Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TPHA0A009203.161ON39139120880.0
Kpol_479.253.161ON39139119920.0
CAGL0K01595g3.161ON39139119650.0
TDEL0D046103.161ON39139119590.0
Suva_4.2203.161ON39139119530.0
NDAI0G029003.161ON39139119500.0
Smik_4.2063.161ON39139119490.0
YDL029W (ARP2)3.161ON39139119460.0
Skud_4.2223.161ON39139119420.0
NCAS0C035503.161ON39239119370.0
KLLA0C03850g3.161ON39139119350.0
SAKL0C07370g3.161ON39139119320.0
TBLA0F008703.161ON39139119280.0
KLTH0F06490g3.161ON39139119210.0
ZYRO0B04928g3.161ON39139119200.0
KNAG0K01130na 1ON39339319190.0
ADR316W3.161ON39139118940.0
Ecym_52373.161ON39139118790.0
KAFR0C01040na 1ON33733716940.0
Kwal_33.141773.161ON33733716740.0
TPHA0D002508.23ON3753799281e-123
NCAS0C037008.23ON3753799271e-123
NDAI0G030408.23ON3753799251e-122
TDEL0C004708.23ON3753799251e-122
CAGL0K12694g8.23ON3753799251e-122
Suva_6.188.23ON3753799251e-122
Smik_6.398.23ON3753799251e-122
YFL039C (ACT1)8.23ON3753799251e-122
TBLA0C004408.23ON3753799241e-122
KNAG0L002508.23ON3753799221e-122
KAFR0D009408.23ON3753799221e-122
ZYRO0F02772g8.23ON3753799221e-122
ABR222W8.23ON3763799201e-122
Kpol_1058.158.23ON3753799171e-121
KLLA0D05357g8.23ON3753799171e-121
Ecym_15208.23ON3763799171e-121
KLTH0G18832g8.23ON3753799171e-121
SAKL0B00968g8.23ON3753799171e-121
Skud_6.318.23ON3603698981e-119
Kwal_14.11098.23ON3603698901e-117
SAKL0E11814g2.117ON3793887592e-97
Kpol_1023.188.23ON3192927402e-95
AFR051W2.117ON4053867447e-95
Ecym_63852.117ON3773897357e-94
KLLA0E22925g2.117ON3803907314e-93
KLTH0B05940g2.117ON3833887288e-93
Kwal_33.146422.117ON3833886783e-85
ZYRO0G05676g2.117ON3813976741e-84
NCAS0B071302.117ON3813786713e-84
KAFR0F005902.117ON3863866681e-83
TBLA0B010702.117ON3833786505e-81
TPHA0I013002.117ON3793876419e-80
Suva_15.3262.117ON3843786262e-77
YHR129C (ARP1)2.117ON3843786236e-77
Smik_8.2102.117ON3843786174e-76
Skud_8.1902.117ON3843786159e-76
NDAI0B044602.117ON3813836122e-75
TDEL0B048102.117ON3733786071e-74
KNAG0H036502.117ON3873955731e-69
KNAG0B001701.514ON4534444883e-56
Kwal_27.99581.514ON4454404865e-56
SAKL0D12804g1.514ON4564514859e-56
KLTH0C02508g1.514ON4514434841e-55
KAFR0D037001.514ON4494414813e-55
YJR065C (ARP3)1.514ON4494414814e-55
TBLA0D036801.514ON4584574806e-55
Skud_10.2891.514ON4494414752e-54
Smik_10.3551.514ON4494414753e-54
AFR419C1.514ON4554474743e-54
TPHA0O010401.514ON4584494743e-54
CAGL0H09042g2.117ON3873794694e-54
Kpol_1056.161.514ON4603564735e-54
KLLA0B13904g1.514ON4564484736e-54
Suva_12.1541.514ON4494414718e-54
NCAS0A122701.514ON4544464719e-54
CAGL0F00517g1.514ON4544464692e-53
NDAI0A039701.514ON4623584666e-53
Ecym_31531.514ON4583554632e-52
ZYRO0G01936g1.514ON4613554623e-52
TDEL0F004701.514ON4613554589e-52
YJL081C (ARP4)1.287ON4892982553e-23
Skud_10.1321.287ON4882992553e-23
NDAI0G055801.287ON5152982528e-23
Suva_6.1541.287ON4892992501e-22
Smik_10.1611.287ON4892992473e-22
NCAS0B060601.287ON4973062457e-22
AFR105C1.287ON4792952323e-20
KAFR0A015601.287ON4852982314e-20
Kwal_56.238328.258ON4193782224e-19
Kpol_282.41.287ON5013022225e-19
Suva_14.2812.248ON7552342221e-18
KNAG0B019201.287ON5052002201e-18
KLTH0G09482g2.248ON7452332149e-18
TPHA0I010301.287ON5032802131e-17
ZYRO0G21428g1.287ON4832922121e-17
KLTH0G13772g8.258ON4203842111e-17
KLLA0D02288g1.287ON5202942093e-17
KLTH0H09702g1.287ON4812932083e-17
Smik_14.2672.248ON7552412094e-17
Skud_14.2722.248ON7552342094e-17
TDEL0D015501.287ON4802932074e-17
TBLA0D053601.287ON5962362075e-17
CAGL0M03201g1.287ON4932032066e-17
SAKL0H17138g8.258ON4193712012e-16
TDEL0F038508.258ON4193662012e-16
KLLA0F19063g8.258ON4153902003e-16
SAKL0D05874g1.287ON4972742004e-16
Kwal_14.23771.287ON4811851987e-16
NCAS0G030502.248ON7432401952e-15
TBLA0H014608.258ON4424001933e-15
Ecym_63301.287ON4801891933e-15
NDAI0B019608.258ON4394531923e-15
KLLA0F03421g2.248ON7472331934e-15
Kpol_543.368.258ON4273761915e-15
YNL059C (ARP5)2.248ON7552321901e-14
KAFR0B027008.258ON4203791871e-14
ZYRO0C01738g8.258ON4143621862e-14
Kwal_23.48482.248ON7452331845e-14
Skud_12.1538.258ON4383851782e-13
Ecym_43128.258ON4113691782e-13
TPHA0A018308.258ON4213681782e-13
KAFR0J011602.248ON7512331792e-13
SAKL0E08602g2.248ON7472411783e-13
AGR091W8.258ON4103711763e-13
Smik_12.1448.258ON4383931746e-13
CAGL0L12166g8.258ON4213711738e-13
NDAI0D010602.248ON7532341731e-12
YLR085C (ARP6)8.258ON4383901711e-12
CAGL0J10054g2.248ON7542341722e-12
KNAG0G020108.258ON4243831702e-12
NCAS0B049908.258ON4203721674e-12
TBLA0E038602.248ON7592451685e-12
TDEL0C041402.248ON7492401676e-12
Suva_10.1698.258ON4383841631e-11
ZYRO0A01584g2.248ON7482421623e-11
KNAG0I018602.248ON7532271453e-09
TPHA0C031602.248ON7552321453e-09
ADL253C2.248ON7512311382e-08
Kpol_1003.162.248ON7492311356e-08
SAKL0H17358g8.251ON3112411311e-07
Ecym_32852.248ON7462501285e-07
NDAI0A013007.448ON5651971152e-05
AFR135W5.477ON7911501142e-05
Kwal_27.105527.448ON3513411104e-05
Kpol_520.117.448ON4883511105e-05
SAKL0F13772g7.448ON4223651105e-05
KAFR0K021507.448ON4901151098e-05
TPHA0N014302.593ON4722371081e-04
NCAS0A147207.448ON4851971071e-04
Kpol_543.105.477ON8761671081e-04
TBLA0H028002.593ON4843011043e-04
KLLA0E03213g5.477ON7881031044e-04
KLLA0F11913g8.251ON253981005e-04
Ecym_23115.477ON7751031017e-04
Ecym_23062.593ON4073451008e-04
Skud_15.3045.477ON8831391019e-04
Suva_16.3647.448ON480113990.001
Smik_15.3205.477ON873128990.001
Smik_13.2032.593ON467229980.002
Skud_13.1892.593ON467229970.002
YPR034W (ARP7)7.448ON477183970.002
Smik_16.2787.448ON476113970.002
YOR141C (ARP8)5.477ON88187970.003
SAKL0G03608g5.477ON794165960.003
Skud_16.3217.448ON479191950.004
Suva_13.2022.593ON467229940.004
YMR033W (ARP9)2.593ON467229930.006
Ecym_35058.251ON305217920.007
KLTH0D08624g2.593ON432234920.009
KAFR0E025305.477ON842100910.013
TBLA0F004507.448ON482124890.021
Kpol_181.22.593ON463285880.023
KNAG0B021107.448ON485160880.025
CAGL0F05907g2.593ON462196870.029
NCAS0B039008.251ON279118860.033
ZYRO0G17182g7.448ON465127860.047
KLLA0E06315g7.448ON438225850.054
CAGL0K05335g7.448ON529116850.056
Kwal_26.83312.593ON432234850.060
KLTH0F14960g5.477ON775105850.062
Kwal_55.212505.477ON775123850.065
YDR106W (ARP10)8.251ON28492830.078
AGR099C8.251ON305217830.081
ZYRO0F01122g2.593ON462228820.14
KAFR0I015802.593ON459229780.38
ABR084W2.593ON46481780.38
TBLA0E043208.251ON27680760.54
TDEL0C031207.448ON438104760.66
TPHA0B014607.448ON485184760.68
CAGL0I07161g5.477ON837100741.4
Suva_2.2658.251ON281100731.4
NCAS0H022905.477ON863135712.9
Ecym_63812.121ON12768673.7
TPHA0L012008.466ON32239703.8
KNAG0H005702.593ON46978694.6
Suva_8.1925.477ON879114696.2
ADR128C2.618ON86744687.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TPHA0A00920
         (391 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...   808   0.0  
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...   771   0.0  
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...   761   0.0  
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...   759   0.0  
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...   756   0.0  
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...   755   0.0  
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...   755   0.0  
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...   754   0.0  
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...   752   0.0  
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...   750   0.0  
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...   749   0.0  
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...   748   0.0  
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...   747   0.0  
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...   744   0.0  
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...   744   0.0  
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...   743   0.0  
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...   734   0.0  
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...   728   0.0  
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...   657   0.0  
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...   649   0.0  
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   362   e-123
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   361   e-123
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   360   e-122
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   360   e-122
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   360   e-122
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   360   e-122
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   360   e-122
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   360   e-122
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   360   e-122
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   359   e-122
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   359   e-122
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   359   e-122
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   358   e-122
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   357   e-121
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   357   e-121
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   357   e-121
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   357   e-121
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   357   e-121
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...   350   e-119
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...   347   e-117
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...   296   2e-97
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...   289   2e-95
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...   291   7e-95
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...   287   7e-94
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...   286   4e-93
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...   285   8e-93
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...   265   3e-85
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...   264   1e-84
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...   263   3e-84
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...   261   1e-83
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...   254   5e-81
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...   251   9e-80
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...   245   2e-77
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...   244   6e-77
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...   242   4e-76
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...   241   9e-76
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...   240   2e-75
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...   238   1e-74
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...   225   1e-69
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...   192   3e-56
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...   191   5e-56
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...   191   9e-56
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...   191   1e-55
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...   189   3e-55
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...   189   4e-55
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...   189   6e-55
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...   187   2e-54
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...   187   3e-54
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...   187   3e-54
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....   187   3e-54
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...   185   4e-54
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....   186   5e-54
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...   186   6e-54
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...   186   8e-54
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...   186   9e-54
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...   185   2e-53
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514    184   6e-53
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...   182   2e-52
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...   182   3e-52
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...   181   9e-52
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...   102   3e-23
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...   102   3e-23
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...   101   8e-23
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...   100   1e-22
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...   100   3e-22
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    99   7e-22
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    94   3e-20
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    94   4e-20
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...    90   4e-19
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    90   5e-19
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    90   1e-18
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    89   1e-18
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    87   9e-18
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    87   1e-17
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    86   1e-17
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...    86   1e-17
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    85   3e-17
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    85   3e-17
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    85   4e-17
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    85   4e-17
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    84   4e-17
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    84   5e-17
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    84   6e-17
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...    82   2e-16
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...    82   2e-16
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...    82   3e-16
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    82   4e-16
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    81   7e-16
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    80   2e-15
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...    79   3e-15
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    79   3e-15
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...    79   3e-15
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    79   4e-15
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...    78   5e-15
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    78   1e-14
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...    77   1e-14
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...    76   2e-14
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    75   5e-14
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...    73   2e-13
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...    73   2e-13
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...    73   2e-13
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    74   2e-13
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    73   3e-13
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...    72   3e-13
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...    72   6e-13
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...    71   8e-13
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    71   1e-12
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...    70   1e-12
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    71   2e-12
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...    70   2e-12
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...    69   4e-12
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    69   5e-12
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    69   6e-12
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...    67   1e-11
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    67   3e-11
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    60   3e-09
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    60   3e-09
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    58   2e-08
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    57   6e-08
SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa] ...    55   1e-07
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    54   5e-07
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    49   2e-05
AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic ho...    49   2e-05
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    47   4e-05
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    47   5e-05
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    47   5e-05
KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7....    47   8e-05
TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2....    46   1e-04
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    46   1e-04
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...    46   1e-04
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    45   3e-04
KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {...    45   4e-04
KLLA0F11913g Chr6 complement(1094612..1095373) [762 bp, 253 aa] ...    43   5e-04
Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar t...    44   7e-04
Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}...    43   8e-04
Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {...    44   9e-04
Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034...    43   0.001
Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {...    43   0.001
Smik_13.203 Chr13 (331960..331989,332074..333447) [1404 bp, 467 ...    42   0.002
Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 ...    42   0.002
YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}  ARP7Compo...    42   0.002
Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034...    42   0.002
YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON} ...    42   0.003
SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {...    42   0.003
Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034...    41   0.004
Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 ...    41   0.004
YMR033W Chr13 (337788..337817,337904..339277) [1404 bp, 467 aa] ...    40   0.006
Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON} ...    40   0.007
KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} simila...    40   0.009
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...    40   0.013
TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.4...    39   0.021
Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON} co...    39   0.023
KNAG0B02110 Chr2 complement(399743..401200) [1458 bp, 485 aa] {O...    39   0.025
CAGL0F05907g Chr6 (591411..592799) [1389 bp, 462 aa] {ON} simila...    38   0.029
NCAS0B03900 Chr2 complement(696792..697631) [840 bp, 279 aa] {ON...    38   0.033
ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} simi...    38   0.047
KLLA0E06315g Chr5 complement(567309..568625) [1317 bp, 438 aa] {...    37   0.054
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    37   0.056
Kwal_26.8331 s26 (741843..743141) [1299 bp, 432 aa] {ON} YMR033W...    37   0.060
KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} simi...    37   0.062
Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141...    37   0.065
YDR106W Chr4 (667004..667858) [855 bp, 284 aa] {ON}  ARP10Compon...    37   0.078
AGR099C Chr7 complement(924366..925283) [918 bp, 305 aa] {ON} Sy...    37   0.081
ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp...    36   0.14 
KAFR0I01580 Chr9 complement(332644..334023) [1380 bp, 459 aa] {O...    35   0.38 
ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {...    35   0.38 
TBLA0E04320 Chr5 (1102481..1103311) [831 bp, 276 aa] {ON} Anc_8....    34   0.54 
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    34   0.66 
TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {O...    34   0.68 
CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} simila...    33   1.4  
Suva_2.265 Chr2 (461152..461997) [846 bp, 281 aa] {ON} YDR106W (...    33   1.4  
NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {O...    32   2.9  
Ecym_6381 Chr6 complement(746240..746623) [384 bp, 127 aa] {ON} ...    30   3.7  
TPHA0L01200 Chr12 (250506..251474) [969 bp, 322 aa] {ON} Anc_8.4...    32   3.8  
KNAG0H00570 Chr8 complement(91418..92827) [1410 bp, 469 aa] {ON}...    31   4.6  
Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON...    31   6.2  
ADR128C Chr4 complement(934445..937048) [2604 bp, 867 aa] {ON} S...    31   7.9  

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/391 (100%), Positives = 391/391 (100%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE
Sbjct: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI
Sbjct: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           ASIMADKDHMWLSKQEWAESGPAAMAKFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/391 (93%), Positives = 384/391 (98%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDPHSPIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER +++ PLKD+MIG+EA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPP+NPLKNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL+LDT+LARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTRLARETTTLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           E YELPDGR+IKVGQERFEA ECLFQPNLVDVESAGVGELLFNTIQSAD+DVRSSLYKAI
Sbjct: 241 EKYELPDGRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW+TRVLN DP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLNKDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           A+IMADKDHMWLSKQEW ESGPAAM+KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQESGPAAMSKFGPR 391

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/391 (91%), Positives = 381/391 (97%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER  +N PLKD+MIG+EA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGIIKNWTDMELLWDYAF+ QM+LP+TSGGK+LLTEPP+NP+KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMQLPTTSGGKILLTEPPMNPVKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           ENYELPDGR+IKVGQERFEA ECLFQPNLVDVE AG+GELLFNTIQSAD+DVRSSLYKAI
Sbjct: 241 ENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW+TRVLNNDP RLDKFKVRIEDPPRR+HMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLNNDPTRLDKFKVRIEDPPRRRHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           ASIMADKDHMWL+KQEW ESG AAM+KFGPR
Sbjct: 361 ASIMADKDHMWLTKQEWRESGAAAMSKFGPR 391

