Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0A017408.273ON79794161e-54
Kpol_YGOB_YDR119W-A8.273ON75751852e-19
Ecym_42978.273ON74531244e-10
CAGL0B01875g8.273ON74741201e-09
SAKL0H16786g8.273ON74691166e-09
Suva_2.2808.273ON66561113e-08
KLLA0F19371g8.273ON80681104e-08
Skud_4.3808.273ON66561062e-07
YDR119W-A (COX26)8.273ON66561052e-07
Smik_4.3648.273ON65561035e-07
TBLA0F030308.273ON7572992e-06
TDEL0F040008.273ON6258948e-06
ZYRO0D06908g8.273ON7763941e-05
KNAG0H031708.273ON7172931e-05
NDAI0J012908.273ON7577922e-05
KLLA0F19382gsingletonON7552871e-04
KLTH0G13442g8.273ON7473800.001
Kwal_YGOB_YDR119W-A8.273ON7438760.006
KAFR0B054408.273ON6639640.34
KNAG0F034305.328ON63225660.39
NCAS0B037708.273ON6028610.84
KAFR0A056804.296ON192935631.3
NOTE: 1 genes in the same pillar as TPHA0A01740 were not hit in these BLAST results
LIST: KAFR0B02760

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0A01740
         (79 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}...   164   1e-54
Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON} A...    76   2e-19
Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON} s...    52   4e-10
CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar ...    51   1e-09
SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa] {...    49   6e-09
Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A ...    47   3e-08
KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some s...    47   4e-08
Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A ...    45   2e-07
YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}  COX26Putat...    45   2e-07
Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A ...    44   5e-07
TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}...    43   2e-06
TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273...    41   8e-06
ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON...    41   1e-05
KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}...    40   1e-05
NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.27...    40   2e-05
KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some s...    38   1e-04
KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa] {...    35   0.001
Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74 a...    34   0.006
KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa] {O...    29   0.34 
KNAG0F03430 Chr6 (651144..653042) [1899 bp, 632 aa] {ON} Anc_5.3...    30   0.39 
NCAS0B03770 Chr2 complement(674509..674691) [183 bp, 60 aa] {ON}       28   0.84 
KAFR0A05680 Chr1 complement(1141755..1147544) [5790 bp, 1929 aa]...    29   1.3  

>TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 79

 Score =  164 bits (416), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 79/79 (100%), Positives = 79/79 (100%)

Query: 1  MFSKIISQSTARIANRQIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTV 60
          MFSKIISQSTARIANRQIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTV
Sbjct: 1  MFSKIISQSTARIANRQIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTV 60

Query: 61 LLWPSFIKYFKDPNYKERY 79
          LLWPSFIKYFKDPNYKERY
Sbjct: 61 LLWPSFIKYFKDPNYKERY 79

>Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 75

 Score = 75.9 bits (185), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 54/75 (72%)

Query: 1  MFSKIISQSTARIANRQIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTV 60
          MFS+I++++TAR+   Q +R++S A +   + H+GESW +TEAKRV P ++ WG+ +T +
Sbjct: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAI 60

Query: 61 LLWPSFIKYFKDPNY 75
          L WP  I ++K P+Y
Sbjct: 61 LSWPFIIYHYKAPDY 75

>Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON}
          similar to Saccharomyces cerevisiae YDR119W-A
          Length = 74

 Score = 52.4 bits (124), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%)

Query: 24 NAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKYFKDPNYK 76
           A +   S H+GE W++TE KR+ P +L WG  MT +LLWP   + + +   K
Sbjct: 22 GARRAATSKHIGEPWMVTETKRLVPTILIWGGTMTGILLWPIIFRVYIEEILK 74

>CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar
          to uniprot|Q2V2P9 Saccharomyces cerevisiae YDR119wa
          Length = 74

 Score = 50.8 bits (120), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%)

Query: 1  MFSKIISQSTARIANRQIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTV 60
          MF  +       + N  + R  S+ A+T     +G SW + E KR+ P L+ W S +T  
Sbjct: 1  MFRSVGINRMRYVMNSSMTRSLSSTARTQAQGRIGPSWTIAEIKRLTPTLIGWASFLTVT 60

