845

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/828 (51%), Positives = 545/828 (65%), Gaps = 50/828 (6%)

Query: 67  YNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCV 126
           Y E  VT +++Y   I    +   + QYL  L P++ WLPHYN  W  QD++AGITVGCV
Sbjct: 81  YYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQDMVAGITVGCV 140

Query: 127 LVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERVTS 186
           LVPQSMSYA IATL PQ+GLYSSF+GA IYSFFATSKDVCIGPVAVMSLQTAK + +V +
Sbjct: 141 LVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQTAKAVSKVMA 200

Query: 187 GLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNIIC 246
            L AD                 CG+IS G+G LRLGFL+E IS  AVAGFMTGSA NII 
Sbjct: 201 ELPADTDITAPVVATALAFL--CGLISLGLGVLRLGFLVELISSTAVAGFMTGSALNIIS 258

Query: 247 GQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSLGPQ 306
           GQ+PALMGYNK VNTR STY+V+I TLKHLPDTKLDAVFGLIPL +LY  KW  +S GP+
Sbjct: 259 GQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLYTWKWLCNSGGPR 318

Query: 307 YLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTSVPIS 366
            + + + R +   R+++I        FY+ A+RN V+IIVFTAI+W+I+  K     PIS
Sbjct: 319 LVERYTVRGS---RKQRI---WSATLFYTQALRNAVIIIVFTAIAWSISHHKKKA--PIS 370

Query: 367 ILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIVPDQE 426
           +LG VP GLK+V V K+P GL  K                    K+FGRVNDY++VPDQE
Sbjct: 371 LLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYRVVPDQE 430

Query: 427 LIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGAFYY 486
           LIAIG TNL+GTFF AYPATGSFSRSALKAKC+V TPLSG+FSGACVLLA+YCLT AF Y
Sbjct: 431 LIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQY 490

Query: 487 IPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYFAICF 546
           IPKATLSAVIIHAVSDL+ASYKTT + +++NPLD VCF+ TVFI VFSSIE GIYFA+C+
Sbjct: 491 IPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCW 550

Query: 547 SCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGE-ENTKDDSVKNR 605
           S A L+FK  FP   FLG ++IAE     L+TN+      + + +  + E  K  S  + 
Sbjct: 551 SVAVLLFKVAFPRAQFLGRVEIAE-----LATNEGVSAGSEFAPLSKDFEKGKGVSYASG 605

Query: 606 LDQNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKNDYHREVNPLIKITPPPPG 665
              +E+                   S      ++ +WVP +  Y RE+NP + +  PPPG
Sbjct: 606 SVSSES-FNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNPQVPVAQPPPG 663

Query: 666 IIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECPKSXXX 725
           +IV+R  +S+TY+NC+R Y+ I+DEV + TR+G   V   K  RPWND GEW  PK    
Sbjct: 664 VIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGKVQV-TSKSGRPWNDPGEWHPPKFLRK 722

Query: 726 XXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATAIQSLN 785
                             G +  ES  +   +D++P L++I  D+SQV Q D+T +Q+L+
Sbjct: 723 WF----------------GKKYSESLEQGVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLH 766

Query: 786 DLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYHVSKIN 845
           DLRKAV++Y+++Q+E+HFSGIIS W+K+ L+  GFGTVN+ ++D+S+++GH++Y V++  
Sbjct: 767 DLRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGG 826

Query: 846 NQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
              D       E+ L P        Q  TG N PFFH ++PDFS W+ 
Sbjct: 827 ATGD-------EEALLP--------QPATGVNMPFFHAEMPDFSKWDF 859

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/887 (45%), Positives = 534/887 (60%), Gaps = 56/887 (6%)

Query: 11  LERFELEYDHGKRGDDTHDRVEARDLYSKVD-IEEV--TFQCDNYSGRLDVNSSLSIPMY 67
           L+  E +Y   K  +D+     A +  S++D  + V  + Q   Y G  +       P Y
Sbjct: 40  LDELETDYTRFKTNEDSAGYSGAENERSRIDKFDSVGSSLQFAKYDG--NALPDFKAPPY 97

Query: 68  NEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCVL 127
            E  VT  ++Y   I           Y  SLFP++KW+ HYN  W+  D IAGITVGCVL
Sbjct: 98  YETTVTFMEYYDRTIRSRVGRSFFRSYFLSLFPIIKWIHHYNFAWMYSDFIAGITVGCVL 157

Query: 128 VPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERVTSG 187
           VPQSMSYAQ+A L P+YGLYSSFIGAFIYSFFATSKDVCIGPVAVMS+Q +KVI  V   
Sbjct: 158 VPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQ 217

Query: 188 LTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNIICG 247
           L   E                  I+   IG LRLGF++E IS+ AVAGFMTGSA +I+  
Sbjct: 218 LP--EGTPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALSILAS 275

Query: 248 QVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSLGPQY 307
           Q+P+L+G  +K+NTR  TY V+I+TLKHL  + ++A FGLI L++L+  KW    LGP+ 
Sbjct: 276 QLPSLLGI-QKINTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKL 334

Query: 308 LNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISW-AITRGKSSTSVPIS 366
           ++K            K  +   ++FFY+ A+RN  V+ + T +SW  I R K  TS  IS
Sbjct: 335 ISKY------LRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIGRHKKKTS--IS 386

Query: 367 ILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIVPDQE 426
           +LGTVP GLK V V  +P GL  K                    KSFGR+N+YKIVPDQE
Sbjct: 387 VLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQE 446

Query: 427 LIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGAFYY 486
           LIAIGVTNLIG+FF AYPATGSFSRSALKAKC+VKTPLSGLFSGACVLLALY LT AFYY
Sbjct: 447 LIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYY 506

Query: 487 IPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYFAICF 546
           IPKA LSAVIIHAV DL+ASYK +   +  NP D + F+ T+ +T+FSSIE GIYFA+ F
Sbjct: 507 IPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAF 566

Query: 547 SCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDSVKNRL 606
           S A L+ KN FP G FLGY+KI EV N  +  +  +I  +D    L +E +KD  +    
Sbjct: 567 SMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPE--LPQEISKDSKLAKDP 624

Query: 607 DQNENPXXXXXXXXXXXXXXXXXNSKTTNLSYYVRWVPMKNDYHREVNPLIKITPPPPGI 666
           D + +                   +   ++ ++ +WVP+ N Y RE+NP I +  PPPG+
Sbjct: 625 DVHASANLM---------------ASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGV 669

Query: 667 IVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECPKSXXXX 726
           IVYR  +S+ YLNCSR +DII D VK  TR G    + RK ++ W + G+W  P      
Sbjct: 670 IVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKF 729