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/391 (91%), Positives = 383/391 (97%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEER N++ PLKD+MIG+EA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGIIKNWTDMELLWDYAF++QMKLP+TS GK+LLTEPP+NP+KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFDQMKLPTTSNGKILLTEPPMNPVKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEK+CYVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKVCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           ENYELPDGRVIKVGQERFEA ECLFQP+LVDVE AGVGELLFNTIQ+AD+D+RS+LY+AI
Sbjct: 241 ENYELPDGRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW+TRVL+ND +RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDASRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           A+IMADKDHMWLSKQEW ESGPAAMAKFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQESGPAAMAKFGPR 391

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/391 (91%), Positives = 379/391 (96%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER ++  PLKD+MIG+EA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGIIKNWTDMELLWDYAF+EQMKL STS GK+LLTEPP+NPLKNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLQSTSNGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVLNHLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           E+YELPDGR IKVGQERFEA ECLFQP LVDVE  GVGELLFNT+QSAD+D+RSSLYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW++RVL+NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           ASIMADKDHMWLSKQEW ESGPAAM+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPAAMSKFGPR 391

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/391 (92%), Positives = 377/391 (96%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDPHSPIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER N+  PL+D+MIG+EA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGIIKNWTDMELLWDYAF+ QMKL +TSGGK+LLTEPP+NPLKNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLNNTSGGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVLNHLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           E+YELPDGR IKVGQERFEA ECLFQP LVDVE  GVGELLFNTIQSAD+DVRS+LYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLWYTRVL+NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWYTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           ASIMADKDHMWLSKQEW E G AAMAKFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWYEGGAAAMAKFGPR 391

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/391 (91%), Positives = 379/391 (96%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER ++  PLKD+MIG+EA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGIIKNWTDMELLWDYAF+EQMKLPSTS GK+LLTEPP+NPLKNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVL+HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL+LDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           E+YELPDGR IKVGQERFEA ECLFQP LVDVE  GVGELLFNT+QSAD+D+RSSLYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW++RVL+NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           ASIMADKDHMWLSKQEW ESGPA+MAKFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/391 (91%), Positives = 378/391 (96%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER ++  PLKD+MIG+EA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGIIKNWTDMELLWDYAF+EQMKLPSTS GK+LLTEPP+NPLKNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVL+HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL+LDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           E+YELPDGR IKVGQERFEA ECLFQP LVDVE  GVGELLFNT+QSAD+D+RSSLYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW++RVL+NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           ASIMADKDHMWLSKQEW ESGP+AM KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPSAMTKFGPR 391

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/391 (91%), Positives = 377/391 (96%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER ++  PLKD+MIG+EA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGIIKNWTDMELLWDYAF+EQMKLPSTS GK+LLTEPP+NPLKNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVL+HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL+LDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTVLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           E+YELPDGR IKVGQERFEA ECLFQP LVDVE  GVGELLFNT+QSAD+D+RSSLY+AI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW+ RVL+NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFNRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           ASIMADKDHMWLSKQEW ESGPAAM KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPAAMTKFGPR 391

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/391 (90%), Positives = 374/391 (95%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDPHSPIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER N+  PLKD+MIG+EA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGIIKNWTDMELLWDYAF+EQMKLP+TS GK+LLTEPP+NP KNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVL HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLGHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           E+YELPDGR IKVGQERFEA ECLFQP LVDVE  G+GELLF+T+QSAD+DVRS+LYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW+TRVL NDP RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           ASIMADKDHMWLSKQEW ESG A+M KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/391 (90%), Positives = 378/391 (96%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEERG+ + PLKD+MIG+EA
Sbjct: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGII+NW DMELLWDYAF+EQMKLP+TSGGKVLLTEPP+NP+KNRE
Sbjct: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGG YVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           E+YELPDGRVIKVG ERFEA ECLFQP+LVDVE  GVGELLFNTIQ+AD+D+R+SLYKAI
Sbjct: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW+TRVL NDP RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           A+IMADKDHMWLSKQEW E GPAAM+KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/391 (89%), Positives = 379/391 (96%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER ++  PLKD+MIG+EA
Sbjct: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGIIKNW DMELLWDYAFYEQMKLPSTSGGKVLLTEPP+NPL+NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVL+HLT+R
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTKR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           ENYELPDGRVIKVG ERFEA ECLFQP+LVDVE  GVGE+LFNT+Q+AD+DVR++LY+A+
Sbjct: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW+TRVL NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           A+IMADKDHMWL+KQEW E GPAAM+KFGPR
Sbjct: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/391 (90%), Positives = 377/391 (96%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDPHSPIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEERG ++ PLKD+MIG+EA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGIIKNWTDMELLWDYAF+ QMKLP+TSGGKVLLTEPP+NP+KNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLPTTSGGKVLLTEPPMNPVKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           +MCEVMFE+YDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVLNHLTRR
Sbjct: 121 RMCEVMFERYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGY+FNRTADFETVRQIKEK+CYVSYDL LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQIKEKVCYVSYDLNLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           + YELPDGR+IKVGQERFEA ECLFQP+LVDVES GVGELLFNTIQSADIDVRSSLYKAI
Sbjct: 241 QEYELPDGRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+E+ELKQLW+TR+L  D  RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLERELKQLWFTRILKGDAERLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           A+IMADKDHMWLSKQEW E+G AA+AKFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQENGAAALAKFGPR 391

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/391 (89%), Positives = 378/391 (96%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MD  +PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER N+  PLKD+MIG+EA
Sbjct: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           SAVRSYLQISYPMENG+IKNW+DMELLWDYAFY+QMKLPSTSGGKV+LTEPP+NPL+NRE
Sbjct: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           ENYELPDGRVIKVG ERFEA ECLFQPNLVDVE  GVGE+LFNTIQ+AD+DVRS+LY+AI
Sbjct: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW+TRVL NDP+RL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           A+IMADKDHMWLSKQEW E GP+AM+KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/391 (90%), Positives = 374/391 (95%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDPHSPIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEERG+++ PLKD+MIGEEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGII+NW DME LWDYAFY QMK PSTSGGK+LLTEPP+NPLKNRE
Sbjct: 61  SDVRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFPSTSGGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
            MCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVLNHLTRR
Sbjct: 121 LMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDL LDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLNLDTKLARETTVLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           ENYELPDGRVIKVGQERFEA ECLFQP+LVDVE  G+GELLFNTIQSAD+D+RSSLY+AI
Sbjct: 241 ENYELPDGRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLWYTR+L  D ARLDKFKV+IEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWYTRILRGDAARLDKFKVKIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           ASIMA+KDHMWL+K+EW ESGPAAMAKFGPR
Sbjct: 361 ASIMAEKDHMWLTKEEWHESGPAAMAKFGPR 391

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/393 (90%), Positives = 376/393 (95%), Gaps = 2/393 (0%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLN--IPLKDVMIGE 58
           MDPHSPIVLDQGTGFVKIGRAGENFPD TFPSIVGRPILRAEER  ++   P+KD+M+GE
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGE 60

Query: 59  EASAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKN 118
           EAS VRSYLQISYPMENGIIK+WTDMELLWD+AF+E+MKLPSTSGGK+LLTEPP+NPLKN
Sbjct: 61  EASDVRSYLQISYPMENGIIKHWTDMELLWDHAFFEKMKLPSTSGGKILLTEPPMNPLKN 120

Query: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           RE MC+VMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVLNHLT
Sbjct: 121 REMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLT 180

Query: 179 RRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTT 238
           RRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDL+ DTKLARETTT
Sbjct: 181 RRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDFDTKLARETTT 240

Query: 239 LVENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYK 298
           LVENYELPDGR+IKVGQERFEA ECLFQPNLVDVE  GVGELLFNTIQSAD+D+RSSLYK
Sbjct: 241 LVENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYK 300

Query: 299 AIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGA 358
           AIVLSGGSSMYPGLPSR+EKELKQLW+TRVL NDP+RLDKFKVRIEDPPRRKHMVFIGGA
Sbjct: 301 AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPSRLDKFKVRIEDPPRRKHMVFIGGA 360

Query: 359 VLASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           VLA+IMADKDHMWLSKQEW ESG  AMAKFGPR
Sbjct: 361 VLANIMADKDHMWLSKQEWEESGAQAMAKFGPR 393

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/391 (87%), Positives = 374/391 (95%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDP  PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRA+ER N++ PLKD+MIG+EA
Sbjct: 1   MDPQKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGII++W DMELLWDYAFYEQMKLPSTSGGKVLLTEPP+NPL+NRE
Sbjct: 61  SQVRSYLQISYPMENGIIRDWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGGVYV IQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRD+TR+LIDLLSRRGYAFN+TADFETVRQIKEKLCYVSYDL+LDT+LA+ETTTLV
Sbjct: 181 LDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTRLAQETTTLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           E YELPDGRVIKVG ERFEA ECLFQP+LVDVE  G+GE+LFNTIQSAD+D+ S+LYKAI
Sbjct: 241 EQYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW+TRVL NDP RL+KFKVRIEDPPRRKHMVF GGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPTRLEKFKVRIEDPPRRKHMVFTGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           ASIMADK+HMWL+KQEW ESGPA+M+KFGPR
Sbjct: 361 ASIMADKEHMWLTKQEWEESGPASMSKFGPR 391

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/391 (87%), Positives = 372/391 (95%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MDP+ PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRA ER N++ PLKD+MIG+EA
Sbjct: 1   MDPYVPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEA 60

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
           S VRSYLQISYPMENGIIKNW DME LWDYAFY+QMK+PST+G KVLLTEPP+NPLKNRE
Sbjct: 61  SNVRSYLQISYPMENGIIKNWADMEQLWDYAFYDQMKIPSTAGHKVLLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVLNHLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240
           LDVAGRDVTR+LIDLLSRRGYAFN+TADFETVRQIKEKLCYVSYDL+LDTKLA ETTTLV
Sbjct: 181 LDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTKLAHETTTLV 240

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
           E YELPDGRVIKVG ERFEA ECLFQP+LVDVE  G+GE+LF+TIQSAD+D+ S+LY+AI
Sbjct: 241 ETYELPDGRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAI 300

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW+TRVL NDPARLDKFKVRIEDPPRRKHMVF GGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPARLDKFKVRIEDPPRRKHMVFTGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           A+IMADKDHMWL+K+EW E GPAAM+KFGPR
Sbjct: 361 ANIMADKDHMWLTKKEWEEMGPAAMSKFGPR 391

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/337 (92%), Positives = 328/337 (97%)

Query: 55  MIGEEASAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLN 114
           MIG EAS VRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLP TS GK+LLTEPP+N
Sbjct: 1   MIGGEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPDTSNGKILLTEPPMN 60

Query: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVL 174
           P+KNREKMCEVMFEKY+FGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVL
Sbjct: 61  PIKNREKMCEVMFEKYNFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 120

Query: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLAR 234
           NHLTRRLDVAGRDVTR+LIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL+LDTKLAR
Sbjct: 121 NHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 180

Query: 235 ETTTLVENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRS 294
           ETTTLVE+YELPDGRVIKVG ERFEA ECLFQPNLVDVE AGVGELLFNTIQSAD+D+RS
Sbjct: 181 ETTTLVESYELPDGRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRS 240

Query: 295 SLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVF 354
           +L+KAIVLSGGSSMYPGLPSR+EKELKQLW+TRVL+NDP RLDKFKVRIEDPPRRKHMVF
Sbjct: 241 TLFKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPTRLDKFKVRIEDPPRRKHMVF 300

Query: 355 IGGAVLASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           IGGAVLA+IMADKDHMWLSKQEW ESGPAAMAKFGPR
Sbjct: 301 IGGAVLANIMADKDHMWLSKQEWEESGPAAMAKFGPR 337

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/337 (90%), Positives = 329/337 (97%)

Query: 55  MIGEEASAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLN 114
           MIG+EASAVRSYLQISYPMENG+IKNW+DMELLWDYAFY+QM+LPSTSGGKV+LTEPP+N
Sbjct: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60

Query: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVL 174
           P+KNRE+MCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVV+DSGDGVTHIVPVYESVVL
Sbjct: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 120

Query: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLAR 234
           NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDL+LDTKLAR
Sbjct: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180

Query: 235 ETTTLVENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRS 294
           ETTTLVENYELPDGRVIKVG ERFEA ECLFQP+LVDVE  GVGE+LFNTIQSAD+DVRS
Sbjct: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240

Query: 295 SLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVF 354
           +LY+AIVLSGGSSMYPGLPSR+EKELKQLW+TRVL+NDP+RLDKFKVRIEDPPRRKHMVF
Sbjct: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300

Query: 355 IGGAVLASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391
           IGGAVLA+IMADKDHMWLSKQEW E G AAM+KFGPR
Sbjct: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  362 bits (928), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 176/379 (46%), Positives = 261/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +ESAG+ +  +N+I   DIDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  361 bits (927), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 261/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +ESAG+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  360 bits (925), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 261/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSSIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +ES+G+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           GS+M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GSTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  360 bits (925), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 261/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +ESAG+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  360 bits (925), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 261/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +ESAG+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  360 bits (925), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 261/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +ESAG+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  360 bits (925), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 261/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +ESAG+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  360 bits (925), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 261/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +ESAG+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  360 bits (924), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 174/379 (45%), Positives = 261/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAIMRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +ESAG+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ ++   V+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSME---VKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  359 bits (922), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 174/379 (45%), Positives = 261/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +ES+G+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  359 bits (922), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 174/379 (45%), Positives = 261/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +ES+G+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  359 bits (922), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 174/379 (45%), Positives = 261/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    + H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSVEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +ES+GV +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  358 bits (920), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 174/379 (45%), Positives = 260/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 7   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 63

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 64  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 122

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 123 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 182

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++ + ++YE
Sbjct: 183 GRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYE 242

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +E+AG+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 243 LPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 302

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 303 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 351

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 352 TFQ-QMWISKQEYDESGPS 369

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  357 bits (917), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 173/379 (45%), Positives = 261/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    + H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHGILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +ES+G+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  357 bits (917), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 172/379 (45%), Positives = 260/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKNNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           ++FE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 122 ILFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +L+ RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++ + ++YE
Sbjct: 182 GRDITDYLMKILAERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSAVEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +E+AG+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  357 bits (917), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 173/379 (45%), Positives = 260/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 7   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDCYVGDEAQSKR 63

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 64  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 122

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 123 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 182

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++ + ++YE
Sbjct: 183 GRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDYDQEMQTAAQSSAIEKSYE 242

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +E+AG+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 243 LPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 302

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 303 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 351

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 352 TFQ-QMWISKQEYDESGPS 369

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  357 bits (917), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 174/379 (45%), Positives = 260/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           ++FE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 122 ILFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++ + ++YE
Sbjct: 182 GRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+L+ +E+AG+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  357 bits (917), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 173/379 (45%), Positives = 260/379 (68%), Gaps = 16/379 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           ++FE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+A
Sbjct: 122 ILFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++ + ++YE
Sbjct: 182 GRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
           LPDG+VI +G ERF A E LF P+++ +E+AG+ +  +N+I   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWAESGPA 383
             +  MW+SKQE+ ESGP+
Sbjct: 351 TFQ-QMWISKQEYDESGPS 368

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score =  350 bits (898), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 253/369 (68%), Gaps = 16/369 (4%)

Query: 15  FVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRSYLQISYPME 74
             K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R  L + YP+E
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKRGILTLRYPIE 57

Query: 75  NGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGG 134
           +GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM ++MFE ++   
Sbjct: 58  HGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPA 116

Query: 135 VYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194
            YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+AGRD+T +L+ 
Sbjct: 117 FYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 176

Query: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELPDGRVIKVG 254
           +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YELPDG+VI +G
Sbjct: 177 ILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIG 236

Query: 255 QERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPS 314
            ERF A E LF P+++ +ESAG+ +  +N+I   D+DVR  LY  IV+SGG++M+PG+  
Sbjct: 237 NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 296

Query: 315 RIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSK 374
           R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+   +  MW+SK
Sbjct: 297 RMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTFQ-QMWISK 344

Query: 375 QEWAESGPA 383
           QE+ ESGP+
Sbjct: 345 QEYDESGPS 353

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score =  347 bits (890), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 170/369 (46%), Positives = 252/369 (68%), Gaps = 16/369 (4%)

Query: 15  FVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRSYLQISYPME 74
             K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R  L + YP+E
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKRGILTLRYPIE 57

Query: 75  NGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGG 134
           +GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +++FE ++   
Sbjct: 58  HGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQILFETFNVPA 116

Query: 135 VYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194
            YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    L H   R+D+AGRD+T +L+ 
Sbjct: 117 FYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMK 176

Query: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELPDGRVIKVG 254
           +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++ + ++YELPDG+VI +G
Sbjct: 177 ILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELPDGQVITIG 236

Query: 255 QERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPS 314
            ERF A E LF P+L+ +E+AG+ +  +N+I   D+DVR  LY  IV+SGG++M+PG+  
Sbjct: 237 NERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 296

Query: 315 RIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSK 374
           R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+   +  MW+SK
Sbjct: 297 RMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTFQ-QMWISK 344

Query: 375 QEWAESGPA 383
           QE+ ESGP+
Sbjct: 345 QEYDESGPS 353

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score =  296 bits (759), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 159/388 (40%), Positives = 237/388 (61%), Gaps = 21/388 (5%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + PIVLD G+G +K G +GE  P     S++G P       G L     +  IG +A  +
Sbjct: 9   NQPIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLE---GEQFIGNQAQEL 65

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ YP+E+GI+KNW+DMEL+W++ F++ ++L +     VL TE PLNPLKNRE MC
Sbjct: 66  RGLLKLRYPLEHGIVKNWSDMELIWNHVFHKSLQLNNIEEHPVLATEAPLNPLKNREAMC 125