Query: 61 LLWPSFIKYFKDPN 74
          L WP  I ++K PN
Sbjct: 61 LGWPFGIYFWKKPN 74

>SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa]
          {ON} similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A Pi
          Length = 74

 Score = 49.3 bits (116), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 1  MFSKIISQSTARIANRQII-RHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTT 59
          MFS  + +STA I+   +  + +S          LGE W +TEAKR+ P +  WG++M  
Sbjct: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60

Query: 60 VLLWPSFIK 68
          VL WP  +K
Sbjct: 61 VLGWPFAVK 69

>Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 47.4 bits (111), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 17 QIIRHSSNAA--KTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKYF 70
          Q++R S+ AA  K      +GE+W++TE++R+ P +  WG+ + T L WP  + +F
Sbjct: 5  QVLRSSARAAPIKRYTGGRVGEAWMITESRRLIPEVFQWGAVICTCLGWPGAVYFF 60

>KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 80

 Score = 47.0 bits (110), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 1  MFSKIISQSTARIANRQIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTV 60
          MF     +STA IA     + ++  A   G   +GE+W +TEA+R+GP +L +G+ + +V
Sbjct: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGR-RVGEAWAVTEARRLGPTILMYGTFIVSV 59

Query: 61 LLWPSFIK 68
          L WP  ++
Sbjct: 60 LGWPFLVR 67

>Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 45.4 bits (106), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 17 QIIRHSSNAA--KTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKYF 70
          Q++R S+ AA  K      +GESW++TE +R+ P +L W +A++  L WP  + + 
Sbjct: 5  QVLRSSARAAPIKRYTGGRVGESWVITEGRRLIPEVLQWSAALSICLGWPGAVYFL 60

>YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}
          COX26Putative protein of unknown function; copurifies
          with respiratory chain supercomplexes composed of
          Complex III (ubiquinol-cytochrome c reductase) and
          Complex IV (cytochrome c oxidase)
          Length = 66

 Score = 45.1 bits (105), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 17 QIIRHSSNAA--KTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKYF 70
          Q++R S+ AA  K      +GESW++TE +R+ P +  W + ++  L WP  + +F
Sbjct: 5  QVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFF 60

>Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A
          (REAL)
          Length = 65

 Score = 44.3 bits (103), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 17 QIIRHSSNAA--KTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKYF 70
          +++R S+ AA  K      +GESW++TE +R+ P +  W + ++  L WPS + +F
Sbjct: 5  EVLRSSARAAPIKRYTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAVYFF 60

>TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 75

 Score = 42.7 bits (99), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 7/72 (9%)

Query: 1  MFSKIISQSTARIANRQIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTV 60
          M  +  ++S+A +A  Q+ R  +        S+  ESW +TE KR+ PN+ FW + ++  
Sbjct: 1  MLFQHAARSSASMARMQLRRSFTR-------SYTQESWAVTEVKRIVPNIAFWATLLSVS 53

Query: 61 LLWPSFIKYFKD 72
          L WP    +++D
Sbjct: 54 LGWPFCFVWYQD 65

>TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 62

 Score = 40.8 bits (94), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 35/58 (60%)

Query: 17 QIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKYFKDPN 74
          Q++R ++ AA+    +H  +SW ++EAKR+ P +L WG  +   L WP  IK+F   N
Sbjct: 5  QVLRSAAAAARATSRNHNSQSWAVSEAKRLTPAILGWGGFLAGCLGWPFAIKHFMSAN 62

>ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON}
          similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A
          Length = 77

 Score = 40.8 bits (94), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 17 QIIRHSS-----NAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKYFK 71
          Q++R+S+      AAK    S  GE W L EA+R+    + W  +++ +L WP+ I  F 
Sbjct: 5  QVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAIIKFS 64

Query: 72 DPN 74
          + N
Sbjct: 65 EHN 67

>KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 71

 Score = 40.4 bits (93), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 6/72 (8%)

Query: 1  MFSKIISQSTARIANRQIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTV 60
          MF   +S+S  R++    +R++S+  +      +G  +  TE KR  P +  WGS +  V
Sbjct: 1  MFRSQVSKSLQRMSKPIGLRYASSGGR------VGPGFYRTEIKRRIPQVALWGSGLFLV 54

Query: 61 LLWPSFIKYFKD 72
          L WP F K++  
Sbjct: 55 LEWPFFFKWYNQ 66

>NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 75

 Score = 40.0 bits (92), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 1  MFSKIISQSTARIANRQIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTV 60
          +F+ ++ +S    A RQ +   +N A        G  W+ +E +RV P +L W + +  V
Sbjct: 2  LFNSVLKRSIRNTAVRQFV---TNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVV 58

Query: 61 LLWPSFIKYFKDPNYKE 77
          L WP+   Y+    Y+ 
Sbjct: 59 LGWPAPFYYYHKIKYQS 75

>KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 75

 Score = 38.1 bits (87), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 21 HSSNAAKTPGSS--HLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKYF 70
          H++ A +   +S  H+GESW  +E +R+ PNL+ +   + T++ WP ++K +
Sbjct: 12 HATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPYWVKEY 63

>KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa]
          {ON} conserved hypothetical protein
          Length = 74

 Score = 35.4 bits (80), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 4/73 (5%)

Query: 1  MFSKIISQSTAR---IANRQIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAM 57
          M S  I +S A    +A  Q+ R +S      G S     W + EAKR+ P +  WG+ M
Sbjct: 1  MLSSQILKSVATLQGVAASQVSRSASRVV-LKGPSSRARKWAVIEAKRLVPAIGMWGAFM 59

Query: 58 TTVLLWPSFIKYF 70
            VL WP  ++  
Sbjct: 60 GAVLGWPFAVRAL 72

>Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74
          aa] {ON} ANNOTATED BY YGOB -
          Length = 74

 Score = 33.9 bits (76), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 27 KTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWP 64
          K P S      W + EAKR+ P +  W ++MT +L WP
Sbjct: 31 KAPSSR--ARQWAVIEAKRIVPTVAMWATSMTIMLGWP 66

>KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa]
          {ON} Anc_8.273 YDR119W-A
          Length = 66

 Score = 29.3 bits (64), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 21/39 (53%)

Query: 31 SSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKY 69
          + H+G  ++  +AK+    +  WG+ +   L WPS I Y
Sbjct: 24 AQHIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVIYY 62

>KNAG0F03430 Chr6 (651144..653042) [1899 bp, 632 aa] {ON} Anc_5.328
           YDR307W
          Length = 632

 Score = 30.0 bits (66), Expect = 0.39,   Method: Composition-based stats.
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 42  EAKRVGPNLLFWGSAMTTVLLWPSF 66
           E+ R+ P+ LFW S + TVL W S+
Sbjct: 149 ESVRLSPDALFWFSLVCTVLFWRSY 173

>NCAS0B03770 Chr2 complement(674509..674691) [183 bp, 60 aa] {ON}
          Length = 60

 Score = 28.1 bits (61), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 15/28 (53%)

Query: 35 GESWILTEAKRVGPNLLFWGSAMTTVLL 62
          G  W+  E KRV P L  W S + T LL
Sbjct: 33 GVRWLKGEVKRVTPTLGVWASILITTLL 60

>KAFR0A05680 Chr1 complement(1141755..1147544) [5790 bp, 1929 aa] {ON}
            Anc_4.296 YLR422W
          Length = 1929

 Score = 28.9 bits (63), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 3    SKIISQSTARIANRQIIRHSSNAAKTPGSSHLGES 37
            S+I+  +   I  + I R SS+++ T GSSHL  S
Sbjct: 1863 SEIVDMNMGEILTKYITRSSSHSSLTTGSSHLAPS 1897

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.131    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,118,429
Number of extensions: 258388
Number of successful extensions: 602
Number of sequences better than 10.0: 22
Number of HSP's gapped: 602
Number of HSP's successfully gapped: 22
Length of query: 79
Length of database: 53,481,399
Length adjustment: 51
Effective length of query: 28
Effective length of database: 47,633,433
Effective search space: 1333736124
Effective search space used: 1333736124
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)