Query: 727 XXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATAIQSLND 786
                          K               DN+P LKI+  D++QV   D+T+IQSL D
Sbjct: 730 F--------------KKYRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQSLID 775

Query: 787 LRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYHVSKINN 846
           LRK +NRY+++Q+ +HFSGI+S W+K++L+  GFGT+N+NYS+  +++ + +YHV + N 
Sbjct: 776 LRKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQ-NV 834

Query: 847 QEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893
                ENQ N +           +   +GTN+PFFHID+PDF+ W++
Sbjct: 835 LSADEENQQNSEISA-------SLDVASGTNFPFFHIDMPDFTKWDI 874

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  468 bits (1204), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 248/510 (48%), Positives = 329/510 (64%), Gaps = 30/510 (5%)

Query: 66  MYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITVGC 125
           +Y EK VT+ + +  ++   F+   I  YL SL P+ KW+ HYNL W I D+IAGITVGC
Sbjct: 2   VYREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGC 61

Query: 126 VLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERVT 185
           VLVPQSMSYAQIATL PQYGLYSS +G FIY+ FATSKD+CIGPVA+MSLQTAK I  V 
Sbjct: 62  VLVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHV- 120

Query: 186 SGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNII 245
                 +                CG I+ GIG LRLGF I+ I + AV GF +GSAFNI+
Sbjct: 121 ----HQKHPDIPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNIL 176

Query: 246 CGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSLGP 305
            GQ+P LMGY+K VNTR  TY+VV++TLK LP T ++AV GLIPL  L++ K+     G 
Sbjct: 177 WGQIPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKY-----GC 231

Query: 306 QYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTSVPI 365
            Y  +   R NL    ++I+       FY  ++R  +VII+ +A ++    G  + S  +
Sbjct: 232 DYALR---RGNLKPWPKRIV-------FYLLSLRVTIVIIICSAAAY----GAKNPS--L 275

Query: 366 SILGTVPKGLKEVA---VFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIV 422
            +LG +PKG    +   +  +P  L                       KSF RVN+Y++ 
Sbjct: 276 KVLGKIPKGFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVS 335

Query: 423 PDQELIAIGVTNLIGTFFM-AYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLT 481
            DQEL AIGV+N++G   + AYP TGSFSR+ALKA+C+V+TPL  +FSG CV++A+  LT
Sbjct: 336 ADQELTAIGVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLT 395

Query: 482 GAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIY 541
            A  +IPKATLSAVIIHAVS L++SYK T+  YKM PLD + F+ T+FITVFS IE G+Y
Sbjct: 396 SALAWIPKATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVY 455

Query: 542 FAICFSCAQLIFKNMFPVGSFLGYIKIAEV 571
           FA+C++C  L+ +  FP G+FLGY+++ E+
Sbjct: 456 FAVCWACFLLMIRIAFPYGAFLGYVRVREI 485

 Score =  171 bits (434), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 85/190 (44%), Positives = 115/190 (60%), Gaps = 19/190 (10%)

Query: 642 WVPMKNDYHREVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISN 701
           W+P  + + RE+NP +KI PPPPG++VYRF DS TY+NCSR+YD I D +K NT+ G  +
Sbjct: 688 WIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPGEID 747

Query: 702 VYKRK-QDRPWNDVGEWECPKSXXXXXXXXXXXTDIGGDEDKDGNEAIESNSKANNTDNK 760
           V       +PWN+ G WE PK              +   E  D     E   K    D +
Sbjct: 748 VLSDALYVKPWNNPGPWEKPK--------------LKFWEHADP----EIARKKRMADKR 789

Query: 761 PELKIICFDFSQVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGF 820
           P L+I+C DFSQV Q D+TA+Q+L DLR  VN Y+   +E+HF GIIS WV+++LIE+GF
Sbjct: 790 PTLRILCLDFSQVAQIDSTALQALIDLRHEVNAYTCSLVEWHFCGIISPWVRRNLIEIGF 849

Query: 821 GTVNDNYSDK 830
           G +N  +  K
Sbjct: 850 GKINKEFFPK 859

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score =  120 bits (302), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 113/478 (23%), Positives = 202/478 (42%), Gaps = 59/478 (12%)

Query: 94  YLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGA 153
           Y++   P+LKW P Y+   L +DL+AGI++    +P ++S + +A ++P  GL+S  I  
Sbjct: 43  YISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIPFAISLSTMAHVSPYAGLFSLVIPP 102

Query: 154 FIYSFFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIIS 213
            IY+ F +   + +GP  V+SL   +  E       A                   G I 
Sbjct: 103 LIYAVFGSVPTMVVGPQTVVSLVVGQSCE-------AWSHKSVDSLVTVAVIACTSGFIL 155

Query: 214 TGIGFLRLGFLIEFISLNAVAGFMTGSAFNIICGQV-PALMG---YNKKV---NTRASTY 266
             +G  R+GF+   IS   + GF+   A  ++  ++ P L     Y  +V   N   +T+
Sbjct: 156 LSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELLPELQLEDLYRDEVAQGNAGTTTW 215

Query: 267 EVVINTLKHLPD--TKLDAVFGLIPLSILYLCKWFFSSLGPQYLNKLSNRRNLTE-RQRK 323
           +     LK+ P+           I  SIL +CK+               ++  TE R  K
Sbjct: 216 DKFNFILKYGPEHADSFSMKLSFIAFSILMVCKYV--------------KKYFTEKRGSK 261

Query: 324 IIKYLGNYFFYSNAMRNGVVIIVFTAIS----WAITRGKSSTSVPISILGTVPKGLKEVA 379
           + ++  +           +V+  F  +S    W+ T G         I+G +P       
Sbjct: 262 LCRFFPDLL---------LVVAGFIYLSYYNDWSSTMGTR-------IIGNLPPNKNH-- 303

Query: 380 VFKVPGGLFEKXXXX---XXXXXXXXXXXXXXXXKSFGRVNDYKIVPDQELIAIGVTNLI 436
            FKVP   F++                       K+ G   D  I  ++EL+++G+ N++
Sbjct: 304 -FKVPITSFKEFKELFDISFLVAILGLFDSATAFKAIGEKFDIDISSNRELVSLGLINVV 362

Query: 437 GTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGAFYYIPKATLSAVI 496
            + F A PA G + RS L   C  +TP++G+      +  +  + GAF+Y+P   L+ +I
Sbjct: 363 SSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAIFCMNYMMGAFHYLPLCVLAVII 422

Query: 497 IHAVSDLLASYKTTLNFYKM--NPLDFVCFITTVFITVFSSIEYGIYFAICFSCAQLI 552
            +   +LL    + L FY       + + F+  V  T+  S ++G+   +  +  +L+
Sbjct: 423 SYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTLVWSPQFGVSIGVGLTMIRLL 480