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           E++FE ++   VYV+IQAVL+LYA G ++G V+D GDG  H VPV++   L    RR+DV
Sbjct: 126 EMLFETFNVPAVYVSIQAVLSLYASGRTTGCVLDCGDGCCHSVPVFDGFSLPSSIRRIDV 185

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYD--LELDTKLARETTTLV 240
           AGRDVT  L  LL +  G +   +++ E VR IKEK CYV+ D   E  T     T+T+ 
Sbjct: 186 AGRDVTEFLQLLLRKTTGVSLLSSSEREIVRIIKEKACYVARDPLTEEQTYHLTPTSTI- 244

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
             ++LPDG+V+ +  E+F A E LFQP L+  E   + E+   +I   D+D+R +L   I
Sbjct: 245 --FKLPDGKVLDLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNI 302

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGG++M+PG   R+  EL+ L       ++P    + K++I  PP RK+  +IGG++L
Sbjct: 303 VLSGGTTMFPGFGDRLLTELRNL-------SEP----QTKIKIFAPPERKYSTWIGGSIL 351

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKF 388
           + +   K  +W++K EW E+     ++F
Sbjct: 352 SGLSTFKK-IWVTKSEWQENPDCVHSRF 378

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score =  289 bits (740), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 135/292 (46%), Positives = 203/292 (69%), Gaps = 4/292 (1%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP  +    G   +  KD  +G+EA + R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVG---MGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCE 124
             L + YP+E+GI+ NW DME +W + FY ++++ +     VLLTE P+NP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV-APEEHPVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G ++G+V+DSGDGVTH+VP+Y    + H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHGILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D E + + A +++++ ++YE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSL 296
           LPDG+VI +G ERF A E LF P+++ +ES+G+ +  +N+I   D+DVR  L
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKEL 293

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score =  291 bits (744), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 151/386 (39%), Positives = 231/386 (59%), Gaps = 17/386 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + P+VLD G+G +K G +GE  P     S++G         G L     D  IG +A  +
Sbjct: 35  NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLE---GDTFIGNQAQEL 91

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ YP+++GI+ NW DME +W Y F + ++L +      L+TE PLNP KNREKMC
Sbjct: 92  RGLLKLRYPLQHGIVTNWADMEQVWGYVFNKSLQLQNVEDHPNLVTEAPLNPHKNREKMC 151

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           E++FE ++   +YV++QAVL+LYA G ++G V+D GDG  H VPV++   +    RR+D+
Sbjct: 152 ELLFESFNVPALYVSVQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSVPSSIRRIDI 211

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVEN 242
           AGRD+T  L  LL +  G +   +++ E VR IKEK C+V+ D +L+ +      +    
Sbjct: 212 AGRDITEFLQLLLRKTTGVSLLSSSEREIVRTIKEKACFVTKDPKLEEQNFPMNPSF-SK 270

Query: 243 YELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVL 302
           ++LPDG+ I++GQER+ A E LFQP L+  E   + ++ + +I   D+D+RS LY  I+L
Sbjct: 271 FKLPDGKTIELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILL 330

Query: 303 SGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
           SGG+SM PG   R+ KELK L  +R            K++I  PP RK+  +IGG++L+ 
Sbjct: 331 SGGTSMLPGFGDRLLKELKSLSGSRT-----------KIKIFAPPERKYSTWIGGSILSG 379

Query: 363 IMADKDHMWLSKQEWAESGPAAMAKF 388
           +   K  +W++K EW E      ++F
Sbjct: 380 LSTFKK-LWVTKSEWEEFPDCIHSRF 404

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score =  287 bits (735), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 148/389 (38%), Positives = 234/389 (60%), Gaps = 23/389 (5%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + PIVLD G+G +K G +GE  P     S++G         G L     D  IG +A  +
Sbjct: 7   NQPIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLE---GDTFIGNQAQEL 63

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ +P+E+GI+KNW+DME +W Y F + ++L +     +L+TE PLNP  NRE+MC
Sbjct: 64  RGLLKLRHPVEHGIVKNWSDMEHIWSYVFNKSLQLQNVEDHPILITEAPLNPRNNRERMC 123

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           E++FE ++   +YV+IQAVL+LYA G ++G V+D GDG  H VPV++   +    RR+D+
Sbjct: 124 ELLFESFNVPALYVSIQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSIPSSIRRIDI 183

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVEN 242
           AGRD+T  L  LL +  G +   +++ E VR IKEK CYV+ D  ++     +  ++  N
Sbjct: 184 AGRDITEFLQLLLRKTTGVSLLSSSEREVVRIIKEKACYVAKDPHIE----EQNFSINPN 239

Query: 243 Y---ELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKA 299
           Y   +LPDG+ I +GQE+F A E LFQP L+  E   + ++ + +I+  D+D+RS L+  
Sbjct: 240 YTKFKLPDGKTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSN 299

Query: 300 IVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAV 359
           ++LSGG+S+ PG   R+  ELK L  ++            K++I  PP RK+  +IGG++
Sbjct: 300 VLLSGGTSILPGFGDRLLSELKSLSDSQT-----------KIKIFAPPERKYSTWIGGSI 348

Query: 360 LASIMADKDHMWLSKQEWAESGPAAMAKF 388
           L+ +   K  +W+++ EW E+     ++F
Sbjct: 349 LSGLSTFK-KLWVTRAEWEEAADCIHSRF 376

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score =  286 bits (731), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 153/390 (39%), Positives = 237/390 (60%), Gaps = 25/390 (6%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + PIVLD G+G +K G  GE+ P     S+VG P       G  +    +  +G +A  +
Sbjct: 10  NQPIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFD---GNTFVGNQAQEI 66

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ +P+E+G++ +W  +E LW + F + ++L S     VL+TE PLNP KNRE+MC
Sbjct: 67  RGLLKLRHPLEHGVVTDWNALEQLWGHVFEKGLQLSSLQDHPVLVTEAPLNPKKNREQMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           E++FE +    VYV+IQAVL+LYA G ++G V+DSGDG +H VPVY+   L    RR+D+
Sbjct: 127 ELLFETFSVPAVYVSIQAVLSLYASGRTTGCVLDSGDGCSHAVPVYDGYTLPSAIRRIDI 186

Query: 184 AGRDVTRHLIDLLSRR--GYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVE 241
           AGRD++  L+ +L R+  G +   +++ E VR IKEK CY++    LD K   +  T+  
Sbjct: 187 AGRDIS-ELLQVLIRKSTGVSLLSSSEREIVRIIKEKACYIA----LDPKEEEKNYTMHG 241

Query: 242 N---YELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYK 298
               + LPDG+ I++  E+F A E LF P L+  E   + E+L+ +IQ  D+D+R+SL+ 
Sbjct: 242 KQTMFRLPDGKQIELDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFS 301

Query: 299 AIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGA 358
            IV SGG++M PG   R+ KELK       L+ +P    + K++I  PP RK+  +IGG+
Sbjct: 302 NIVFSGGTTMIPGFGDRVLKELK-------LSCEP----QTKIKIFAPPERKYSTWIGGS 350

Query: 359 VLASIMADKDHMWLSKQEWAESGPAAMAKF 388
           +L+ +   K  +W++K+EW E+     A+F
Sbjct: 351 ILSGLSTFK-KIWVTKKEWEENPRCVHARF 379

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score =  285 bits (728), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 151/388 (38%), Positives = 233/388 (60%), Gaps = 17/388 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + P+VLD G+G +K G +GE  P     S++G P       G L       +IG EA  +
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGL--ASDSQLIGNEAQKM 66

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ YP+E+G++++W  +E LW + FY  +KL +     +L+TE PLNP+KNR KMC
Sbjct: 67  RGLLKLHYPLEHGVVQDWPGLEQLWTHVFYNSLKLANIEEHPMLITEAPLNPMKNRNKMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           E++FE +    VYV+IQAVLALYA G ++G VID GDG    VPVY+   L    +R+DV
Sbjct: 127 EMLFETFGSPAVYVSIQAVLALYAGGRTTGCVIDCGDGCCQSVPVYDGFTLPSAIQRIDV 186

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDL--ELDTKLARETTTLV 240
           AGRD+T  L  LL +  G   + +++ E VR IKEK C+V+ D+  E        +  L 
Sbjct: 187 AGRDITEFLQLLLRKSSGVTLSSSSEREIVRMIKEKACFVATDVGNEEQNYEGANSAELE 246

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
             ++LPDG+++ +G E+F A E LFQP+L+  E   + E+   +I   D+D+RSSLY +I
Sbjct: 247 TRFKLPDGKILTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSI 306

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGS+M+ G   R+  E+++        ++P      K++I  PP RK+  +IGG++L
Sbjct: 307 VLSGGSTMFSGFGDRLLSEIRK-------TSEP----NTKIKIFAPPERKYSTWIGGSIL 355

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKF 388
           A  ++  + +W+++ EW E+     ++F
Sbjct: 356 AG-LSTFEKLWVTRAEWQENPQCIHSRF 382

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score =  265 bits (678), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 150/388 (38%), Positives = 238/388 (61%), Gaps = 17/388 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + P+VLD G+G +K G +GE  P     S++G P       G L+   +  ++G EA   
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSS--RGQLVGNEAQKQ 66

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ YP+E+GI+++W+ +E LW + FY  +KL +     +L+TE PLNPL+NR+KMC
Sbjct: 67  RGLLRLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLNNIGDHPMLVTEAPLNPLENRDKMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           E+++E ++   VYV+IQAVLALYA G ++G VID GDG    VPVY+   +    RR+DV
Sbjct: 127 EMLYETFNVPAVYVSIQAVLALYAGGRTTGCVIDCGDGCCQSVPVYDGFSIPSAIRRIDV 186

Query: 184 AGRDVTRHLIDLLSRR-GYAFNRTADFETVRQIKEKLCYVSYDLELDTK--LARETTTLV 240
           AGRDVT  L  LL +  G     +++ E VR IKEK CYV+ ++  + +   +   +  +
Sbjct: 187 AGRDVTEFLQLLLRKSIGVTLLSSSEREIVRMIKEKACYVAPEVAAEEQKYASSRGSEEL 246

Query: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
             ++LPDG+++ +G E+F A E LFQP L+  E   + ++ F +I   D+D+RSSLY ++
Sbjct: 247 TKFKLPDGKILSLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSL 306

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGS+++ G   R+  EL+    +R   N        K++I  PP RK+ V+IGG++L
Sbjct: 307 VLSGGSTLFAGFGDRLLNELR----SRCEPN-------VKIKIFAPPERKYSVWIGGSIL 355

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKF 388
           A  ++  + +W+++ EW E+     ++F
Sbjct: 356 AG-LSTFEKIWVTRSEWQENPQCVHSRF 382

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score =  264 bits (674), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 147/397 (37%), Positives = 233/397 (58%), Gaps = 25/397 (6%)

Query: 1   MDPHS-----PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKD-V 54
           +DP++     P+VLD G+  +K G +GE+ P     SIVG P       G +N   KD  
Sbjct: 2   LDPNAVLYSQPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSP-----RHGYVNDSSKDDT 56

Query: 55  MIGEEASAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLN 114
            +G  A   RS LQ+ +P+++G++KNW DMEL+WDY F +++KL       VL+TE PLN
Sbjct: 57  FVGNLAQERRSILQLRHPVDHGVVKNWNDMELIWDYMFKDKLKLKDVDEHPVLITEAPLN 116

Query: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVL 174
           P+ NR++MC+++FE +    +YVA  AVL+LYA G  SG V+D GDG +  VPVY+   L
Sbjct: 117 PVSNRDEMCDLLFESFGVQALYVANPAVLSLYASGKISGCVLDCGDGYSCSVPVYQGYTL 176

Query: 175 NHLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLEL-DTKL 232
               +R+D+ GRD+T  L + L    G +   + + E VR IKEK CYV+ DL++ + K 
Sbjct: 177 KSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMIKEKSCYVAVDLDIEEEKC 236

Query: 233 ARETTTLVENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDV 292
             E   +   ++LPDG+ I + ++RF+  E LFQP+++  E + + E+++ ++   D D+
Sbjct: 237 NYEGDQVGLKFKLPDGKFITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDL 296

Query: 293 RSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHM 352
           R  ++  I+LSGG++M  G  +R+ +EL +      LN   +R     V+I  PP RK+ 
Sbjct: 297 RPQMWSDILLSGGTTMLKGFGNRLVQELDK------LNQAQSR-----VKIWAPPERKYT 345

Query: 353 VFIGGAVLASIMADKDHMWLSKQEWAESGPAAMAKFG 389
            +IGG++LA  ++    + ++K +W E       K G
Sbjct: 346 SWIGGSILAE-LSTFQKIIVTKSQWQEDPSIIHTKCG 381

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score =  263 bits (671), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 139/378 (36%), Positives = 213/378 (56%), Gaps = 14/378 (3%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + P+VLD G+  +K G +G+N P     +++G P        N         IG  A   
Sbjct: 8   NQPVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKS 67

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ +PM  GI++NW DME LW + F + +K+       +L+TE PLNP KNR+KMC
Sbjct: 68  RGLLRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFDEHPLLITEAPLNPEKNRDKMC 127

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           EV FEK+DF  VY+A  + L+LYA G ++G V+D GDG    VP+YE   L    RR+DV
Sbjct: 128 EVFFEKFDFAAVYIANPSTLSLYASGRTTGCVLDCGDGYCSSVPIYEGFALPSSIRRIDV 187

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVE- 241
            GRDVT  L   +    G +   +++ E V+ +KEK CYVS D   D  ++      +  
Sbjct: 188 GGRDVTEQLQFQIRKYTGISLYSSSEHEIVKNVKEKACYVSTDFAHDEDMSNLNPEKIRC 247

Query: 242 NYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIV 301
            ++LPDG+ + + + RF A E LF+P ++ +E   V ++ F +I   D+++R  L+ +I+
Sbjct: 248 QFKLPDGKDLILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSII 307

Query: 302 LSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           L+GGS+M+ G   R+ KEL+     R  N       K  ++I  PP RK+  +IGG++L 
Sbjct: 308 LNGGSTMFRGFGDRLLKELQ----IRTGN-------KNLIKIIAPPERKYTSWIGGSILT 356

Query: 362 SIMADKDHMWLSKQEWAE 379
            +   K  +W++K EW E
Sbjct: 357 GLSTFK-QLWMTKAEWQE 373

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score =  261 bits (668), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 138/386 (35%), Positives = 217/386 (56%), Gaps = 16/386 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + PIV+D GT  +K G  GE  P     SIVG P  + ++    N    D  IG +A   
Sbjct: 12  NQPIVIDNGTNVIKGGFTGETKPRCLEYSIVGTP--KYDKIMQSNGIESDSFIGNKAQKY 69

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ +PM  G+++NW DME +W Y F + + L + +   +L+TEPPLN + NR+KMC
Sbjct: 70  RGILKLRHPMLRGVVQNWDDMETIWQYVFDDTLYLENLNEHPILITEPPLNNMANRQKMC 129

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           E +FE + F  VY+++  VL+LYA G ++G  +D GDG    +PVY    L    +++D+
Sbjct: 130 EALFEIFGFPAVYISVSPVLSLYASGQTTGCAVDCGDGYCTSIPVYNGFSLASSVKKIDI 189

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDT-KLARETTTLVE 241
            G D+T  L   +L   G     +++ E VR IKEK+CY++ D  L+T K       +  
Sbjct: 190 GGCDITEQLQFSILKNTGLFMYSSSEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMAS 249

Query: 242 NYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIV 301
            ++LPDG+++ + Q ++ + E LF+P L+  E   + E+ + +I+  D D+R  LY  IV
Sbjct: 250 QFKLPDGKMLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIV 309

Query: 302 LSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++M PG  SR+ KEL+ L             D  K+RI  PP RK+  +IGG++L+
Sbjct: 310 LSGGTTMCPGFGSRLLKELQTL----------TGYDT-KIRIIAPPERKYTSWIGGSILS 358

Query: 362 SIMADKDHMWLSKQEWAESGPAAMAK 387
             ++    +W++K  W E      +K
Sbjct: 359 G-LSTFSKIWVTKSMWEEDNKIIHSK 383

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score =  254 bits (650), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 139/378 (36%), Positives = 218/378 (57%), Gaps = 21/378 (5%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + PIVLD G+  +K G  G++ P     S++G P       G +    K   +G  A   
Sbjct: 11  NQPIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVE---KGKFVGNLAQEY 67

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ YPM++GII+NW  ME +WD+ F + +K+ +     +++TE PLNP  NREKMC
Sbjct: 68  RGLLKLRYPMDHGIIENWEHMETVWDHIFKDCLKVSNLGEHPLVVTEAPLNPKPNREKMC 127

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           E +FE ++   +Y+A  AVL+LYA G ++G V+++GDG    VP+YE   L    RR+D+
Sbjct: 128 ETLFESFNIPALYIANPAVLSLYASGRTTGCVVEAGDGYCSSVPIYEGFALTPSIRRIDI 187

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTK---LARETTTL 239
            GRD+T+HL + L    G     +++ E VR IKE  CY+  + + + +   L +E  ++
Sbjct: 188 GGRDITKHLQLQLRKSTGMWLYSSSEQEIVRLIKENGCYICSNHKKEEEKFLLDQEKKSI 247

Query: 240 VENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKA 299
             +++LPDG+ + +G  RF A E LF P L+  E + + +++  +I   DID+RS L   
Sbjct: 248 --SFKLPDGKNLVIGPGRFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNN 305

Query: 300 IVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAV 359
           I LSGGS+M+ G   R+  EL           D +     KVRI  PP RK+  FIGG++
Sbjct: 306 ITLSGGSTMFQGFCDRLITEL-----------DFSVDKTTKVRILAPPERKYSAFIGGSI 354

Query: 360 LASIMADKDHMWLSKQEW 377
           LA++   ++ MW++K +W
Sbjct: 355 LANLSTFRN-MWVTKDQW 371

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score =  251 bits (641), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 137/387 (35%), Positives = 219/387 (56%), Gaps = 17/387 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + P+V+D GTG +K+G  G++ P     +IVG P       G L+    ++ IG +A   
Sbjct: 8   NQPVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFDKVMIGGLD---DNMYIGNKAQEN 64

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ +PME+G +K+W +ME +W +     + +       +L+TE PLN  KNRE MC
Sbjct: 65  RGLLRLRHPMEHGEVKHWDEMEAVWKHTLLHDLNIQHIEEHPILITEAPLNSSKNREHMC 124

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           E++FE ++   ++V   AVLALY+ G ++G VID G+G    VP+YE   L    RR+D+
Sbjct: 125 EILFESFNIPAIHVENPAVLALYSGGRTTGCVIDCGEGYCSAVPIYEGFALTPSIRRIDI 184

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-ELDTKLARETTTLVE 241
            GR++T  L   +    G +   + + E VR IKE+ CYV+ D+ + + K   ++ +   
Sbjct: 185 GGREITEQLQFQIRKSVGMSLFSSNEKEIVRTIKERACYVADDISKEEHKYILDSESNSS 244

Query: 242 NYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIV 301
            ++LPDG+ + +G  RF A E LF P L+  ES  V E++F T+   DID+R  LYK++V
Sbjct: 245 KFKLPDGKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLV 304

Query: 302 LSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           L+GG+++ PG  +RI KEL+ L           + D  K+RI   P RK+  +IGG++LA
Sbjct: 305 LNGGTTVLPGFGNRILKELQIL----------TKQDT-KLRIIASPERKYTTWIGGSILA 353

Query: 362 SIMADKDHMWLSKQEWAESGPAAMAKF 388
             ++    + ++K  W E      + F
Sbjct: 354 G-LSTFQKILVTKSNWNEDRSRVYSSF 379

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  245 bits (626), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 126/378 (33%), Positives = 219/378 (57%), Gaps = 17/378 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + PIV+D G+G +K G +GE  P     S+VG       ++  L     D  +G +A  +
Sbjct: 12  NQPIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHA---KYDKVMLEGLQGDTFVGNKAQRL 68

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ YP+E+G++++W  MEL+W +   E ++L +     +L+TE P+NPLKNRE M 
Sbjct: 69  RGLLRLQYPIEHGVVEDWDSMELIWAHILNEVLQLQNIEEHPLLITEAPMNPLKNREVMA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           +V+FE ++   +YV+  AVL+LYA G ++G VID G+G    VP+Y+   L     R+D+
Sbjct: 129 QVLFETFNLPALYVSNPAVLSLYASGRTTGCVIDCGEGYCSTVPIYDGFALPASMMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLEL-DTKLARETTTLVE 241
            GRD+T+ L   L    G +   +++ E VR IKEK+CY++ D++  +    +E+  L  
Sbjct: 189 GGRDITKQLQFQLRKSAGVSLFSSSEREIVRTIKEKVCYLATDIKKEENTYMQESQDLTS 248

Query: 242 NYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIV 301
            ++LPDG+ I++G +R+ A E LF P ++     G+ ++   +I   D+D+R++L  +I+
Sbjct: 249 VFKLPDGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSII 308

Query: 302 LSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+   +T+  +         K++I  PP RK+  ++GG++L 
Sbjct: 309 LSGGTTTLRGFGDRMLHDLEA--FTKGTS---------KIKIIAPPERKYTTWVGGSILT 357

Query: 362 SIMADKDHMWLSKQEWAE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQRLWTKKSDWLE 374

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score =  244 bits (623), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 126/378 (33%), Positives = 212/378 (56%), Gaps = 17/378 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + P+V+D G+G +K G +GE  P      +VG       ++  L     D  IG  A  +
Sbjct: 12  NQPVVIDNGSGIIKAGFSGEERPKALEYCLVGNT---KYDKVMLEGLQGDTFIGNNAQKL 68

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ YP+++G++++W  MEL+W Y   E ++L +     +L+TE P+NPLKNRE+M 
Sbjct: 69  RGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           +V+FE +D   +YV+  AVL+LYA G ++G V+D G+G    VP+Y+   L     R+D+
Sbjct: 129 QVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLEL-DTKLARETTTLVE 241
            G D+T  L   L    G +   +++ E VR +KEK+CY++ +++  + K  + T  L+ 
Sbjct: 189 GGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLIS 248

Query: 242 NYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIV 301
            ++LPDGR I+VG +R+ A E LF P ++ +   G+ ++   +I   D+D+R  L  +I+
Sbjct: 249 TFKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSII 308

Query: 302 LSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+      LW    L    +     K++I  P  RK+  +IGG++L 
Sbjct: 309 LSGGTTTLKGFGDRM------LWDLEALTKGTS-----KIKIIAPSERKYTTWIGGSILT 357

Query: 362 SIMADKDHMWLSKQEWAE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQRLWTKKSDWLE 374

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  242 bits (617), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 127/378 (33%), Positives = 215/378 (56%), Gaps = 17/378 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + PIV+D G+G +K G +GE  P     S+VG       ++  L     D  +G +A  +
Sbjct: 12  NQPIVIDNGSGIIKAGFSGEERPKALEYSLVGHT---KYDKVMLEGLQGDTFVGNKAQKL 68

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ YPM++G++++W  MEL+W Y   E ++L +     +L+TE P+NPLKNRE + 
Sbjct: 69  RGLLRLRYPMKHGVVEDWDSMELIWSYVLNEVLQLQNIEEHPLLITEAPMNPLKNREMIA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           +VMFE ++   +YV+  AVL+LYA G ++G V+D G+G    VP+Y+   L     R+D+
Sbjct: 129 QVMFETFNLSAIYVSDPAVLSLYASGRTTGCVVDCGEGYCSSVPIYDGFALPASIMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDT-KLARETTTLVE 241
            G D+T  L   +    G +   +++ E VR IKEK+CY++ D + +  K  + T  L+ 
Sbjct: 189 GGGDITEQLQFQIRKSAGVSLFSSSEREIVRTIKEKVCYLAKDAKKEEDKYLQGTQDLIS 248

Query: 242 NYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIV 301
            ++LPDG+ I+VG +R+ A E LF P ++     G+  +   +I   D+D+R +L  +++
Sbjct: 249 AFKLPDGKSIEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVI 308

Query: 302 LSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+ L  T+  +         K++I  PP RK+  +IGG++L 
Sbjct: 309 LSGGTTTLKGFGDRMLHDLEAL--TKGTS---------KIKIIAPPERKYTAWIGGSILT 357

Query: 362 SIMADKDHMWLSKQEWAE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQKLWTKKSDWLE 374

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  241 bits (615), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 124/378 (32%), Positives = 213/378 (56%), Gaps = 17/378 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + PIV+D G+G +K+G +GE  P     S+VG       E+  L     D  +G +A  +
Sbjct: 12  NQPIVIDNGSGIIKVGFSGEERPKALEYSLVGHV---KYEKVMLEGLQGDTFVGNKAQKL 68

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ YPM +G++++W  MEL+W Y   E ++L +     +L+TE P+NPLKNRE M 
Sbjct: 69  RGLLRLRYPMTHGVVEDWDSMELIWSYMLNEVLQLQNIEEHPLLITEAPMNPLKNREVMA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           +V+FE ++   +Y++  AVL+LYA G ++G V+D G+G    VP+Y+   L     R+D+
Sbjct: 129 QVLFETFNLPALYISNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASIMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDT-KLARETTTLVE 241
            GRD+T  L   L    G +   +++ E VR IKEK+CY++ +++ +  +  +    L  
Sbjct: 189 GGRDITEQLQFQLRKSAGISLFSSSELEVVRMIKEKVCYLAKNIKKEEDRYLQGHHDLGS 248

Query: 242 NYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIV 301
            ++LPDG+ I++G +R+ A E LF P ++     G+ ++   +I   D+D+R +L  +I+
Sbjct: 249 VFKLPDGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSII 308

Query: 302 LSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+ L                K++I  PP RK+  ++GG++L 
Sbjct: 309 LSGGTTTLRGFGERMLHDLEAL-----------SKGTCKIKIIAPPERKYTTWVGGSILT 357

Query: 362 SIMADKDHMWLSKQEWAE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQKLWTKKSDWLE 374

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score =  240 bits (612), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 129/383 (33%), Positives = 214/383 (55%), Gaps = 23/383 (6%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRP----ILRAEERGNLNIPLKDVMIGEE 59
           + PIV+D G+  +K G + ++ P     ++ G P    I+   +  NL     D  IG  
Sbjct: 9   NQPIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENL-----DKYIGNR 63

Query: 60  ASAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNR 119
           A ++R  L++ +PM  G++ NW DMELLW + F + + + +     +L+TE PL   K R
Sbjct: 64  AQSIRGLLRLQHPMNRGVVDNWDDMELLWWHIFNDTLNVQNIEEHPLLITEAPLTIEKQR 123

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTR 179
             MCE +FE ++   +YVA  +VL+LYA G ++G V+D GDG     P+YE  VL    R
Sbjct: 124 HIMCERLFETFNIPSLYVANPSVLSLYASGNTTGCVVDCGDGYCSSTPIYEGFVLPASIR 183

Query: 180 RLDVAGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-ELDTKLARETT 237
           +++V GRD+T HL   +    G +   + + E VR IKEK+CY+S D  + +        
Sbjct: 184 KMEVGGRDITEHLQFQIRKSSGISLYSSNEKEIVRTIKEKVCYISEDFNKSEESYYLRQD 243

Query: 238 TLVENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLY 297
            +   ++LPDG+ + + +ERF + E LF P L+ +E+  V  + F +I   D+++R  L+
Sbjct: 244 EMSCKFKLPDGKELTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLF 303

Query: 298 KAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGG 357
             I+L+GGS+++ G  SR+  +L++L   R            K++I  PP RK+  +IGG
Sbjct: 304 SNILLTGGSTLFKGFGSRLLGDLQELTNNRA-----------KIKILAPPERKYTSWIGG 352

Query: 358 AVLASIMADKDHMWLSKQEWAES 380
           ++L  +   K+ +W++K +W ES
Sbjct: 353 SILTGLSTFKN-LWVTKSDWEES 374

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score =  238 bits (607), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 132/378 (34%), Positives = 205/378 (54%), Gaps = 17/378 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + P+V+D G+  VK G  GE  P     S++G         G L     D  +G +A  +
Sbjct: 9   NQPVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLEC---DSFVGNKAQRL 65

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R  L++ +PME G++ +W DMELLW +  ++ ++L S     +L+TE PLNP  N+EKM 
Sbjct: 66  RGLLKLKHPMERGVVSDWDDMELLWSHILFDSLQLTSGMEHPLLITEAPLNPESNKEKML 125

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           EV FE ++   + V+I  VL+LYA G ++G V+D G+G    VPV E   L    +R+++
Sbjct: 126 EVFFETFNIPAICVSIPGVLSLYASGRTTGCVVDCGEGYCSSVPVCEGYTLASSIKRINL 185

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYD-LELDTKLARETTTLVE 241
            G DVT+ L   L    G     + + E VR +KEK CYVS + L+ + K   E   +  
Sbjct: 186 GGIDVTKQLQFQLRKESGVWLFSSGERELVRTMKEKSCYVSLNQLKDEEKFTFEPGKMNT 245

Query: 242 NYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIV 301
           N++LPDG ++ + + RF A E LFQP ++  E   + E+   +I S D+++R  L   I 
Sbjct: 246 NFKLPDGNMLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRIT 305

Query: 302 LSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++M+ G   R  +EL+            +   K  +RI  PP RK+  +IGG++LA
Sbjct: 306 LSGGTTMFRGFGDRFLQELQI-----------STCKKSNIRILAPPERKYTAWIGGSMLA 354

Query: 362 SIMADKDHMWLSKQEWAE 379
            +   +  M  +K +W E
Sbjct: 355 GLTTFR-KMLTTKSDWRE 371

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score =  225 bits (573), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/395 (33%), Positives = 216/395 (54%), Gaps = 29/395 (7%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKD-VMIGEEASA 62
           + P+VLD G+  +K G +G+  P     ++ G+P  +      +   L+D   +G EA  
Sbjct: 11  NQPVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKV----MTTGLEDRTFVGNEAQR 66

Query: 63  VRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGG----KVLLTEPPLNPLKN 118
           +R  L +  P+  G + NW DMELLW + FY +++L   +       +L+TE PLN  KN
Sbjct: 67  LRGLLALRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGNSQIGDHPLLITEAPLNSTKN 126

Query: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           RE MCE+++E ++F  +YVA  AVL+LYA G ++G V++ G+G +   PVY+   L    
Sbjct: 127 RETMCEILYETFNFDALYVAHPAVLSLYATGQTTGCVLECGEGYSASTPVYQGFALPSSI 186

Query: 179 RRLDVAGRDVTRHLIDLLSRR-GYAFNRTADFETVRQIKEKLCYVSYDLELDTKL----A 233
           RR+D+ GRD+T+ L   + +  G +    ++ E VR IKEK  YV+ D + + +      
Sbjct: 187 RRIDIGGRDITQELQFYIRKSTGLSLFSNSEQEIVRTIKEKANYVALDYKFEEEKFFIHE 246

Query: 234 RETTTLVENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVR 293
           RE T+ V   +LPDG+ +  G+ ++  +E LFQP L+  E   V E+L  +I   D+D+R
Sbjct: 247 RENTSTV---KLPDGQELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLR 303

Query: 294 SSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMV 353
           + L + IVLSGG++M  G   R   E K++                KV+I     R ++ 
Sbjct: 304 TQLLENIVLSGGTTMLKGFDQRTMSETKKMLPKHT-----------KVKIRSLAERSYIA 352

Query: 354 FIGGAVLASIMADKDHMWLSKQEWAESGPAAMAKF 388
           +IGG++L+ +   ++ +WL+++ + E       KF
Sbjct: 353 WIGGSILSGLYGFRN-LWLTREMYEEDPSMVHRKF 386

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score =  192 bits (488), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 136/444 (30%), Positives = 214/444 (48%), Gaps = 67/444 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIV--------GRPILRAEERGNLNIPLKDVMIGE 58
           +V+D GTG  K+G AG + P   FP+ +        G    +A+  G  N    +   G 
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQGTATGSNKNKAQATGGSNAGGSNPYFGN 68

Query: 59  EASAVR-------------------------------------SYLQISYPMENGIIKNW 81
             SA                                       +   +SYP+ +G ++NW
Sbjct: 69  STSATSFNNLSSQMLMSNNLAGKRGTEDLDFYIGNEALIASQGASYSLSYPIRHGQVENW 128

Query: 82  TDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQA 141
             ME  W+ + ++ ++         LLTEPPLNP +NRE++ E+ FE ++  G+Y+A+QA
Sbjct: 129 DHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQIAEIFFESFNCAGLYIAVQA 187

Query: 142 VLALYAQGLSS--------GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLI 193
           VLAL A   SS        G VIDSGDGVTH++PV E  V+    + + +AGRD+T+ + 
Sbjct: 188 VLALAASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQ 247

Query: 194 DLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARETTTLVENYELPDG 248
            LL  RG A        T  +IK++ CYV  D+     + D    +    +VEN E    
Sbjct: 248 TLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYVVENQEKTQK 304

Query: 249 RVIKVGQERFEAAECLFQPNLVDVES-AGVGELLFNTIQSADIDVRSSLYKAIVLSGGSS 307
           +V+ VG ERF A E  F P +   +    +  ++  TIQ+  IDVR  LY  IVLSGGS+
Sbjct: 305 KVVDVGYERFLAPEIFFNPEIASSDFLTPLPTIVDQTIQACPIDVRKGLYNNIVLSGGST 364

Query: 308 MYPGLPSRIEKELKQLWYTRVLNND---PARLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           M+     R++++LK +   R+  N+     +     V +    ++++ V+ GG++LA   
Sbjct: 365 MFKDFGRRLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTA 424

Query: 365 ADKDHMWLSKQEWAESGPAAMAKF 388
             K +   +K+++ E GP  +  F
Sbjct: 425 EFKSYCH-TKKDYEEYGPEIVRNF 447

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score =  191 bits (486), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 143/440 (32%), Positives = 219/440 (49%), Gaps = 67/440 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVG--RPILRAEE--------------------- 43
           IV+D GTG  K+G AG + P   FP+ +   +P    ++                     
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQPSTTTKQSGSSGGVGPGSGSIQTQGVGS 68

Query: 44  ---------------RGNLNIPLKDVMIGEEASAVR---SYLQISYPMENGIIKNWTDME 85
                          RG  ++   D  IG+EA A     SY  +SYP+ +G ++NW  ME
Sbjct: 69  SSLSAALLSNNLAGKRGTEDL---DFYIGDEAIAASQGPSY-SLSYPIRHGQVENWDHME 124

Query: 86  LLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLAL 145
             W+ + ++ ++         LLTEPPLNP +NRE++ E+ FE ++  G+Y+A+QAVLAL
Sbjct: 125 RFWENSIFKYLRT-EPEDHYFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLAL 183