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 126/526 (23%), Positives = 209/526 (39%), Gaps = 94/526 (17%)

Query: 57  DVNSSLSIPM--YNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLI 114
           DVNSS   PM  +      +K  +Y+++  Y              P   WLP Y L    
Sbjct: 53  DVNSS---PMRSFLTSEQLVKMSFYDRLKYYL-------------PCFSWLPDYTLKKFG 96

Query: 115 QDLIAGITVGCVLVPQSMSYA-QIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVM 173
            D+IAGIT+    +P ++SYA  +A + P  GLYS  I  F+Y  F +   + +GP + +
Sbjct: 97  GDMIAGITLASFQIPLALSYATSLAHVEPLCGLYSLAITPFVYCVFGSVPQMIVGPESAI 156

Query: 174 SLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAV 233
           SL   + +E++   +T +E+                G I    G  RLGFL   +S   +
Sbjct: 157 SLVVGQAVEKL---VTHNEKVGTINISVVVTFLS--GAILLIFGITRLGFLGNILSRALL 211

Query: 234 AGFMTGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGL------ 287
            GF++     ++   +   +   K + T    Y        H P  K+  +F        
Sbjct: 212 RGFISSVGLVMVINSLITELKLTKLLATVPEHY--------HTPFEKVQFLFKYGPENLH 263

Query: 288 IPLSILYLCKWFFSSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVF 347
            P +IL LC +            L   R L   ++K++K   +  F+       +++IV 
Sbjct: 264 KPTAILSLCSFII----------LMTLRFL---KKKLMKRYKSVIFFPE-----ILLIVI 305

Query: 348 TAISWAITRGKSSTSVPISILGTV----------PKG---------LKEVAVFKVPGGLF 388
           +++  ++          IS+LG            P G         L  V +     G F
Sbjct: 306 SSLIISVNFNLKK-DFDISMLGDFSTSGFDKLNNPLGKDNRSLCHELLSVGLMCAILGFF 364

Query: 389 EKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGS 448
           E                     KS G + D  I  ++EL+A+G  NL+G+ F A P+ G 
Sbjct: 365 ES----------------TTASKSLGTIYDLTISSNRELVALGSMNLVGSLFGALPSFGG 408

Query: 449 FSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYK 508
           + RS + A    +T +SG   G   L  +  L    +Y P   LS +       LL    
Sbjct: 409 YGRSKINALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLLEEAP 468

Query: 509 TTLNFY-KMNPLDFVCFITTVFI-TVFSSIEYGIYFAICFSCAQLI 552
           + + F+ + +  + +   T +F+ T+  S+E GI     +S   +I
Sbjct: 469 SDIRFHIRCHGYNELIIFTLIFVTTIIHSVEAGISVGCIYSIGSII 514

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 104/475 (21%), Positives = 196/475 (41%), Gaps = 53/475 (11%)

Query: 94  YLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYAQIATLAPQYGLYSSFIGA 153
           Y++   P+L+WLP Y+   + +D++AG+T+    +P ++S   +A ++P  GLY+  I  
Sbjct: 43  YVSYYLPILRWLPEYSWGKMAKDMLAGLTLTSFQIPLAISLTTMAHVSPYAGLYALVIPP 102

Query: 154 FIYSFFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXC--GI 211
            IY+ F +   + +GP  V SL           G + D                 C  G+
Sbjct: 103 LIYAVFGSVPTMVVGPQTVASL---------VVGQSCDAWAHKSLEPLMTVAVIGCISGV 153

Query: 212 ISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNIICGQVPALMGYN-------KKVNTRAS 264
           +   +G  RLGF+   IS   + GF +  A  ++  ++   +  +       K+    ++
Sbjct: 154 LVFAMGIFRLGFIDNAISKAFLKGFTSALAVVMLITELLPQLQIDDRYKQALKEGKVGSA 213

Query: 265 TYEVVINTLKHLPD--TKLDAVFGLIPLSILYLCKWFFSSLGPQYLNKLSNRRNLTERQR 322
            ++ ++  L++  +          +   SIL L K+       +YL        LT    
Sbjct: 214 AWDKLVFALENAREYSNPFSVKLSVAAFSILLLSKYL-----KKYLTAKYGWTKLTFFPD 268

Query: 323 KIIKYLGNY---FFYSNAMRNGVVIIVFTAISWAITRGKSSTSVPISILGTVPKGLKEVA 379
            ++  LG+    F+Y    +  + I+        +   K    VPI       K L + +
Sbjct: 269 LLLVVLGSILLSFYYDWDNKYNLPIV------GDLPPNKDHIKVPIQSFQEF-KDLFDAS 321

Query: 380 VFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIVPDQELIAIGVTNLIGTF 439
                 GLFE                     KS     D  +  ++EL+++G+ N++G+ 
Sbjct: 322 FLVAILGLFESATAF----------------KSISATFDIDVSSNRELVSLGLINIVGSV 365

Query: 440 FMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGAFYYIPKATLSAVIIHA 499
           F + PA G + RS L   C  +TP++G+F     +  +  L G F+Y+P   L+ +I   
Sbjct: 366 FSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIFCMRFLMGVFHYLPLCILAVIISFI 425

Query: 500 VSDLLASYKTTLNFY--KMNPLDFVCFITTVFITVFSSIEYGIYFAICFSCAQLI 552
             +LL      + FY       + + F   V  T+  S ++G+   +  +  +L+
Sbjct: 426 AYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTLIWSPQFGLVMGLGLTMIRLL 480

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 112/464 (24%), Positives = 188/464 (40%), Gaps = 40/464 (8%)

Query: 99  FPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYA-QIATLAPQYGLYSSFIGAFIYS 157
            P L W+P+YN      D IAG+++    +P  +S+A  +A + P  GLYS  +  FIY+
Sbjct: 72  LPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAVTPFIYA 131

Query: 158 FFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIG 217
            F +   + +GP + +SL   + +E +TS                       G+     G
Sbjct: 132 LFGSVPHMIVGPESAISLVVGQAVETLTS-----HDLSLETVDIATMISFMSGLTLLFGG 186

Query: 218 FLRLGFLIEFISLNAVAGFMTGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLP 277
             RLGFL   +S   + GF++   F +I   +   +  NK + T    Y        H P
Sbjct: 187 IFRLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHY--------HTP 238

Query: 278 DTKLDAVFGLIPLSILYLCKWFFSS--LGPQYLNKLSNRRNLTER--QRKIIKYLGNYFF 333
             K           IL+L ++  S+  L   +L+       +T R  ++K+++ +    F
Sbjct: 239 FEK-----------ILFLVRYGPSNYHLPTSFLSLAVFTTLMTIRIFKKKMMRRIKWIVF 287