Query: 146 YAQGLSS--------GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLS 197
            A   SS        G VIDSGDGVTH++PV E  V+    + + +AGRD+T  +  LL 
Sbjct: 184 AASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLR 243

Query: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARETTTLVENYELPDGRVIK 252
            RG          T  +IK++ CYV  D+     + D    +    +VEN E    +VI 
Sbjct: 244 ERG---EEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDSEKFAQFIVENSEKTRRKVID 300

Query: 253 VGQERFEAAECLFQPNLVDVES-AGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPG 311
           VG ERF A E  F P +   +    +  ++  TIQ+  IDVR  LY  IVLSGGS+M+  
Sbjct: 301 VGYERFLAPEIFFNPEIASSDFLTPLPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKD 360

Query: 312 LPSRIEKELKQLWYTRVLNNDPARLDK---FKVRIEDPPRRKHMVFIGGAVLASIMADKD 368
              R++++LK +   R+  ++     K     V++    R+++ V+ GG++LA     + 
Sbjct: 361 FGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAETAEFRG 420

Query: 369 HMWLSKQEWAESGPAAMAKF 388
           +   SKQ++ E GP  +  F
Sbjct: 421 YCH-SKQDYEEIGPEIVRNF 439

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score =  191 bits (485), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 141/451 (31%), Positives = 218/451 (48%), Gaps = 78/451 (17%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIV----------------------------GRPI 38
           +V+D GTG  K+G AG + P   FP+ +                            G P 
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSNTKKSSAVATMGGSGAQPGGSAGNPY 68

Query: 39  LR---------------------AEERGNLNIPLKDVMIGEEASAVR---SYLQISYPME 74
                                  A +RG  ++   D  IG EA A     SY  +SYP+ 
Sbjct: 69  FGNSTSATSFDSLAASALLSNNLAGKRGTEDL---DFYIGNEALAASRGPSY-SLSYPIR 124

Query: 75  NGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGG 134
           +G ++NW  ME  W+ + ++ ++         LLTEPPLNP +NRE++ E+ FE ++  G
Sbjct: 125 HGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAG 183

Query: 135 VYVAIQAVLALYAQGLSS--------GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGR 186
           +Y+A+QAVLAL A   SS        G VIDSGDGVTH++PV E  V+    + + +AGR
Sbjct: 184 LYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGR 243

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARETTTLVE 241
           D+T  +  LL  RG          T  +IK++ CYV  D+     + D    +    +VE
Sbjct: 244 DITLFIQSLLRERGEV---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVE 300

Query: 242 NYELPDGRVIKVGQERFEAAECLFQPNLVDVES-AGVGELLFNTIQSADIDVRSSLYKAI 300
           N E    +++ VG ERF A E  F P +   +    +  ++  TIQ+  IDVR  LY  I
Sbjct: 301 NSESTKKKIVDVGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNI 360

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNND---PARLDKFKVRIEDPPRRKHMVFIGG 357
           VLSGGS+M+     R++++LK +   R+  ++     +     V++    R+++ V+ GG
Sbjct: 361 VLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGG 420

Query: 358 AVLASIMADKDHMWLSKQEWAESGPAAMAKF 388
           ++LA     K +   +KQ++ E GP  +  F
Sbjct: 421 SLLAQTAEFKSYCH-TKQDYEEYGPEIVRNF 450

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score =  191 bits (484), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 143/443 (32%), Positives = 213/443 (48%), Gaps = 67/443 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFP----------------------------------- 31
           IV+D GTG  K+G AG + P   FP                                   
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQRSTTKQGGSGSGAGQSQGSGNPYFGNST 68

Query: 32  ------SIVGRPILRAEERGNLNIPLKDVMIGEEASAVR---SYLQISYPMENGIIKNWT 82
                 S+    +L     G       D  IG EA A     SY  +SYP+ +G ++NW 
Sbjct: 69  SATSFNSLASAALLSNNLAGKRGTEDLDFYIGNEALAASQGPSY-SLSYPIRHGQVENWD 127

Query: 83  DMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAV 142
            ME  W+ + ++ ++         LLTEPPLNP +NRE++ E+ FE ++  G+Y+A+QAV
Sbjct: 128 HMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAV 186

Query: 143 LALYAQGLSS--------GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194
           LAL A   SS        G VIDSGDGVTH++PV E  V+    + + +AGRD+T  +  
Sbjct: 187 LALAASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQS 246

Query: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARETTTLVENYELPDGR 249
           LL  RG          T  +IK++ CYV  D+     + D    +    +VEN E    +
Sbjct: 247 LLRERG---EEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSEKTKRK 303

Query: 250 VIKVGQERFEAAECLFQPNLVDVES-AGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSM 308
           VI VG ERF A E  F P +   +    +  ++  TIQ+  IDVR  LY  IVLSGGS+M
Sbjct: 304 VIDVGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTM 363

Query: 309 YPGLPSRIEKELKQLWYTRVLNNDPARLDK---FKVRIEDPPRRKHMVFIGGAVLASIMA 365
           +     R++++LK +   R+  ++     K     V++    R+++ V+ GG++LA    
Sbjct: 364 FKDFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTAE 423

Query: 366 DKDHMWLSKQEWAESGPAAMAKF 388
            K +   +KQ++ E GP  +  F
Sbjct: 424 FKSYCH-TKQDYEEIGPEIVRNF 445

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score =  189 bits (481), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 140/441 (31%), Positives = 217/441 (49%), Gaps = 65/441 (14%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRP-------------------------ILRA 41
           IV+D GTG  K+G AG + P   FP+ +                               A
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQNHTKKTSSMSSTSNTTSSNQYFGNSTSA 68

Query: 42  EERGNLN--IPLK------------DVMIGEEASAVR---SYLQISYPMENGIIKNWTDM 84
               +LN  +PL             D  IG EA A     SY  +SYP+ +G I+NW  M
Sbjct: 69  TSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSY-SLSYPIRHGQIENWDHM 127

Query: 85  ELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + ++ ++         LLTEPPLNP +NRE++ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLSS--------GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196
           L A   SS        G VIDSGDGVTH++PV E  V+    + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARETTTLVENYELPDGRVI 251
             RG          T  +IK++ CYV  D+     + D    +    +VEN E    +++
Sbjct: 247 RERG---ETDTSLRTAERIKQEYCYVCPDIVKEFNKFDRNPDKFAQFIVENQEKTQKKIV 303

Query: 252 KVGQERFEAAECLFQPNLVDVES-AGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYP 310
            VG ERF A E  F P +   +    +  ++ +TIQ+  IDVR  LY  IVLSGGS+M+ 
Sbjct: 304 DVGYERFLAPEIFFNPEIASSDFLTPLPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFK 363

Query: 311 GLPSRIEKELKQLWYTRVLNND---PARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADK 367
               R+++++K +   R+  ++     +     V +    ++++ V+ GG++LA     K
Sbjct: 364 DFGRRLQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAVWFGGSLLAQTAEFK 423

Query: 368 DHMWLSKQEWAESGPAAMAKF 388
            +   +K+++ E GP  +  F
Sbjct: 424 SYCH-TKKDYEEYGPEIVRNF 443

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score =  189 bits (481), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 144/441 (32%), Positives = 220/441 (49%), Gaps = 65/441 (14%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFP--------------SIVGRPILRAEE--------- 43
           +V+D GTG  K+G AG + P   FP              S VG P   + E         
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFGNSTS 68

Query: 44  -------RGNL---NIPLK------DVMIGEEA---SAVRSYLQISYPMENGIIKNWTDM 84
                   G L   N+  K      D  IG EA   S   SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + ++ ++         LLTEPPLNP +NRE++ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLSS--------GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196
           L A   SS        G VIDSGDGVTH++PV E  V+    + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARETTTLVENYELPDGRVI 251
             RG A        T  +IK++ CYV  D+     + D   ++    +VEN E    +V+
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGQERFEAAECLFQPNLVDVES-AGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYP 310
            +G ERF A E  F P +   +    +  ++  TIQ+  IDVR  LY  IVLSGGS+M+ 
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 363

Query: 311 GLPSRIEKELKQLWYTRVLNND---PARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADK 367
               R++++LK +   R+  ++     +     V +    ++++ V+ GG++LA     K
Sbjct: 364 DFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFK 423

Query: 368 DHMWLSKQEWAESGPAAMAKF 388
            +   +K+++ E GP  +  F
Sbjct: 424 GYCH-TKKDYEEYGPEIVRNF 443

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score =  189 bits (480), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 136/457 (29%), Positives = 219/457 (47%), Gaps = 74/457 (16%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIV-------------------------- 34
           M+ +  +V+D GTG  K+G AG + P   FP+ +                          
Sbjct: 1   MNLNPAVVMDNGTGLTKLGFAGNDSPSWIFPTAIATASPSGNKKTGSSATSSSVSGSGTN 60

Query: 35  ------------------------GRPILRAEERGNLNIPLKDVMIGEEA--SAVRSYLQ 68
                                   G+ +L     G       D  IG EA  +A      
Sbjct: 61  GSNGSSNPYFGNSTSATNFGGLTGGKMLLSNNLAGKRGTEDLDFYIGNEALVAAQSPSYS 120

Query: 69  ISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFE 128
           +SYP+ +G ++NW  ME  W+ + ++ ++         LLTEPPLNP +NRE++ E+ FE
Sbjct: 121 LSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHYFLLTEPPLNPPENREQVAEIFFE 179

Query: 129 KYDFGGVYVAIQAVLALYAQGLSS--------GVVIDSGDGVTHIVPVYESVVLNHLTRR 180
            ++  G+Y+A+QAVLAL A   SS        G VIDSGDGVTH++PV E  V+    + 
Sbjct: 180 SFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKN 239

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARE 235
           + +AGRD+T  +  LL  RG A        T  +IK++ CYV  D+     + D +  + 
Sbjct: 240 IPIAGRDITEFIQSLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEKF 296

Query: 236 TTTLVENYELPDGRVIKVGQERFEAAECLFQPNLVDVES-AGVGELLFNTIQSADIDVRS 294
              +VE+ E    +V+ VG ERF A E  F P +   +    +  ++  TIQ+  IDVR 
Sbjct: 297 AQFIVESQEKTKQKVVDVGYERFLAPEIFFNPEIASSDYLTPLPTVVDQTIQACPIDVRK 356

Query: 295 SLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDP---ARLDKFKVRIEDPPRRKH 351
            LY  IVLSGGS+M+     R+++++K +   R+  N+     +     V++    ++++
Sbjct: 357 GLYNNIVLSGGSTMFKDFSRRLQRDMKSIVNARISQNEKMTGVKSSGVDVQVISHRKQRN 416

Query: 352 MVFIGGAVLASIMADKDHMWLSKQEWAESGPAAMAKF 388
            V+ GG++LA     + +   +K+++ E GP  +  F
Sbjct: 417 AVWFGGSLLAQTAEFRGYCH-TKRDYEEIGPEIVRNF 452

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  187 bits (475), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 137/441 (31%), Positives = 215/441 (48%), Gaps = 65/441 (14%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRP----------------------------- 37
           +V+D GTG  K+G AG + P   FP+ +                                
Sbjct: 9   VVMDNGTGLTKLGFAGNDAPSWVFPTAIATAAPSNTKKSSGVGATSATGSEASYFGNATS 68

Query: 38  ----------ILRAEERGNLNIPLKDVMIGEEA---SAVRSYLQISYPMENGIIKNWTDM 84
                     +L     G       D  IG EA   S   SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + ++ ++         LLTEPPLNP +NRE++ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLSS--------GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196
           L A   SS        G VIDSGDGVTH++PV E  V+    + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARETTTLVENYELPDGRVI 251
             RG A        T  +IK++ CYV  D+     + D   ++    +VEN E    +V+
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGQERFEAAECLFQPNLVDVESAGVGELLFN-TIQSADIDVRSSLYKAIVLSGGSSMYP 310
            +G ERF A E  F P +   +      ++ + TIQ+  IDVR  LY  IVLSGGS+M+ 
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTPLPMVVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 363

Query: 311 GLPSRIEKELKQLWYTRVLNND---PARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADK 367
               R++++LK +  +R+  ++     +     V +    ++++ V+ GG++LA     K
Sbjct: 364 DFGRRLQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFK 423

Query: 368 DHMWLSKQEWAESGPAAMAKF 388
            +   +K+++ E GP  +  F
Sbjct: 424 GYCH-TKKDYEEYGPEIVRNF 443

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  187 bits (475), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 137/441 (31%), Positives = 214/441 (48%), Gaps = 65/441 (14%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRP----------------------------- 37
           +V+D GTG  K+G AG + P   FP+ +                                
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKASGVGTSSAAGNEASYFGNSTS 68

Query: 38  ----------ILRAEERGNLNIPLKDVMIGEEA---SAVRSYLQISYPMENGIIKNWTDM 84
                     +L     G       D  IG EA   S   SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + ++ ++         LLTEPPLNP +NRE++ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLSS--------GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196
           L A   SS        G VIDSGDGVTH++PV E  V+    + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARETTTLVENYELPDGRVI 251
             RG A        T  +IK++ CYV  D+     + D   ++    +VEN E    +V+
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGQERFEAAECLFQPNLVDVES-AGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYP 310
            +G ERF A E  F P +   +    +  ++  TIQ+  IDVR  LY  IVLSGGS+M+ 
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 363

Query: 311 GLPSRIEKELKQLWYTRVLNND---PARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADK 367
               R++++LK +   R+  ++     +     V +    ++++ V+ GG++LA     K
Sbjct: 364 DFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFK 423

Query: 368 DHMWLSKQEWAESGPAAMAKF 388
            +   +K+++ E GP  +  F
Sbjct: 424 GYCH-TKKDYEEYGPEIVRNF 443

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score =  187 bits (474), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 140/447 (31%), Positives = 220/447 (49%), Gaps = 71/447 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVG--RPILRAEER-------------------- 44
           +V+D GTG  K+G AG + P   FP+ +   +P   A+                      
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSKTAKSSSMSGMGQSGSGMGAGGSAFF 68

Query: 45  GNL-----------------NIPLK------DVMIGEEASAVR---SYLQISYPMENGII 78
           GN                  N+  K      D  IG EA A     SY  +SYP+ +G +
Sbjct: 69  GNTTSATSFTGFTSSSLMSNNLAGKRGTEDLDFYIGNEALAAAQGPSY-SLSYPIRHGQV 127

Query: 79  KNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVA 138
           ++W  ME  W+ + ++ ++         LLTEPPLNP +NRE++ E+ FE ++  G+Y+A
Sbjct: 128 EDWNHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIA 186

Query: 139 IQAVLALYAQGLSS--------GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTR 190
           +QAVLAL A   SS        G VIDSGDGVTH++PV E  V+    + + +AGRD+T 
Sbjct: 187 VQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITL 246

Query: 191 HLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARETTTLVENYEL 245
            +  LL  RG          T  +IK++ CYV  D+     + D    +    +VEN E 
Sbjct: 247 FIQSLLRERGEV---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDATKFAQFIVENKEK 303

Query: 246 PDGRVIKVGQERFEAAECLFQPNLVDVES-AGVGELLFNTIQSADIDVRSSLYKAIVLSG 304
              +V+ VG ERF A E  F P +   +    +  ++  TIQ+  IDVR  LY  IVLSG
Sbjct: 304 TQKKVVDVGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSG 363

Query: 305 GSSMYPGLPSRIEKELKQLWYTRVLNND---PARLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           GS+M+     R++++L+ +   R+  ++     +    +V++    R+++ V+ GG++LA
Sbjct: 364 GSTMFKDFGRRLQRDLRSIVNNRIAQSELLSGTKSTGVEVQVISHRRQRNAVWFGGSLLA 423

Query: 362 SIMADKDHMWLSKQEWAESGPAAMAKF 388
                K +   +K+++ E GP  +  F
Sbjct: 424 QTAEFKSYCH-TKKDYEEYGPQIVRNF 449

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score =  187 bits (474), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 137/449 (30%), Positives = 219/449 (48%), Gaps = 72/449 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSI-------------------------VGRPILRA 41
           IV+D GTG  K+G AG + P   FP+                          V  P    
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQSSNAKSSANAPQGLGNAKAGVSNPATSN 68

Query: 42  EERGNL-----------------NIPLK------DVMIGEEA--SAVRSYLQISYPMENG 76
              GN                  N+  K      D  IG EA  ++      +SYP+ +G
Sbjct: 69  PYFGNSTSATSFASNSNAFLLSNNLAGKRGTEDLDFYIGNEALVASQGPAYSLSYPIRHG 128

Query: 77  IIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVY 136
            ++NW  ME  W+ + ++ ++         LLTEPPLNP +NRE++ E+ FE ++  G+Y
Sbjct: 129 QVENWDHMERFWENSIFKYLRA-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLY 187

Query: 137 VAIQAVLALYAQGLS--------SGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDV 188
           +A+QAVLAL A   S        +G VIDSGDGVTH++PV E  V+    + + +AGRD+
Sbjct: 188 IAVQAVLALAASWTSAQVTDRSLTGTVIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDI 247

Query: 189 TRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARETTTLVENY 243
           T  +  LL  RG A    +  +T  +IK++ CYV  D+     + D +  +    ++EN 
Sbjct: 248 TLFIQSLLRERGEA---DSSLKTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIENQ 304

Query: 244 ELPDGRVIKVGQERFEAAECLFQPNLVDVES-AGVGELLFNTIQSADIDVRSSLYKAIVL 302
           +    +VI +G ERF A E  F P +   +    +  ++  TIQ+  IDVR  LY  IVL
Sbjct: 305 DKTTKKVIDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVL 364