Query: 334 YSNAMRNGVVIIVFTAISWAITRGKSSTSVPISILGTV-PKGLKEV--AVFKVPGGLFEK 390
               +    V+I    +S+     K      IS++G     G  +    + K   GL   
Sbjct: 288 IPEILS---VVIFSIVLSYMCDLKKKYD---ISVIGDFNTDGFDDFRNPLSKCNRGLIPA 341

Query: 391 XXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFS 450
                               KS G   +     ++EL+A+G+ N IG+ F   PA G + 
Sbjct: 342 LRDVSLVSALLGFLESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFGGYG 401

Query: 451 RSALKAKCDVKTPLSGLFSGACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTT 510
           RS + A    +T ++G+F G+  L  +  L    +YIP   LS +       LL      
Sbjct: 402 RSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVGVSLLEEAPHD 461

Query: 511 LNFY-KMNPLD-FVCFITTVFITVFSSIEYGIYFAICFSCAQLI 552
           + F+ +    D  + F+ T   T F SIE+GI     +S   ++
Sbjct: 462 IKFHIRCKGYDELIMFVLTFLCTCFYSIEFGILAGCTYSLISIV 505

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 113/483 (23%), Positives = 195/483 (40%), Gaps = 52/483 (10%)

Query: 90  EIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYA-QIATLAPQYGLYS 148
           +++QY     P L+WLP YN      D I+GI++    +P ++SYA  IA + P  GLYS
Sbjct: 108 QLIQYY---LPCLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYS 164

Query: 149 SFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERV--TSGLTADEQXXXXXXXXXXXXX 206
             I   IY    +   + +GP   +SL   + ++++  +  L++ E              
Sbjct: 165 LAITPVIYGILGSVPPMIVGPEGAISLVVGQAVDKLHGSYNLSSQEDDHISRMNISVTIT 224

Query: 207 XXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNIICGQVPALMGYNKKV--NTR-- 262
              G++    G LRLGFL   +S   +  F++     ++   +   M  N  +  N R  
Sbjct: 225 FLSGLVLFICGLLRLGFLGSVLSKPLLRSFISSVGGVMVIDALITEMKLNCILIDNDRHY 284

Query: 263 ASTYEVVINTLKHLPDT--KLDAVFGLIPLSILYLCKWFFSSLGPQYLNKLSNRRNLTER 320
            + +E ++  +K+ P+   K   V  ++  SILY  ++                     +
Sbjct: 285 HTAFEKIMFIIKYAPNNFHKPTTVLSVVCFSILYFVRYC--------------------K 324

Query: 321 QRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTSVPISILGTVPK------- 373
           ++ IIK+    F     +   +++++ T I  A    K +    ISI+G V         
Sbjct: 325 KKYIIKHKSLIF-----LPEILIVVISTGILSASYNFKDNYG--ISIIGDVNSNNSNLIA 377

Query: 374 GLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIVPDQELIAIGVT 433
           G  +  +      LF                      KS G   +  I  ++EL+A+GV 
Sbjct: 378 GNLQNPLSSSNKELFPILMNTGFAIAALGFFESTTASKSLGTKFELSISSNRELVALGVM 437

Query: 434 NLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGAFYYIPKATLS 493
           NL  +     P+ G + RS + A    KT +SG+  G   +L +  L    ++IP   LS
Sbjct: 438 NLTASLLGGLPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLS 497

Query: 494 AVIIHAVSDLLASYKTTLNFY----KMNPLDFVCFITTVFITVFSSIEYGIYFAICFSCA 549
            +       L+      + F+      N L  + F  T   T+F S+E GI     +S  
Sbjct: 498 VITTIVGLSLIEEAPGEVKFHWRCKGYNEL--IIFFMTACGTIFFSVEVGIIIGCSYSII 555

Query: 550 QLI 552
            +I
Sbjct: 556 SII 558

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  103 bits (256), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 111/462 (24%), Positives = 179/462 (38%), Gaps = 36/462 (7%)

Query: 99  FPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSY-AQIATLAPQYGLYSSFIGAFIYS 157
            P   WLP Y  + L  D+IAGI+V    +P ++SY   IA + P  GLYS  I  F+Y 
Sbjct: 105 LPCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 164

Query: 158 FFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIG 217
              +   + +GP + +SL   + +E +T       +                G I    G
Sbjct: 165 ILGSVPQMIVGPESAISLVVGQAVESITL-----HKENVSLIDISTVITFVSGTILLFSG 219

Query: 218 FLRLGFLIEFISLNAVAGFMTGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHLP 277
             R GFL   +S   + GF++     +I   + + +  +K + +    Y      +  L 
Sbjct: 220 ISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLI 279

Query: 278 DTKLDAVFGLIPLSILYLCKWFFSSLGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNA 337
           D         IP +I   C      L   +L +L         +RK++KY  +  F+ + 
Sbjct: 280 DYAPAQYH--IPTAIFSGC-----CLIVLFLTRL--------LKRKLMKYHKSAIFFPDI 324

Query: 338 MRNGVVIIVFTAISWAITRGKSSTSVPISILGTVPKGLKEVAVFKVP-----GGLFEKXX 392
           +   +V+IV   IS             ISI+G     +      K P       L     
Sbjct: 325 L---LVVIVTILISMKFNLKH---RYGISIIGDF--SMDNFDELKNPLTRPRRKLIPDLF 376

Query: 393 XXXXXXXXXXXXXXXXXXKSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRS 452
                             KS G   +  +  ++EL+A+G  N++ + F A PA G + RS
Sbjct: 377 SASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPAFGGYGRS 436

Query: 453 ALKAKCDVKTPLSGLFSGACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLN 512
            + A    ++ +SG+F G   L+ +  L    +YIP   LS +       LL      + 
Sbjct: 437 KINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPGDIK 496

Query: 513 FYKM--NPLDFVCFITTVFITVFSSIEYGIYFAICFSCAQLI 552
           F+       +   F  T   T+F SIE GI     +S   +I
Sbjct: 497 FHLRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINII 538

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 107/471 (22%), Positives = 192/471 (40%), Gaps = 39/471 (8%)

Query: 90  EIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYA-QIATLAPQYGLYS 148
           E+++Y     P L WLP+Y    L+ DL+AGIT+    +P ++SYA  IA + P  GLY+
Sbjct: 104 ELIRYY---LPCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYA 160

Query: 149 SFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXX 208
             +  F Y+ F ++  + +GP   +SL   + ++                          
Sbjct: 161 LAVSPFFYAIFGSTPQMIVGPEGAISLVIGQCVQSC-----KKHNPDLDPILIVIAVTLI 215

Query: 209 CGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNIICGQVPALMGYNKKVNTRASTYEV 268
            G I    G  RLG+L   ++   + GF+         G V  +M  +  +N      ++
Sbjct: 216 SGTILLISGIFRLGYLGNILNKALLHGFI---------GSVGFVMIIDSLIN-ELKLGDI 265

Query: 269 VINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSLGPQYLNKLSNRRNLTERQRKIIKYL 328
           + +T +H         +    L I++L K+ F +              +    R   K L
Sbjct: 266 LADTPEH---------YNTPFLKIVFLWKYAFQNFHVPTTLISFISIIILLIVRAFKKVL 316

Query: 329 GNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTSVPISILGTVPKGLKEVAVFKVP---- 384
            +   +   +    ++IV T +     +   + +  I ILG       E ++F  P    
Sbjct: 317 MHRHRWLIFIPE--ILIVLTTVLILSYKLDFADTYDIDILGDFKS--NENSIFHNPLSNK 372

Query: 385 -GGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAY 443
             GL                       K+ G  ++  +  ++EL+A+G++N++ +   A 
Sbjct: 373 NRGLIHVVFNIGIITAIFGFFESTTASKALGASSERSVSSNRELVALGLSNIVISTLGAL 432

Query: 444 PATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGAFYYIPKATLSAVIIHAVSDL 503
           P+ G + RS + A    KT LSG+F G   +LA+  L    +YIP   LS +       L
Sbjct: 433 PSFGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFTL 492

Query: 504 LASYKTTLNFY-KMNPLDFVCFITTVFIT-VFSSIEYGIYFAICFSCAQLI 552
           L      ++F+ +    + +  I   F+T +F S+E  +Y    +S   +I
Sbjct: 493 LEEIPKEVSFHWRCRGYNELFLIVLTFMTSIFYSVETSMYIGCVYSILNII 543

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 127/553 (22%), Positives = 211/553 (38%), Gaps = 57/553 (10%)

Query: 23  RGDDTHDRVEARDLYSKVDIEEVTFQ-------CDNYSGRLDVNSSLSIP-MYNEKPVTI 74
           RG  ++       +   VD  E+ F           + GR  V SS S   +Y E  V+ 
Sbjct: 10  RGRTSYSSTIPTRVKKSVDQHEILFDNVDYDKDTSKFRGRACVGSSKSASEIYGENIVSS 69

Query: 75  KDFYYEKINDYFSIG-EIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMS 133
             F     ND       I + +    P   WLP Y  + L  D+IAGI++    +P ++S
Sbjct: 70  DSFNNLSNNDNLDDNNRIFETVPYYLPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALS 129

Query: 134 YA-QIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADE 192
           Y   IA + P  GLYS  I  F+Y    +   + +GP + +SL   + +E +T  L  D 
Sbjct: 130 YTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESIT--LHKDN 187

Query: 193 QXXXXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNIICGQVPAL 252
                            G I    G  R GFL   +S   + GF++     +I   + + 
Sbjct: 188 ---VSLIDISIVITFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLVSE 244

Query: 253 MGYNKKVNTRASTY----EVVINTLKHLPDT--KLDAVFGLIPLSILYLCKWFFSSLGPQ 306
           +  +K + +    Y    E V+  + + P    K  A+F      IL + +         
Sbjct: 245 LKLDKFLVSLPQHYHTPFEKVLFLIDYAPAQYHKPTAIFSGCCFIILIVMRLL------- 297

Query: 307 YLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTSVPIS 366
                  ++ L +R +  +       F+ + +   +V+IV   IS  ++  +      IS
Sbjct: 298 -------KKKLMKRHKSAV-------FFPDIL---LVVIVTILISMKLSLKQ---RYGIS 337

Query: 367 ILGTVPKGLKEVAVFKVP-----GGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRVNDYKI 421
           I+G     +      K P       L                       KS G   +  +
Sbjct: 338 IVGDF--SMDNFDKLKNPLTHSRRKLMPDLFSASLIVAMLGFFESTTASKSLGTTYNLTV 395

Query: 422 VPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLT 481
             ++EL+A+G  N+  + F A P+ G + RS + A    ++ +SG+F G   L+ +  L 
Sbjct: 396 SSNRELVALGCINMFISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMKLLL 455

Query: 482 GAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKM--NPLDFVCFITTVFITVFSSIEYG 539
              +YIP   LS +       LL      + F+       +   F  T  +T+F SIE G
Sbjct: 456 QFVHYIPNCVLSVITTVIGISLLEEVPGDIKFHLQCGGYSELFVFAVTFGVTIFYSIESG 515

Query: 540 IYFAICFSCAQLI 552
           I     +S   +I
Sbjct: 516 ICIGCVYSILNII 528

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 82/175 (46%), Gaps = 6/175 (3%)

Query: 94  YLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYA-QIATLAPQYGLYSSFIG 152
           YL   FP   W+P+Y L   + DL AG++V    +P ++SYA  +A + P  GLYS  I 
Sbjct: 55  YLAYYFPCFSWMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHVEPLSGLYSLAIT 114

Query: 153 AFIYSFFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGII 212
            FIY+ F +   + +GP + +SL   + +E + +    DE+                 ++
Sbjct: 115 PFIYAIFGSVPQMIVGPESAISLVVGQAVEPMVN---HDERISTISISIVVTFISGSFLL 171

Query: 213 STGIGFLRLGFLIEFISLNAVAGFMTGSAFNIICGQVPALMGYNKKVNTRASTYE 267
             GI   RLGFL   +S   + GF+    F +I   + + +  +K + T    Y 
Sbjct: 172 FLGI--FRLGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATSPEHYH 224

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 66/144 (45%), Gaps = 2/144 (1%)

Query: 411 KSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSG 470
           K+ G   D  +  ++EL+A+G  N++G+ F A PA G + RS + A    +T +SG+  G
Sbjct: 350 KALGTTYDLTVSSNRELVALGSMNIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLG 409

Query: 471 ACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPL--DFVCFITTV 528
           +  L  +       +  P   LS V       LL    T L FY  +    + +    T 
Sbjct: 410 SVTLFTIKFFLPVVHNTPTCVLSVVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTF 469

Query: 529 FITVFSSIEYGIYFAICFSCAQLI 552
             T+F S+E GI    C+S   +I
Sbjct: 470 ITTIFYSVEVGICVGCCYSIISII 493

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 81/179 (45%), Gaps = 6/179 (3%)

Query: 99  FPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYA-QIATLAPQYGLYSSFIGAFIYS 157
            P + W+PHY+ +    DL+AGI++    +P ++SYA  IA + P  GLYS  I   IY+
Sbjct: 74  LPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPLIYA 133