Query: 303 SGGSSMYPGLPSRIEKELKQLWYTRVLNNDP---ARLDKFKVRIEDPPRRKHMVFIGGAV 359
           SGGS+M+     R+++++K +   R+  N+     +     V++    ++++ V+ GG++
Sbjct: 365 SGGSTMFKDFSRRLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGGSL 424

Query: 360 LASIMADKDHMWLSKQEWAESGPAAMAKF 388
           LA     K +   +K+++ E GP  +  F
Sbjct: 425 LAQTAEFKGYCH-TKKDYEEHGPEIVRNF 452

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score =  185 bits (469), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 114/379 (30%), Positives = 186/379 (49%), Gaps = 18/379 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
           + P++LD G+  +K G AG   PD    + +G P+    ER  + +  K+  IG  A   
Sbjct: 10  NQPVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPL---AERSMVTVSNKETYIGNSAYER 66

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           R+ L +  P     I +W  +E LWDY    ++++       V+LT       K  EKMC
Sbjct: 67  RATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTSKKEEEKMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           EV+FEK+    +Y +   +++LY  G ++G  +  G     I  V + +++   ++  + 
Sbjct: 127 EVLFEKFSIPAIYCSRDPIMSLYGLGRTTGCSVSCGHRGIGITTVIDGMIVGGSSQISNT 186

Query: 184 AGRDVTRHLIDLLSRRGYAF-NRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVEN 242
            G  VT  ++DLL        N     E +R IKE+ C +S D   + +     T+   N
Sbjct: 187 GGSAVTNTMLDLLRHNHPKLENGQNGIELIRSIKERCCVLSKDFYNEIRAYELITSKTSN 246

Query: 243 --YELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300
             Y LPDG +I++G ERFEA E +F P         + +++ N+I  A I  RS L ++I
Sbjct: 247 NKYRLPDGNIIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESI 306

Query: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSS+  G   R+ KE+++     +  N        K+ +  P  R+ + +IGG+VL
Sbjct: 307 VLSGGSSLIKGFGERLTKEIRK----EIDGNQ-------KIMLNAPHERRFLPWIGGSVL 355

Query: 361 ASIMADKDHMWLSKQEWAE 379
           + +   K  +W SK  + E
Sbjct: 356 SGLSTMK-LLWKSKSAYRE 373

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score =  186 bits (473), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 122/356 (34%), Positives = 197/356 (55%), Gaps = 26/356 (7%)

Query: 53  DVMIGEEA---SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLT 109
           D  IG EA   S   SY  +SYP+ +G I+NW  ME  W+ + ++ ++         LLT
Sbjct: 105 DFYIGNEALIASQGPSY-SLSYPIRHGQIENWDHMERFWENSIFKYLR-AEPEDHFFLLT 162

Query: 110 EPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS--------GVVIDSGDG 161
           EPPLNP +NRE++ E+ FE ++  G+Y+A+QAVLAL A   SS        G VIDSGDG
Sbjct: 163 EPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSQVTDRSLTGTVIDSGDG 222

Query: 162 VTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221
           VTH++PV E  V+    + + +AGRD+T  +  LL  RG A        T  +IK++ CY
Sbjct: 223 VTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA---DTSLRTAERIKQEYCY 279

Query: 222 VSYDL-----ELDTKLARETTTLVENYELPDGRVIKVGQERFEAAECLFQPNLVDVES-A 275
           V  D+     + D +  +    ++EN +    +V+ +G ERF A E  F P +   +   
Sbjct: 280 VCPDIVKEFNKFDRQPEKFAQFIIENQDKTKQKVVDIGYERFLAPEIFFNPEIASSDFLT 339

Query: 276 GVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDP-- 333
            +  ++ +TIQ+  IDVR  LY  IVLSGGS+M+     R+++++K +  +R++ N+   
Sbjct: 340 PLPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDIKSIVNSRIIQNEAVT 399

Query: 334 -ARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWAESGPAAMAKF 388
             +     V++    ++++ V+ GG++LA     K +   +K+++ E GP  +  F
Sbjct: 400 GVKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPEIVRNF 454

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 7  IVLDQGTGFVKIGRAGENFPDHTFPSIVG 35
          IV+D GTG  K+G AG + P   FP+ + 
Sbjct: 9  IVMDNGTGLTKLGYAGNDSPSWIFPTSIA 37

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score =  186 bits (473), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 140/448 (31%), Positives = 214/448 (47%), Gaps = 72/448 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFP----------------------------------- 31
           +V+D GTG  K+G AG + P   FP                                   
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQSGKSQSSSNKSTGFGSSSANAQSSYLSG 68

Query: 32  -----------SIVGRPILRAEERGNLNIPLKDVMIGEEA---SAVRSYLQISYPMENGI 77
                      S+    ++     G       D  IG EA   S   SY  +SYP+ +G 
Sbjct: 69  GGNSTSATDFNSLASSTLISNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQ 127

Query: 78  IKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYV 137
           ++NW  ME  W+ + ++ ++         LLTEPPLNP +NR+++ E+ FE ++  G+Y+
Sbjct: 128 VENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENRQQVAEIFFESFNCAGLYI 186

Query: 138 AIQAVLALYAQGLSS--------GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVT 189
           A+QAVLAL A   SS        G VIDSGDGVTH++PV E  V+    + + +AGRD+T
Sbjct: 187 AVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT 246

Query: 190 RHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARETTTLVENYE 244
             +  LL  RG    + A   T  +IK++ CYV  D+     + D    +    +VEN E
Sbjct: 247 LFIQSLLRERG---EQDASLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFIVENKE 303

Query: 245 LPDGRVIKVGQERFEAAECLFQPNLVDVES-AGVGELLFNTIQSADIDVRSSLYKAIVLS 303
               +V+ VG ERF A E  F P +   +    +  ++  TIQ+  IDVR  LY  IVLS
Sbjct: 304 RTTKKVVDVGYERFLAPEIFFNPEIASSDFLTPLPVVVDETIQACPIDVRKGLYNNIVLS 363

Query: 304 GGSSMYPGLPSRIEKELKQLWYTRVLNNDP---ARLDKFKVRIEDPPRRKHMVFIGGAVL 360
           GGS+M+     R++++LK +   R+  ++     R     V +    R+++ V+ GG++L
Sbjct: 364 GGSTMFKDFGRRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAVWFGGSLL 423

Query: 361 ASIMADKDHMWLSKQEWAESGPAAMAKF 388
           A     K +   +KQ++ E GP  +  F
Sbjct: 424 AQTGEFKSYCH-TKQDYEEYGPDIVRNF 450

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  186 bits (471), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 136/441 (30%), Positives = 213/441 (48%), Gaps = 65/441 (14%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRP----------------------------- 37
           +V+D GTG  K+G AG + P   FP+ +                                
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKASGVGASSAAGSDTSYFGNSTS 68

Query: 38  ----------ILRAEERGNLNIPLKDVMIGEEA---SAVRSYLQISYPMENGIIKNWTDM 84
                     +L     G       D  IG EA   S   SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGVTGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + ++ ++         LLTEPPLNP +NRE++ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLSS--------GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196
           L A   SS        G VIDSGDGVTH++PV E  V+    + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARETTTLVENYELPDGRVI 251
             RG A        T  +IK++ CYV  D+     + D   ++    +VEN E    + +
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKAV 303

Query: 252 KVGQERFEAAECLFQPNLVDVES-AGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYP 310
            +G ERF A E  F P +   +    +  ++  TIQ+  IDVR  LY  IVLSGGS+M+ 
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 363

Query: 311 GLPSRIEKELKQLWYTRVLNND---PARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADK 367
               R++++LK +   R+  ++     +     V +    ++++ V+ GG++LA     K
Sbjct: 364 DFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFK 423

Query: 368 DHMWLSKQEWAESGPAAMAKF 388
            +   +K+++ E GP  +  F
Sbjct: 424 GYCH-TKKDYEEYGPEIVRNF 443

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score =  186 bits (471), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 139/446 (31%), Positives = 216/446 (48%), Gaps = 70/446 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIV-------------------------GRP---- 37
           +V+D GTG  K+G AG + P   FP+ +                         G P    
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQGGSSSNAKKSMSSSAASSATAGNPYYGN 68

Query: 38  ---------------ILRAEERGNLNIPLKDVMIGEEA---SAVRSYLQISYPMENGIIK 79
                          +L     G       D  IG EA   S   SY  +SYP+ +G ++
Sbjct: 69  STSATSFNDNNLSSMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVE 127

Query: 80  NWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAI 139
           NW  ME  W+ + ++ ++         LLTEPPLNP +NRE++ E+ FE ++  G+Y+A+
Sbjct: 128 NWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQIAEIFFESFNCAGLYIAV 186

Query: 140 QAVLALYAQGLSS--------GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRH 191
           QAVLAL A   SS        G VIDSGDGVTH++PV E  V+    + + +AGRD+T  
Sbjct: 187 QAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLF 246

Query: 192 LIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARETTTLVENYELP 246
           +  LL  RG A        T  +IK++ CYV  D+     + D    +    +VEN E  
Sbjct: 247 IQSLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQEST 303

Query: 247 DGRVIKVGQERFEAAECLFQPNLVDVES-AGVGELLFNTIQSADIDVRSSLYKAIVLSGG 305
             +++ VG ERF A E  F P +   +    +  ++  TIQ+  IDVR  LY  IVLSGG
Sbjct: 304 RKKIVDVGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGG 363

Query: 306 SSMYPGLPSRIEKELKQLWYTRVLNND---PARLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
           S+M+     R++++LK +   R+  ++     +     V++    ++++ V+ GG++LA 
Sbjct: 364 STMFKDFGRRLQRDLKGIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAVWFGGSLLAQ 423

Query: 363 IMADKDHMWLSKQEWAESGPAAMAKF 388
               K +   +K+++ E GP  +  F
Sbjct: 424 TAEFKGYCH-TKKDYDEYGPEIVRNF 448

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score =  185 bits (469), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 134/446 (30%), Positives = 220/446 (49%), Gaps = 70/446 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNL------------------- 47
           +V+D GTG  K+G AG + P   FP+ +        ++  +                   
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQASNTKKSTVVNKSSAGGADSSGSGYFGN 68

Query: 48  -------------------NIPLK------DVMIGEEASAV---RSYLQISYPMENGIIK 79
                              N+  K      D  IG EA A    +SY  +SYP+ +G ++
Sbjct: 69  STSATSFNSGDMSSLLLSNNLAGKRGTEDLDFYIGNEALAAAQGQSY-SLSYPIRHGQVE 127

Query: 80  NWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAI 139
           NW  ME  W+ + ++ ++         LLTEPPLNP +NRE++ E+ FE ++  G+Y+A+
Sbjct: 128 NWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAV 186

Query: 140 QAVLALYAQGLS--------SGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRH 191
           QAVLAL A   S        +G VIDSGDGVTH++PV E  V+    + + +AGRD+T  
Sbjct: 187 QAVLALAASWTSPKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLF 246

Query: 192 LIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----ELDTKLARETTTLVENYELP 246
           +  LL  RG    +    +T  +IK++ CYV  D+     + D   ++    +VE+ E  
Sbjct: 247 IQQLLRERG---EQDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDASKFAQFVVESQEKT 303

Query: 247 DGRVIKVGQERFEAAECLFQPNLVDVES-AGVGELLFNTIQSADIDVRSSLYKAIVLSGG 305
             +++ VG ERF A E  F P +   +    +  ++  TIQ+  IDVR  LY  IVLSGG
Sbjct: 304 RKKIVDVGYERFLAPEIFFNPEIASSDFLTPLPTVVDETIQACPIDVRKGLYNNIVLSGG 363

Query: 306 SSMYPGLPSRIEKELKQLWYTRVLNNDPARLDK---FKVRIEDPPRRKHMVFIGGAVLAS 362
           S+M+     R+++++K +   R+  ++     K     V++    ++++ V+ GG++LA 
Sbjct: 364 STMFKDFGRRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQ 423

Query: 363 IMADKDHMWLSKQEWAESGPAAMAKF 388
               K +   +K+++ E GP  +  F
Sbjct: 424 TAEFKSYCH-TKKDYDEYGPEIVRNF 448

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score =  184 bits (466), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 126/358 (35%), Positives = 197/358 (55%), Gaps = 30/358 (8%)

Query: 53  DVMIGEEA---SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLT 109
           D  IG EA   S   SY  +SYP+ +G ++NW  ME  W+ + ++ ++         LLT
Sbjct: 107 DFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLT 164

Query: 110 EPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS--------GVVIDSGDG 161
           EPPLNP +NRE++ E+ FE ++  G+Y+A+QAVLAL A   SS        G VIDSGDG
Sbjct: 165 EPPLNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDG 224

Query: 162 VTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221
           VTH++PV E  V+    + + +AGRD+T  +  LL  RG         +T  +IK++ CY
Sbjct: 225 VTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEV---DTSLKTAERIKQEYCY 281

Query: 222 VSYDL-----ELDTKLARETTTLVENYELPDGRVIKVGQERFEAAECLFQPNLVDVES-A 275
           V  D+     + D   ++    +VEN E    +V+ VG ERF A E  F P +   +   
Sbjct: 282 VCPDIVKEFNKFDRDGSKFAQFIVENQEQTRKKVVDVGYERFLAPEIFFNPEIASSDFLT 341

Query: 276 GVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPAR 335
            +  ++ +TIQ+  IDVR  LY  IVLSGGS+M+     R++++LK +   R+  ++  R
Sbjct: 342 PLPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVSNRIAQSE--R 399

Query: 336 LDKFK-----VRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWAESGPAAMAKF 388
           L   K     V++    ++++ V+ GG++LA     K +   +K+++ E GP  +  F
Sbjct: 400 LSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPEIVRNF 456

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 7  IVLDQGTGFVKIGRAGENFPDHTFPSIVG 35
          +V+D GTG  K+G AG + P   FP+ + 
Sbjct: 9  VVMDNGTGLTKLGFAGNDSPSWIFPTAIA 37

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score =  182 bits (463), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 118/355 (33%), Positives = 195/355 (54%), Gaps = 24/355 (6%)

Query: 53  DVMIGEEA--SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTE 110
           D  IG EA  +A      +SYP+++G ++NW  ME  W+ + ++ ++         LLTE
Sbjct: 103 DFYIGNEALTAAQGPAYSLSYPIKHGQVENWNHMERFWENSIFKYLRT-EPEDHFFLLTE 161

Query: 111 PPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS--------GVVIDSGDGV 162
           PPLNP +NRE++ E+ FE ++  G+Y+A+QAVLAL A   SS        G VIDSGDGV
Sbjct: 162 PPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGV 221

Query: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           TH++PV E  V+    + + +AGRD+T  +  LL  RG         +T  +IK++ CYV
Sbjct: 222 THVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEV---DTSLKTAERIKQEYCYV 278

Query: 223 SYDL-----ELDTKLARETTTLVENYELPDGRVIKVGQERFEAAECLFQPNLVDVES-AG 276
             D+     + D  + + +  ++EN      +++ VG ERF A E  F P +   +    
Sbjct: 279 CPDIVKEFNKFDRDVGKFSQFIIENQGKTQKKIVDVGYERFLAPEIFFNPEIASSDFLTP 338

Query: 277 VGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNND---P 333
           +  ++ +TIQ+  IDVR  LY  IVLSGGS+M+     R++++L+ +   R+  ++    
Sbjct: 339 LPTIVDHTIQACPIDVRKGLYSNIVLSGGSTMFKDFGRRLQRDLRSIVNDRIAQSELLSG 398

Query: 334 ARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWAESGPAAMAKF 388
            +     V++    R+++ V+ GG++LA     K +   +K+++ E GP  +  F
Sbjct: 399 TKSTGVDVQVISHRRQRNAVWFGGSLLAQTAEFKSYCH-TKRDYEEYGPEIVRNF 452

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score =  182 bits (462), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 120/355 (33%), Positives = 193/355 (54%), Gaps = 24/355 (6%)

Query: 53  DVMIGEEA--SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTE 110
           D  IG EA  ++  +   ++YP+ +G ++NW  ME  W+ + ++ ++         LLTE
Sbjct: 106 DFYIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTE 164

Query: 111 PPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS--------GVVIDSGDGV 162
           PPLNP +NRE++ E+ FE ++  G+Y+A+QAVLAL A   SS        G VIDSGDGV
Sbjct: 165 PPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGTVIDSGDGV 224

Query: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           TH++PV E  V+    + + +AGRD+T+ +  LL  RG          T  +IK++ CYV
Sbjct: 225 THVIPVAEGYVIGSALKNIPIAGRDITQFIQSLLRERGEV---DTSLRTAERIKQEYCYV 281

Query: 223 SYDL-----ELDTKLARETTTLVENYELPDGRVIKVGQERFEAAECLFQPNLVDVES-AG 276
             D+     + D    +    +VEN +    +V+ +G ERF A E  F P +   +    
Sbjct: 282 CPDIVKEFNKFDRDAEKFAQYVVENQDKTRQKVVDIGYERFLAPEIFFNPEIASSDFLTP 341

Query: 277 VGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNND---P 333
           +  +L  TIQ+  IDVR  LY  IVLSGGS+M+     R++++LK +   R+   +    
Sbjct: 342 LPTVLDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAETERLSG 401

Query: 334 ARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWAESGPAAMAKF 388
           AR     V++    ++++ V+ GG++LA     K +   +K+++ E GP  +  F
Sbjct: 402 ARSTGVDVQVISHRKQRNAVWFGGSLLAQTPEFKGYCH-TKKDYEEYGPEIVRNF 455