Query: 158 FFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIG 217
            F +   + +GP + +SL   +  E+ ++                       G++   +G
Sbjct: 134 IFGSVPQMIVGPESAISLVVGQATEKFSA-----HDSEISTVTITMMITFISGVVLFFLG 188

Query: 218 FLRLGFLIEFISLNAVAGFMTGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTLKHL 276
            +RLGFL   +S   + GF++     +I   +   +  N K+   A  Y   +  +  L
Sbjct: 189 SVRLGFLGNILSKALLRGFISSVGLVMIINSLIIELKLNHKLADVAGHYHTPVGKIMFL 247

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 64/146 (43%), Gaps = 6/146 (4%)

Query: 411 KSFGRVNDYKIV--PDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLF 468
           KS G  +DY +    ++ELIA+G  N++G+ F A P+ G + RS +      KT +SG  
Sbjct: 364 KSLG--SDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSGGKTVMSGAM 421

Query: 469 SGACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNP--LDFVCFIT 526
            G   LL    L    +Y P   LS +       LL    + + F+       +   F  
Sbjct: 422 VGLITLLTAKLLLPMIHYTPTCVLSVITTVIGISLLEEVPSDIKFHIHCSGYSELTVFTL 481

Query: 527 TVFITVFSSIEYGIYFAICFSCAQLI 552
           T   T+  S+E G+     +S   ++
Sbjct: 482 TFIATLSQSVELGVTVGCIYSLILIV 507

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 98/438 (22%), Positives = 173/438 (39%), Gaps = 51/438 (11%)

Query: 130 QSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERVTSGLT 189
            S+S + +A L P  GLYS  I   IY    T     +GP  V+SL   +  E  +    
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSLVVGQSCEWWSH--- 57

Query: 190 ADEQXXXXXXXXXXXXXXXCGIISTGI----GFLRLGFLIEFISLNAVAGFMTGSAFNII 245
                               G +S GI    G  R+GF+   +S   + GF++  A  ++
Sbjct: 58  --------RSLEPLSTVAVIGCVSGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVML 109

Query: 246 CGQVPALMG-------YNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKW 298
             ++   +        Y  +     +T+E     L+  P+      + L   + + L   
Sbjct: 110 ITELLPELKLEELYAHYVAQGYIGTTTWEKFRFILEKAPENSDTFTWNLSLFTFILL--- 166

Query: 299 FFSSLGPQYLNKLSNRRNLTER--QRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITR 356
               +  +YL     +R+L E+   +K I      FF        ++I+V  +I+ + T+
Sbjct: 167 ----MTIRYL-----KRHLAEKCGWKKCI------FFPE------ILIVVVGSITLSNTQ 205

Query: 357 GKSSTSVPISILGTVPKGLKEVAVFKVPGGLFEKXXXXXXXXXXXXXXXXXXXXKSFGRV 416
            K S    I I+G +P     + V       F++                    KS    
Sbjct: 206 -KWSELKGIKIIGDIPPNSDHIKVPVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSN 264

Query: 417 NDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLA 476
           ++     ++EL+++GV NL+ + F A PA G + RS +   C  +T  SG+F     ++ 
Sbjct: 265 SNVDASSNRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIIC 324

Query: 477 LYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKM--NPLDFVCFITTVFITVFS 534
           +  L  AF+++P   L+ +I      LL      L FY       +   FI  V  T+  
Sbjct: 325 MNFLMNAFHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVW 384

Query: 535 SIEYGIYFAICFSCAQLI 552
           S ++G+   +C +  +L+
Sbjct: 385 SPQFGVTMGMCLTMIRLL 402

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 99/242 (40%), Gaps = 22/242 (9%)

Query: 22  KRGDDTHDRVEARDLYSKVDIEEVTFQCDNYSGRLDVNSSLSI----PMYNEKPVTIKDF 77
           KR  D HD       Y K              GR+ V +S S     P  N  P +I + 
Sbjct: 24  KRSVDQHDSFSDNFNYDK--------DSSKNKGRIYVGTSNSTSEVCPAKNSIPESIDNA 75

Query: 78  -YYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYA- 135
            + + I+D   I E + Y     P   WLP Y    L  D+IAGI++    +P ++SY  
Sbjct: 76  GFNDGIDDDNRIFETIPYY---LPCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTT 132

Query: 136 QIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADEQXX 195
            IA + P  GLYS  I  F+Y  F +   + +GP + +SL   + +E +T  L  D    
Sbjct: 133 SIAHVPPLCGLYSLAISPFVYGVFGSVPQMIVGPESAISLVVGQAVESIT--LHKDN--- 187

Query: 196 XXXXXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNIICGQVPALMGY 255
                         G I    G  R GFL   +S   + GF++     +I   + + +  
Sbjct: 188 VSLIDISIVITFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKL 247

Query: 256 NK 257
           +K
Sbjct: 248 DK 249

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 68/144 (47%), Gaps = 2/144 (1%)

Query: 411 KSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSG 470
           KS G   +  +  ++EL+A+G  N++ + F A P+ G + RS + A    ++ +SG+F G
Sbjct: 385 KSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVISGVFVG 444

Query: 471 ACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKM--NPLDFVCFITTV 528
              L+ +  L    +YIP   LS +       LL    + + F+       +   F  T 
Sbjct: 445 VITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPSDIKFHLRCGGYSELFVFAVTF 504

Query: 529 FITVFSSIEYGIYFAICFSCAQLI 552
            +T+F SIE GI     +S   +I
Sbjct: 505 GVTIFYSIEAGICIGCVYSILNII 528

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 67/141 (47%), Gaps = 6/141 (4%)

Query: 411 KSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSG 470
           KS G   D  I  ++EL+A+G  N+I + F A P+ G + RS + A    KT +SG+F G
Sbjct: 379 KSLGTTYDLAISSNRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMG 438

Query: 471 ACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNF-YKMNPLD-FVCFITTV 528
           +  L+ +  L    +YIP   LS +       LL    + L F ++    D    F  TV
Sbjct: 439 SVTLITIRYLLPLIHYIPLCILSVITSIVGISLLEEAPSELKFHFRCKGYDELFVFAITV 498

Query: 529 FITVFSSIEYGIYFAICFSCA 549
             T+  S+E G    IC  C 
Sbjct: 499 LATLLYSVEMG----ICIGCG 515

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 99  FPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYA-QIATLAPQYGLYSSFIGAFIYS 157
            P   W+P Y    LI D +AGI++    +P ++SYA  IA + P  GLYS  I  FIY+
Sbjct: 89  LPCFSWIPQYTWFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFIYA 148

Query: 158 FFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADE 192
            F +   + +GP + +SL   + +E + S  +A E
Sbjct: 149 VFGSVPQMIVGPESAISLVVGQSVELLKSHDSALE 183

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 64/143 (44%), Gaps = 10/143 (6%)

Query: 411 KSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSG 470
           KS G   D  I  ++EL+A+G  NL  +   + PA G + RS + A    +T +SG F G
Sbjct: 380 KSLGSSYDLAISSNRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMG 439

Query: 471 ACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCF----IT 526
             VLL +  L    +YIP   LS V       LL      L F+      F CF    + 
Sbjct: 440 LLVLLTIKFLLPMIHYIPICVLSVVTTMVGISLLEEAPADLMFH------FRCFGYDELL 493

Query: 527 TVFITVFSSIEYGIYFAICFSCA 549
              +TV +++ Y +   IC  C 
Sbjct: 494 VFTLTVLTTMFYSVEVGICIGCG 516

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 67/148 (45%), Gaps = 6/148 (4%)

Query: 99  FPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYA-QIATLAPQYGLYSSFIGAFIYS 157
            P   WLP+YN+   I DLIAG+++    +P ++S+A  +A + P  GLYS     FIY+
Sbjct: 90  LPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYSLAFTPFIYA 149

Query: 158 FFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIG 217
              +   + +GP + +SL   + +E++ S                       G      G
Sbjct: 150 ILGSVPQMIVGPESAISLVVGQAVEKMIS-----HNPDLHTLQLSAVITFISGGFLFFFG 204

Query: 218 FLRLGFLIEFISLNAVAGFMTGSAFNII 245
             RLGFL   +S   + GF++     +I
Sbjct: 205 LCRLGFLGNVLSRALLRGFISSVGLVMI 232

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 84/206 (40%), Gaps = 16/206 (7%)

Query: 99  FPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYA-QIATLAPQYGLYSSFIGAFIYS 157
            P   WLP Y+L     D IAG+++    +P +MSYA  IA + P  GLY+     F Y+
Sbjct: 97  LPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAFTPFFYA 156

Query: 158 FFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIG 217
            F +   + +GP + +SL   + IE +                         G++    G
Sbjct: 157 IFGSVPQMIVGPESAISLVVGQAIEPMIR-----HDPSLSSLDLCVIITFISGVVLFTFG 211

Query: 218 FLRLGFLIEFISLNAVAGFMTGSAFNIICGQVPALMGYNKKVNTRASTY----EVVINTL 273
             R GFL   +S   + GF++     ++   +   +   K  +   S Y    E V+  +
Sbjct: 212 VFRFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSHYHSPFEKVLFLI 271

Query: 274 KHLPDTKLDAVFGLIPLSILYLCKWF 299
           K+ P          +P S+L LC + 
Sbjct: 272 KYAPANY------HLPTSLLSLCCFL 291

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 67/146 (45%), Gaps = 6/146 (4%)

Query: 411 KSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSG 470
           KS G   D  +  ++EL+A+G  NLIG+ F A P+ G + RS + A    +T +SG   G
Sbjct: 387 KSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTVVSGACMG 446

Query: 471 ACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFY----KMNPLDFVCFIT 526
              +  +  L     YIP   LS +       LL      L F+      N L  + FI 
Sbjct: 447 TITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNEL--ISFII 504

Query: 527 TVFITVFSSIEYGIYFAICFSCAQLI 552
           TV  T F S+E GI     +S  ++I
Sbjct: 505 TVLTTFFYSVEAGITVGCGYSIIRVI 530

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 64/144 (44%), Gaps = 2/144 (1%)

Query: 411 KSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSG 470
           KS G   +  I  ++ELIA+G  N++G+ F   PA G + RS + A    +T +SG F G
Sbjct: 364 KSLGTSYNLAISSNRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMG 423

Query: 471 ACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNP--LDFVCFITTV 528
              L  +  L     YIP   LS +       LL      L F+       +   F  T+
Sbjct: 424 LVTLFTIQFLLPIIRYIPVCILSVITTVVGLTLLEEAPHDLKFHWRCKGYSELTVFTVTL 483

Query: 529 FITVFSSIEYGIYFAICFSCAQLI 552
             T+F S+E GIY     S   +I
Sbjct: 484 LATLFYSLEAGIYIGCACSIINVI 507

 Score = 54.7 bits (130), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 99  FPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYA-QIATLAPQYGLYSSFIGAFIYS 157
            P   W+P Y++   + D IAG+++    +P +MSYA  +A + P  GLYS      +Y+
Sbjct: 74  LPCFSWIPTYSVKKCMGDFIAGLSLASFQIPLAMSYATSVAHVPPLCGLYSLVFSPAVYT 133

Query: 158 FFATSKDVCIGPVAVMSLQTAKVIE 182
              +   + +GP + +SL   + IE
Sbjct: 134 VLGSVPQMIVGPESAISLILGQAIE 158

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 63/141 (44%), Gaps = 6/141 (4%)

Query: 99  FPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYA-QIATLAPQYGLYSSFIGAFIYS 157
            P   W+P Y     + DL+AGIT+    +P ++SYA  +A + P  GLYS     FIY+
Sbjct: 82  LPCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCGLYSLAFTPFIYA 141

Query: 158 FFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIISTGIG 217
            F +   + +GP + +SL   + +E++ +                       G+     G
Sbjct: 142 IFGSVPQMIVGPESAISLVVGQAVEKLRA-----HNHEISTMSISVLVTFISGMFLFVFG 196

Query: 218 FLRLGFLIEFISLNAVAGFMT 238
             R GFL   +S   + GF++
Sbjct: 197 ICRFGFLGNVLSRALLRGFIS 217

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 62/141 (43%), Gaps = 6/141 (4%)

Query: 411 KSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSG 470
           KS G   ++ I  ++EL+A+G  NL  +   A PA G + RS + +    +T +SG+  G
Sbjct: 372 KSLGSAYEFAISSNRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMG 431

Query: 471 ACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFY--KMNPLDFVCFITTV 528
             VLL +        YIP   LS +       LL      L F+       + + F  TV
Sbjct: 432 VIVLLTVKFFLSQIRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTV 491

Query: 529 FITVFSSIEYGIYFAICFSCA 549
             T F S+E G    +C  C 
Sbjct: 492 LTTFFYSLEMG----VCIGCG 508

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 65/150 (43%), Gaps = 14/150 (9%)

Query: 411 KSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSG 470
           KS G   D  I  ++EL+A+G  NL+G+ F A P+ G + RS + A     T +SG+F G
Sbjct: 375 KSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATVMSGVFMG 434