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 7  IVLDQGTGFVKIGRAGENFPDHTFPS 32
          +V+D GTG  K+G AG + P   FP+
Sbjct: 9  VVMDNGTGLTKLGFAGNDSPSWIFPT 34

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score =  181 bits (458), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 120/355 (33%), Positives = 193/355 (54%), Gaps = 24/355 (6%)

Query: 53  DVMIGEEA--SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTE 110
           D  IG EA  +A      +SYP+ +G ++NW  ME  W+ + ++ ++         LLTE
Sbjct: 106 DFYIGNEALIAAQGPSYGLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHC-FLLTE 164

Query: 111 PPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS--------GVVIDSGDGV 162
           PPLNP +NRE++ E+ FE ++  G+Y+A+QAVLAL A   SS        G VIDSGDGV
Sbjct: 165 PPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGTVIDSGDGV 224

Query: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           TH++PV E  V+    + + +AGRD+T  +  LL  RG          T  +IK++ CYV
Sbjct: 225 THVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLLRERG---EEDTSLRTAERIKQEYCYV 281

Query: 223 SYDL-----ELDTKLARETTTLVENYELPDGRVIKVGQERFEAAECLFQPNLVDVES-AG 276
             D+     + D    +    +VE+ E    +V+ VG ERF A E  F P +   +    
Sbjct: 282 CPDIVKEFNKFDRDSEKFAQFVVESQEKTRRKVVDVGCERFMAPEIFFNPEIASSDFLTP 341

Query: 277 VGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNND---P 333
           +  ++ +TIQ+  IDVR  LY  IVLSGGS+M+     R++++LK +   R++ ++    
Sbjct: 342 LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIVQSEYLSG 401

Query: 334 ARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWAESGPAAMAKF 388
            +     V++    ++++ V+ GG++LA     K +   +K+++ E GP  +  F
Sbjct: 402 TKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEIGPEIVRNF 455

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 7  IVLDQGTGFVKIGRAGENFPDHTFPSIVG 35
          +V+D GTG  K+G AG + P   FP+ + 
Sbjct: 9  VVMDNGTGLTKLGFAGNDSPSWVFPTAIA 37

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score =  102 bits (255), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 131/298 (43%), Gaps = 36/298 (12%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           D  S +V+D G+    IG +G +FP    PS+ G+      + GN     K +   +   
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK---YTADEGN-----KKIFSEQSIG 63

Query: 62  AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREK 121
             R   ++   +ENG++ +W   +  W +A   ++ L S SG   LLTEP  N  +NR+K
Sbjct: 64  IPRKDYELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKK 123

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRL 181
             EV+ E   F   Y+A  +    +A G  + +V+D G     + P+ + + L+  TRR 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVTRHLID-------------LLSRRGYAFNRTADFET-------------VRQI 215
            +AG+ +  HLI              +  R+     +T D+E               ++ 
Sbjct: 184 FIAGKFI-NHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANNRGFFQEC 242

Query: 216 KEKLCYVSYDLELDTKLARETTTLVENYELP-DGRVIKVGQERFEAAECLFQPNLVDV 272
           KE LC++     L+      ++T   + E P +  ++   + R+  AE LF P   D+
Sbjct: 243 KETLCHICPTKTLEETKTELSSTAKRSIESPWNEEIVFDNETRYGFAEELFLPKEDDI 300

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 65/119 (54%), Gaps = 16/119 (13%)

Query: 266 QPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWY 325
           +P   + E  G+ +L++++I S+D+D+R++L   +VL+GG+S  PGL  R+  EL ++  
Sbjct: 374 KPPKENNELIGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKI-- 431

Query: 326 TRVLNNDPARLDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWAESG 381
                     L   K RI        R++  ++GG++L S +     +W+ K+E+ E G
Sbjct: 432 ----------LPSLKFRILTTGHTIERQYQSWLGGSILTS-LGTFHQLWVGKKEYEEVG 479

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score =  102 bits (255), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 134/299 (44%), Gaps = 38/299 (12%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           D  S +V+D G+    IG +G +FP    PS+ G+  L A+E           M  E++ 
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK--LTADENSK-------KMFSEQSI 62

Query: 62  AV-RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
            + R   ++   +ENG++ +W   +  W +A   ++ L S SG   LLTEP  N ++NR+
Sbjct: 63  GIPRKDYELKPIIENGLVIDWDTAQEQWQWALRNELYLDSNSGIPALLTEPVWNSMENRK 122

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           K  EV+ E   F   Y+A  +    +A G  + +V+D G     + P+ + + L+  TRR
Sbjct: 123 KSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRR 182

Query: 181 LDVAGRDVTRHLID-------------LLSRRGYAFNRTADFET-------------VRQ 214
             +AG+ +  HLI              +  R+     +  D++               ++
Sbjct: 183 NFIAGKFIN-HLIQKALEPKEIIPLFAIKQRKPELIKKVFDYKVDKSLYDYANSRGFFQE 241

Query: 215 IKEKLCYVSYDLELDTKLARETTTLVENYELP-DGRVIKVGQERFEAAECLFQPNLVDV 272
            KE LC++     L+   A  +TT   + E P +  +I   + R+  AE LF     D+
Sbjct: 242 CKETLCHICPTKPLEEAKAELSTTTKRSIESPWNEEIIFDNETRYGFAEELFLTKKEDI 300

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 63/112 (56%), Gaps = 16/112 (14%)

Query: 273 ESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYT---RVL 329
           E AG+  L++++I S+D+D+R++L   +VL+GG+S  PGL  R+  EL ++  +   R+L
Sbjct: 380 ELAGLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRIL 439

Query: 330 NNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWAESG 381
                R             R++  ++GG++L S +     +W+ KQE+ E G
Sbjct: 440 TTGHIR------------ERQYQSWLGGSILTS-LGTFHQLWVGKQEYEEVG 478

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score =  101 bits (252), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 83/298 (27%), Positives = 132/298 (44%), Gaps = 31/298 (10%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           D  + IV+D G+    IG +G + P+   PS  G+    A+E    N     V   +   
Sbjct: 10  DEITSIVIDPGSYTTNIGYSGSDCPESIIPSSYGQYKDTAKEE---NQKKTKVFSEQSIG 66

Query: 62  AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREK 121
             R   +I   +ENG I +W   +  WD+    ++ L S SG  VLLTEP  N ++NR+K
Sbjct: 67  LARPDYEIKRIVENGEIADWDTAQEQWDWVLKNELFLKSNSGIPVLLTEPIWNSVENRKK 126

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRL 181
             EV+ E  DF   Y++  +    +A G  + +V+D G   T + PV + + L+  + R 
Sbjct: 127 SLEVLLEGMDFEACYLSPVSTCVSFAAGRPNCLVVDIGHDTTSVSPVIDGMTLSKSSTRN 186

Query: 182 DVAGRDVTRHLID-------------LLSRRGYAFNRTADFET-------------VRQI 215
            +AGR +  HLI+             + SRR     RT +++               ++ 
Sbjct: 187 FIAGRYI-NHLIETYLKPREIIPLFAIESRRPEFKRRTFNYQVDDSLFTYGNERGFYQEC 245

Query: 216 KEKLCYVSYDLELDTKLARETTTLVENYELPDGRVIKVGQE-RFEAAECLFQPNLVDV 272
           KE LC +  +  L+      +T    + E P    I    E R+  AE LF P+  D+
Sbjct: 246 KETLCQIIPNSTLEKSQDELSTMTKRSIEAPWAEEIVFDNEARYGFAEQLFSPHREDI 303

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 64/126 (50%), Gaps = 18/126 (14%)

Query: 259 EAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEK 318
           E +E     N VD+   G+ +L+  +I  +D+D+R+SL   +V++GG+S  P L  R+  
Sbjct: 395 EDSEVSSNGNGVDI--IGIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMY 452

Query: 319 ELKQLWYTRVLNNDPARLDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQ 375
           EL +            RL   K RI        +++  ++GG++L S +     +W+ K+
Sbjct: 453 ELSK------------RLPALKFRILTTGHLREKQYQAWLGGSILTS-LGTFHQLWVGKE 499

Query: 376 EWAESG 381
           E+ E G
Sbjct: 500 EYKEVG 505

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score =  100 bits (250), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 130/299 (43%), Gaps = 38/299 (12%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           D  S +V+D G+    IG +G +FP    PS+ G+     + +          +  E++ 
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKSTSDKDSK---------TIFSEQSI 62

Query: 62  AV-RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
            + R   ++   +ENG++ +W   +  W +A   ++ L S SG   LLTEP  N  +NR+
Sbjct: 63  GIPRKDYELKPIIENGLVIDWDTAQEQWQWALKNELYLDSNSGIPALLTEPVWNSTENRK 122

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           K  EV+ E   F   Y+A  +    +A G  + +V+D G     + P+ + + L+  TRR
Sbjct: 123 KSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRR 182

Query: 181 LDVAGRDVTRHLID-------------LLSRRGYAFNRTADFET-------------VRQ 214
             +AG+ +  HLI              +  R+     +  D+E               ++
Sbjct: 183 NFIAGKFI-NHLIKKAIEPKEIIPLFAIKQRKPKLIKKIFDYEIDQSLYEYANNRGFFQE 241

Query: 215 IKEKLCYVSYDLELDTKLARETTTLVENYELP-DGRVIKVGQERFEAAECLFQPNLVDV 272
            KE LC++     L+   A    T   + E P +  ++   + R+  AE LF P   D+
Sbjct: 242 CKETLCHICPTKTLEEAKAELNATTKRSIETPWNEEIVFDNETRYGFAEELFLPKKDDI 300

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 63/112 (56%), Gaps = 16/112 (14%)

Query: 273 ESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYT---RVL 329
           E  G+ +L++++I S+D+D+R++L   +VL+GG+S  PGL  R+  EL ++  +   R+L
Sbjct: 381 EITGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRIL 440

Query: 330 NNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWAESG 381
                R             R++  ++GG++L S +     +W+ KQE+ E G
Sbjct: 441 TTGHTR------------ERQYQSWLGGSILTS-LGTFHQLWVGKQEYEEVG 479

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 99.8 bits (247), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 134/299 (44%), Gaps = 38/299 (12%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           D  S +V+D G+    IG +G +FP    PS+ G+      + G  NI        E++ 
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK---YTADEGKKNI------FSEQSI 62

Query: 62  AV-RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
            + R   ++   +++G++ +W   +  W +A   ++ L S SG   LLTEP  N  +NR+
Sbjct: 63  GIPRKDYELKPIVKDGLVIDWDTAQEQWQWALKNELYLNSNSGTPALLTEPVWNSTENRK 122

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           K  EV+ E   F   Y+A  +    +A G  + +V+D G     + P+ + + L+  TRR
Sbjct: 123 KSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRR 182

Query: 181 LDVAGRDVTRHLID-------------LLSRRGYAFNRTADFETVRQI------------ 215
             +AG+ +  HLI              +  R+     ++ ++E  + I            
Sbjct: 183 NFLAGKFI-NHLIKKALEPKEIIPLFAIKQRKPELIKKSFNYEVDKSIYDYANNRGFFQE 241

Query: 216 -KEKLCYVSYDLELDTKLARETTTLVENYELP-DGRVIKVGQERFEAAECLFQPNLVDV 272
            KE LC++     L+   A  +TT   + E P +  ++   + R+  AE LF P   DV
Sbjct: 242 CKETLCHICPTKTLEETKADLSTTTKRSIESPWNEEIVFDNETRYGFAEKLFLPKEDDV 300

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 63/114 (55%), Gaps = 16/114 (14%)

Query: 271 DVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLN 330
           D E  G+  L++++I S+D+D+R++L   +VL+GG+S+ PGL  R+  EL ++       
Sbjct: 379 DNELIGLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKI------- 431

Query: 331 NDPARLDKFKVRI---EDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWAESG 381
                L   K RI        R++  ++GG++L S +     +W+ K+E+ E G
Sbjct: 432 -----LPSLKFRILTTGHTMERQYQSWLGGSILTS-LGTFHQLWVGKKEYEEVG 479

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 99.0 bits (245), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 82/306 (26%), Positives = 130/306 (42%), Gaps = 53/306 (17%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           D  + +++D G+    IG +G ++P    PS  G                K+   G+E++
Sbjct: 12  DEITAVIIDPGSFSTNIGYSGTDYPQSILPSSYGT--------------YKETTEGQEST 57

Query: 62  AVR------SYLQISYP-------MENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLL 108
             R      S +QI  P       +ENG I +W   +  W +A   Q+ L STSG   LL
Sbjct: 58  TKRKRIFSESSIQIPRPDYEIKRIVENGSIMDWDAAQEQWSWALKSQLHLQSTSGIPALL 117

Query: 109 TEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPV 168
           TEP  N ++NR+K  E++ E  +F   Y++       +A G  + +V+D G   T + PV
Sbjct: 118 TEPIWNSVENRKKSLEILLEGMNFEACYLSSVPTCVSFAAGRPNCLVVDIGHDTTSVSPV 177

Query: 169 YESVVLNHLTRRLDVAGRDVT---------RHLIDLLS---RRGYAFNRTADF------- 209
            + + L+  + R  +AG+ +          R +I L S   RR     RT D+       
Sbjct: 178 VDGMTLSKSSMRNFIAGKYINTLIEKYLQPREIIPLFSIKQRRPEFIKRTFDYTVDSSLY 237

Query: 210 ------ETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELPDGRVIKVGQE-RFEAAE 262
                 E  ++ KE LC ++    L+    +  T    + E P    +    E RF   E
Sbjct: 238 QYANEHEFFQECKETLCQITSTGSLEKNKDQLKTISSRSIEAPWAEELVFENETRFGFGE 297

Query: 263 CLFQPN 268
            LF PN
Sbjct: 298 ELFVPN 303

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 63/119 (52%), Gaps = 18/119 (15%)

Query: 266 QPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWY 325
           +P   D+  AG+ +L+++ I  +D+D+R+SL   +VL+GGSS  PGL  R+  EL +   
Sbjct: 384 EPTKNDI--AGLADLVYSAIIKSDVDLRASLAHNVVLTGGSSSIPGLSDRLILELNR--- 438

Query: 326 TRVLNNDPARLDKFKVRI---EDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWAESG 381
                    RL   K RI        R++  ++GG++L S +     +W+ K E+ E G
Sbjct: 439 ---------RLPALKFRILSTGHTKERQYQAWLGGSILTS-LGTFHQLWVGKNEYNEVG 487

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 129/295 (43%), Gaps = 38/295 (12%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           D  + +V+D G+    IG +G + P    PS  G+     E         KD +  E++ 
Sbjct: 12  DEITAVVIDPGSFTTNIGYSGTDCPQAILPSCYGK-YTEGE---------KDELFSEQSI 61

Query: 62  AV-RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
            + R   +I   ++NG + +W   E  WD+A   +++  + SG   LLTEP  N  +NR+
Sbjct: 62  GLPRKDYEIHNIVQNGEVVDWEKAEKQWDWAIRSELRFETNSGMPALLTEPIWNSEENRK 121

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           K  EV+ E  DF   Y+   A    +A G  + +V+D G  VT + PV + + L+  + R
Sbjct: 122 KSLEVLLESMDFSACYLVPTATAVSFAMGRPTCLVVDIGHDVTSVCPVVDGMTLSKSSMR 181

Query: 181 LDVAG---RDVTRH---------LIDLLSRRGYAFNRTADFET-------------VRQI 215
             +AG    ++ R          L  +  RR     R  D+E               ++ 
Sbjct: 182 SYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMERKFDYEIHPSLQKFVNERQFFQEF 241

Query: 216 KEKLCYVSYDLELDTKLARETTTLVENYELPDG-RVIKVGQERFEAAECLFQPNL 269
           KE +  V+       K   ETT+   + E P G  ++    +R E AE LF P+L
Sbjct: 242 KETMLQVAPTSISKFKSEIETTS-KRSIEAPWGEELVYDSLQRLEFAEQLFTPDL 295

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 69/116 (59%), Gaps = 12/116 (10%)

Query: 273 ESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNND 332
           E +G+ +L++++I S D+D+R++L   +V++GG+S  PGL  RI  EL      R L   
Sbjct: 371 EVSGLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELN-----RSL--- 422

Query: 333 PARLDKFKVRIEDPPR-RKHMVFIGGAVLASIMADKDHMWLSKQEWAESGPAAMAK 387
           PA   KF++      R R++  ++GG++LAS +     +W+ KQE+AE G   + K
Sbjct: 423 PAL--KFRMLTSGQLRERQYQGWLGGSILAS-LGTFHQLWVGKQEYAEVGADRLLK 475

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 93.6 bits (231), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 125/298 (41%), Gaps = 32/298 (10%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           D  S +V+D G+    IG +G + P    PS  G      +  G      K  +  E++ 
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDCPQAILPSCYGDYTNTDDPEGK-----KKKVFSEQSI 66

Query: 62  AV-RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
            + R   +I   +ENG++ +W   +  W +A   Q+ L S SG   LLTEP  N ++NR+
Sbjct: 67  CIPRKDYEIKPIVENGVVIDWDAAQEQWSWALENQLYLRSNSGIPALLTEPIWNTVENRK 126

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           K  E++ E  DF   Y+A       +  G SS +V+D G     + PV + + L+  T+R
Sbjct: 127 KSLELLLEGMDFEACYLASTPTCVSFGTGRSSCLVVDLGHDTCSVSPVVDGMTLSKSTKR 186