Query: 471 ACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVC------- 523
              L+    L  A  +IP   LS +       L       L F+      F C       
Sbjct: 435 LITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKFH------FRCRGYNELL 488

Query: 524 -FITTVFITVFSSIEYGIYFAICFSCAQLI 552
            F  TV  T F S+E GI     +S  + I
Sbjct: 489 TFAITVLTTFFYSVEAGITLGCGYSIIRAI 518

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 64/146 (43%), Gaps = 6/146 (4%)

Query: 95  LTSLFPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYA-QIATLAPQYGLYSSFIGA 153
           LT   P   WLP Y+    I DLIAG ++    +P +MSY+  +A + P  GL +     
Sbjct: 81  LTYYLPCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTP 140

Query: 154 FIYSFFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIIS 213
            +Y+ F +   + +GP + +SL   + IE++T                        G I 
Sbjct: 141 LVYAVFGSVPHMIVGPESAISLVVGQAIEKLT-----KHDASLNVTNLCVVLTFISGSIL 195

Query: 214 TGIGFLRLGFLIEFISLNAVAGFMTG 239
              G +R GFL   +S   + GF++ 
Sbjct: 196 FSFGLMRFGFLDSVLSRALLRGFISA 221

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 78/179 (43%), Gaps = 9/179 (5%)

Query: 80  EKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYA-QIA 138
           + + D  +I E V Y     P   WLP Y  + L  D+IAGI++    +P ++SY   IA
Sbjct: 79  DSVYDNNTIFETVPYY---LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIA 135

Query: 139 TLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADEQXXXXX 198
            + P  GLYS  I  F+Y    +   + +GP + +SL   + +E +T  L  D       
Sbjct: 136 HVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESIT--LHKDN---VSL 190

Query: 199 XXXXXXXXXXCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNIICGQVPALMGYNK 257
                      G I    G  R GFL   +S   + GF++     +I   + + +  +K
Sbjct: 191 IDISVVITFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINALISELKLDK 249

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 66/144 (45%), Gaps = 2/144 (1%)

Query: 411 KSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSG 470
           KS G   +  +  ++EL+A+G  N++ + F A P+ G + RS + A    ++ +SG+F G
Sbjct: 385 KSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVG 444

Query: 471 ACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKM--NPLDFVCFITTV 528
              L+ +  L    +YIP   LS +       LL      + F+       +   F  T 
Sbjct: 445 IITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTF 504

Query: 529 FITVFSSIEYGIYFAICFSCAQLI 552
            +T+  SIE GI     +S   +I
Sbjct: 505 GVTILCSIEAGICIGCVYSILNII 528

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 66/144 (45%), Gaps = 2/144 (1%)

Query: 411 KSFGRVNDYKIVPDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSG 470
           KS G   +  +  ++EL+A+G  NL+G+ F A P+ G + RS + A     T +SG+F G
Sbjct: 360 KSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFGGYGRSKINAYSGAATVMSGVFMG 419

Query: 471 ACVLLALYCLTGAFYYIPKATLSAVIIHAVSDLLASYKTTL--NFYKMNPLDFVCFITTV 528
               +    L  A ++IP   LS +       L       L  +F      + + F  TV
Sbjct: 420 LITCVTSMFLLNAIHHIPVCVLSVITTMVGITLFEEAPADLRYHFRCRGYNELLIFALTV 479

Query: 529 FITVFSSIEYGIYFAICFSCAQLI 552
             T F S+E GI     +S  ++I
Sbjct: 480 LTTFFYSVEAGITLGCGYSVIRVI 503

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 78/196 (39%), Gaps = 14/196 (7%)

Query: 95  LTSLFPLLKWLPHYNLDWLIQDLIAGITVGCVLVPQSMSYA-QIATLAPQYGLYSSFIGA 153
           LT   P   WLP Y+   L++D IAG ++    +P +MSY+  +A + P  GL +     
Sbjct: 66  LTYYLPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTP 125

Query: 154 FIYSFFATSKDVCIGPVAVMSLQTAKVIERVTSGLTADEQXXXXXXXXXXXXXXXCGIIS 213
           F+Y+ F +   + +GP + +SL   + IE+                          G I 
Sbjct: 126 FVYAVFGSVPHMIVGPESAISLVVGQAIEK-----QMKHDKSLDVVNLCLILTFISGAIL 180

Query: 214 TGIGFLRLGFLIEFISLNAVAGFMTGSAFNIICGQVPALMGYNKKVNTRASTYEVVINTL 273
              G +R G+L   +S   + GF++     ++   +   +   K  N     Y       
Sbjct: 181 FCFGIMRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGHY------- 233

Query: 274 KHLPDTKLDAVFGLIP 289
            H P  KL  +F   P
Sbjct: 234 -HAPFQKLIFLFHYAP 248

>ACR257C Chr3 complement(808667..809446) [780 bp, 259 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKR055W
           (RHO4)
          Length = 259

 Score = 32.3 bits (72), Expect = 4.9,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 39/80 (48%), Gaps = 14/80 (17%)

Query: 643 VPMKNDYHREVNPLIKITPPPPGIIVYRFGDSFTYLNCSRH-------------YDIIYD 689
           V +K+D +  ++ L ++  P    +V R   +F +L CS               +  +YD
Sbjct: 163 VGLKSDLY-SLDALDRLVDPTDAELVARKMGAFVHLQCSAKTRQCLEDVFNTAIHTALYD 221

Query: 690 EVKKNTRKGISNVYKRKQDR 709
           E++   ++G+  ++K+KQ R
Sbjct: 222 ELRAPPQRGVKGMFKKKQQR 241

>Smik_14.278 Chr14 (512181..513827) [1647 bp, 548 aa] {ON} YNL048W
           (REAL)
          Length = 548

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 37/92 (40%), Gaps = 9/92 (9%)

Query: 251 ALMGYN-KKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSLGPQYLN 309
           A  GYN K V +R          LK    + L   +GLI +S    C+W +S+L P    
Sbjct: 4   AWTGYNFKGVGSRLG--------LKKYAVSCLIIAYGLIKVSTWIFCQWVYSNLNPFSKK 55

Query: 310 KLSNRRNLTERQRKIIKYLGNYFFYSNAMRNG 341
               RR       K IK  G +  Y NA   G
Sbjct: 56  SSLLRRATASCGEKNIKVFGFFHPYCNAGGGG 87

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 92,622,996
Number of extensions: 4092012
Number of successful extensions: 12785
Number of sequences better than 10.0: 56
Number of HSP's gapped: 12872
Number of HSP's successfully gapped: 86
Length of query: 893
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 774
Effective length of database: 39,836,145
Effective search space: 30833176230
Effective search space used: 30833176230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)