Query: 181 LDVAGRDVTRHLIDLLS------------RRGYAFNRTADFET-------------VRQI 215
              AG  +   + + +S            RR     +  +F                ++ 
Sbjct: 187 NFFAGGYLNELIKNYISPEKIIPLFAIDKRRPELKKKVFEFPVHESLYKYANDRGIFQEC 246

Query: 216 KEKLCYVSYDLELDTKLARETTTLVENYELP-DGRVIKVGQERFEAAECLFQPNLVDV 272
           KE LC V+    LD   +   T    + E P    +I   + R+  AE LF P   DV
Sbjct: 247 KETLCQVAAPSTLDKMKSELATVAKRSIETPWTEEIIFDNETRYGFAEQLFLPRKEDV 304

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 60/109 (55%), Gaps = 16/109 (14%)

Query: 276 GVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPAR 335
           GV +L+ ++I ++D+D+R++L   +VL+GG+S  PGL  R+  EL             +R
Sbjct: 380 GVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELN------------SR 427

Query: 336 LDKFKVRI---EDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWAESG 381
           L   K R+        R++  ++GG+VL S +     +W+ K+E+ + G
Sbjct: 428 LPALKFRMITTGHTRERQYQSWLGGSVLTS-LGTFHQLWVGKEEYQDVG 475

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score = 90.1 bits (222), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 91/378 (24%), Positives = 155/378 (41%), Gaps = 69/378 (18%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           SP+++D G+  +K G   E  P     SI        ++ GN ++  +   I + +S V 
Sbjct: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIA------KDKYGNYHLSNQVRSIKDISSVV- 56

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPLNPLKNR 119
                + P E G + +W     +WDY  +         + +T G  ++ +E  +   +  
Sbjct: 57  ----FNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELS 112

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153
           + M +V+FE+Y+F  ++ A   V   +  G  S                           
Sbjct: 113 KNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQ 172

Query: 154 VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVR 213
           +VIDSG   + IVPV + V      ++LD+ GR +   L + LS R Y  N   +   V 
Sbjct: 173 LVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILVN 230

Query: 214 QIKEKLCYVSYDLELDTKLARETTTLVENYELPD------GRVIKVGQ------------ 255
            IKE   ++S +   ++  +R  T   + Y LPD      G + K GQ            
Sbjct: 231 SIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQ 288

Query: 256 -ERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPS 314
            E F   E  F P +  + ++G+ E +  +I      +R  +   IV++GG+   P   S
Sbjct: 289 DELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFAS 348

Query: 315 RIEKELKQL----WYTRV 328
           R+  EL++     W  RV
Sbjct: 349 RLATELQRQCPTDWSCRV 366

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 90.1 bits (222), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 129/302 (42%), Gaps = 37/302 (12%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRA---------EERGNLNIPLK 52
           D  S +V+D G+    IG +G + P    PS  G   L+          EE    N   K
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYGEISLKEVASEGNEEIEENSASNNKSK 71

Query: 53  DVMIGEEASAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPP 112
            +   +  +  R+  +I   ++NG + +W   +  WD+A    + L S SG    LTEP 
Sbjct: 72  KIFGEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKNALYLESNSGIPAFLTEPI 131

Query: 113 LNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESV 172
            N ++NR+K  EV+ E   F   Y++       +A G  + +V+D G  V  + PV + +
Sbjct: 132 WNTVENRKKSLEVLLEGLQFEACYLSPTPTCISFASGRPNCLVVDIGHDVASVSPVIDGM 191

Query: 173 VLNHLTRRLDVAGRDVTRHLIDLL------------SRRGYAFNRTADFE---------- 210
            L+  + R  ++GR +   + + L             R+     +T DF           
Sbjct: 192 TLSKSSMRNFISGRFINEKIKEFLKPREIIPLFEVKQRKPEFIKKTFDFPIHQSVYDYAN 251

Query: 211 ---TVRQIKEKLCYVSYDLELDTKLARETTTLVE-NYE-LPDGRVIKVGQERFEAAECLF 265
                ++ KE LC ++    LD K+A E  +L + +YE L    ++     R+  AE LF
Sbjct: 252 DHGIFQECKETLCQIAPTAALD-KMAPELESLAKRSYETLWKEDIVFDNVTRYSFAEHLF 310

Query: 266 QP 267
            P
Sbjct: 311 VP 312

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 66/114 (57%), Gaps = 14/114 (12%)

Query: 276 GVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKEL-KQLWYTRVLNNDPA 334
           G+ +L+ ++I + D+D+R+SL   IVL+GG+S  PG   R+  EL K+L         PA
Sbjct: 396 GIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKL---------PA 446

Query: 335 RLDKFKVRIEDPPR-RKHMVFIGGAVLASIMADKDHMWLSKQEWAESGPAAMAK 387
              KF+V      R R++  ++GG++L+S +     +W+ KQE+ ESG   + K
Sbjct: 447 L--KFRVLTTGQTRERQYQAWLGGSILSS-LGTFHQLWVGKQEYEESGADRLLK 497

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 107/234 (45%), Gaps = 10/234 (4%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           DPH PI +D G+  ++ G   +  P H FP+++ +   R   + N      D ++ +   
Sbjct: 35  DPHVPIAIDFGSSKLRAGFVNQAAPTHIFPNVLTKFRDRKLNK-NFTFVGNDTLLDQ--- 90

Query: 62  AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTS-GGKVLLTEPPLNPLKNRE 120
           AVRS  Q   P +   + NW   E + DY F+     P+      +LLTE        R 
Sbjct: 91  AVRS--QSRSPFDGPFVTNWNFTEEIMDYTFHHLGVSPNNGVRNPILLTERMATVQSQRA 148

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLS---SGVVIDSGDGVTHIVPVYESVVLNHL 177
              ++MFE Y+  GV   I ++   Y Q  S   +G+VID G   T+++PV +   +   
Sbjct: 149 NWYQIMFETYNVPGVTFGIDSLYGFYNQNTSGNKTGLVIDCGHEDTNVIPVVDGTGVLTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTK 231
            +R++  GR    +L DL++ +   F     +     + +  CYVS + + D K
Sbjct: 209 AKRINWGGRQAVDYLSDLMALKYPYFPTKLSYLQYETMYQDYCYVSPNYDEDIK 262

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 61/139 (43%), Gaps = 28/139 (20%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGEL----LFNTIQSADIDVRSS---LYKAIVLSGGSSM 308
           ER    E +FQP L   + AG+ EL    L     S    + S+   +   + ++GG+S 
Sbjct: 617 ERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKLSSTSLDMVNNVFITGGNSK 676

Query: 309 YPGLPSRIEKELKQLW-----YTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASI 363
            PGL  RI +E  +       ++  +++DP+ LD +K               G A LA  
Sbjct: 677 VPGLRERIVREFTEFLPVGTNFSVNMSSDPS-LDAWK---------------GMAALAQN 720

Query: 364 MADKDHMWLSKQEWAESGP 382
             +     +SK+E+ E GP
Sbjct: 721 KEEYKKTVISKKEYEEYGP 739

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 95/200 (47%), Gaps = 8/200 (4%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNI-----PLKDVMI 56
           D  S +V+D G+    IG +G + P    PS  G      ++ G+ +        K   I
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDCPHSILPSRYGSFKKTNKDSGDEDTKSDESATKRAHI 71

Query: 57  GEEASA--VRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLN 114
             E S    R   +I   +ENG + +W   +  W++A   ++ L ST G   LLTEP  N
Sbjct: 72  FSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNELFLESTKGIPALLTEPVWN 131

Query: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVL 174
             KNR+K  E + E  +F   Y+A  +    +A G ++ +V+D G     + PV + + L
Sbjct: 132 TKKNRKKSLETLLESMNFEACYLAPTSTCVSFATGRANCLVVDIGHDTCSVSPVVDGMTL 191

Query: 175 NHLTRRLDVAGRDVTRHLID 194
           +  TRR   AG+ +  HLI+
Sbjct: 192 SKSTRRSFFAGKYIN-HLIE 210

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 61/112 (54%), Gaps = 16/112 (14%)

Query: 273 ESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNND 332
           E  G+ +L+ ++I ++D+D+R+SL   + L+GG+S+ PGL  R+  EL            
Sbjct: 397 EIMGLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELN----------- 445

Query: 333 PARLDKFKVRI---EDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWAESG 381
            ARL   K RI        R++  ++GG+VL S +     +W+ +QE+ E G
Sbjct: 446 -ARLPALKFRILTTGHKKEREYQSWLGGSVLTS-LGTFHQLWVGRQEYEEVG 495

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 87.0 bits (214), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 109/233 (46%), Gaps = 17/233 (7%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           DP+ PI +D G+  V+ G   ++ P H F + + R   R   R N N+      IG + +
Sbjct: 34  DPNVPIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDR---RKNRNL----TFIGNDTN 86

Query: 62  ---AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSG--GKVLLTEPPLNPL 116
              +VRS  Q   P +  I+ NW   E + +Y F+  + +    G    +L+TE      
Sbjct: 87  LDLSVRS--QAKSPYDGAIVSNWDYTEEIMEYTFH-HLGVNGNDGVSNPILMTEKLATLQ 143

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQ--GLSSGVVIDSGDGVTHIVPVYESVVL 174
             RE   +++FE +    V   I ++ + YA     +SG+VI+SG+  TH++PV     +
Sbjct: 144 SQRENWYQLLFECFGVPQVTFGIDSLFSFYANNDATASGLVINSGNEDTHVIPVMNGKGV 203

Query: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLE 227
               +R++  GR    +L +LL+ +   F         + + E  CYVS D +
Sbjct: 204 LSEAKRINWGGRQSVEYLSNLLALKYPYFPIKPSTHQFQSLYEDFCYVSVDYQ 256

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 7/72 (9%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGELL-------FNTIQSADIDVRSSLYKAIVLSGGSSM 308
           ER    E +FQP++  ++ AGV E+        F + +S   +    L   + L+GG+  
Sbjct: 609 ERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGSTRSQLSEGSKKLAANVFLTGGNMR 668

Query: 309 YPGLPSRIEKEL 320
            PG+  RI +E 
Sbjct: 669 LPGVRERIVREF 680

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 119/280 (42%), Gaps = 47/280 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIG-EEASAVR- 64
           +V+D G+    IG +G ++P    PS  G      +++ + N P +      E AS ++ 
Sbjct: 17  VVIDPGSFTTNIGFSGSDYPQSILPSCYGAITEIEDQQADHNKPDESAANNTENASKIKI 76

Query: 65  ----SYLQISYP---------MENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEP 111
               +   + YP         ++NG + +W   +  W +A   ++ L S  G   LLTEP
Sbjct: 77  RKVFNEQSVGYPRANYEIKPIVQNGEVVDWDAAQEQWSWALENELFLKSNEGVPALLTEP 136

Query: 112 PLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYES 171
             N ++NR+K  EV+ E   F   Y++       +A G S+ +V+D G  +  + PV + 
Sbjct: 137 IWNTVENRKKSLEVLLEGMGFEACYLSATPTCVSFAAGRSNCLVVDIGHDIISVSPVVDG 196

Query: 172 VVLNHLTRRLDVAGRDVTRHLIDLL------------SRRGYAFNRTADFE--------- 210
           +  +  TRR  ++G+ +   + D L             R+     +T DF          
Sbjct: 197 MTFSKSTRRNVISGKYLNVLINDFLKPREIVPLFEIKQRKPTLVKKTFDFPIHDSLKTYA 256

Query: 211 ----TVRQIKEKLCYVS-------YDLELDTKLARETTTL 239
                 ++IKE LC VS       Y  EL+    R+  TL
Sbjct: 257 NDRGIYQEIKEALCRVSPNSSLEKYKPELEKMSKRKYETL 296

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 62/110 (56%), Gaps = 18/110 (16%)

Query: 276 GVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRI----EKELKQLWYTRVLNN 331
           G+ +L+ ++I +AD+D+R+SL   +VL+GG+S  PGL  RI     K L  L + RVL N
Sbjct: 398 GIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKF-RVLAN 456

Query: 332 DPARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWAESG 381
              R             R++  ++GG++L+S +     +W+ KQE+ E G
Sbjct: 457 GQTR------------ERQYQSWLGGSILSS-LGTFHQLWVGKQEYEEIG 493

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 119/292 (40%), Gaps = 27/292 (9%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRSY 66
           +V+D G+    IG +G + P    PS  G         G+       V   +  +  R  
Sbjct: 17  VVIDPGSFTTNIGYSGTDCPQAILPSCYGHHKTNENADGDDEKSKPKVFAEQSLTFPRPD 76

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVM 126
            +I   +ENG++ +W   +  WD+A    + L S  G   L+TE   N ++N+ K  EV+
Sbjct: 77  YEIKPIVENGLVVDWDAAQEQWDWALRNVLHLESNKGVPALMTESIWNTMENKTKSLEVL 136

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGR 186
            E  DF   Y++       +A G  + +V+D G       PV + + L+  TRR  ++G+
Sbjct: 137 LETLDFEACYISSTPTCVSFATGRPNCLVVDVGHDTASSSPVVDGMTLSRSTRRNFISGK 196

Query: 187 DVT---------RHLIDL---------LSRRGYAFN---RTADFETVR----QIKEKLCY 221
            V          R +I L           ++ + FN      +F   R    + KE LC 
Sbjct: 197 FVDQLIGKYLQPREIIPLFEIAQRRPEFKKKNFEFNIDPSLYNFANERGFFQECKETLCQ 256

Query: 222 VSYDLELDTKLARETTTLVENYELP-DGRVIKVGQERFEAAECLFQPNLVDV 272
           ++    LD       +T   + E P    ++     R+  AE LF P   D+
Sbjct: 257 IA-PTTLDKFKPELESTAKRSIEAPWTEEIVFDNPSRYGFAEQLFYPQSEDI 307

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 79/145 (54%), Gaps = 18/145 (12%)

Query: 244 ELPDGRVIKVGQERFEAAECLFQPN---LVDVES---AGVGELLFNTIQSADIDVRSSLY 297
           E P+G     G+++   +E   +     + D ES   AG+ +L+ ++I SAD+D+R++L 
Sbjct: 340 EKPNGEETPSGEDQASTSETTNEHGKRPMEDSESSELAGISDLVHSSITSADVDLRATLA 399

Query: 298 KAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPR-RKHMVFIG 356
             IVL+GGSS  PG   R+  EL     T+ L   PA   KF+V      R R++  ++G
Sbjct: 400 HNIVLTGGSSSVPGFSDRLMNEL-----TKKL---PAL--KFRVLTTGHLRERQYQSWLG 449

Query: 357 GAVLASIMADKDHMWLSKQEWAESG 381
           G++L S +     +W+ K+E+ E G
Sbjct: 450 GSILTS-LGSFHQLWVGKREYEEVG 473

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 94/384 (24%), Positives = 159/384 (41%), Gaps = 80/384 (20%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           +PIV+D G+  +K G A  N P     SI        ++ GN ++          ++ VR
Sbjct: 4   APIVIDNGSYEIKFGTASSNEPFTALNSIA------KDKYGNYHL----------SNQVR 47

Query: 65  SYLQISY-----PMENGIIKNWTDMELLWDYAF-----YEQMKLPSTSGGKVLLTEPPLN 114
           S   IS      P + G + +W     +WDY       ++   L +T    ++ +E  + 
Sbjct: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMT 107

Query: 115 PLKNREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------- 154
             +  + M +V+FE+Y++  ++ A +   +   A+G ++ +                   
Sbjct: 108 LPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNK 167

Query: 155 -------VIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207
                  VIDSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   
Sbjct: 168 DYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 225

Query: 208 DFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELPD------GRVIKVGQ------ 255
           +   V  IKEK  ++S +   D+  +R  T   + Y LPD      G + K GQ      
Sbjct: 226 ETILVNSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDS 283

Query: 256 -------ERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSM 308
                  E F   E  F P +  + + G+ E +  +I      +R  L   +V++GG+  
Sbjct: 284 QTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFN 343

Query: 309 YPGLPSRIEKELKQL----WYTRV 328
            P   SR+  EL++     W  RV
Sbjct: 344 IPNFASRLATELQRQCPTDWSCRV 367

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 126/294 (42%), Gaps = 49/294 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRSY 66
           IV+D G+    IG +G + P    PS  G      E  G+     K +   +     R+ 
Sbjct: 17  IVIDPGSFVTNIGYSGTDCPQSIMPSSYGN----VETDGDT----KRIFNEQPLLFPRAG 68

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVM 126
           ++I   +EN  I +W   +  W+YA    +K  S  G  VLLTEP  N   +R+K  E++
Sbjct: 69  MEIKPIVENSTIVDWDRAQEQWEYALNTDLKFESNKGTPVLLTEPIWNSEASRKKSLEIL 128

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGR 186
            E  +F   Y+A  +    +A G  + +V+D G  V+ + PV + + L+  + R  VAG+
Sbjct: 129 LESMEFEACYLAANSSAVSFAMGRPTCLVVDIGHDVSTVSPVIDGMTLSKSSTRNYVAGK 188

Query: 187 DVTRHLI-------------DLLSRRGYAFNRTADFET-------------VRQIKEKLC 220
            +  HLI              +L ++     RT  F+               ++ KE L 
Sbjct: 189 YLN-HLIAKNLKPREIVPIFQVLKKKPDFVKRTLSFDVNESVINFANERQFFQEFKETLL 247

Query: 221 YV------SYDLELDTKLARETTTLVENYELPDG-RVIKVGQERFEAAECLFQP 267
           ++      S+  EL T+  R       + E P G  +I     R+  AE LF+P
Sbjct: 248 HIAPKSLSSFKDELATQTKR-------SLEAPWGEELIFDADTRYSFAEQLFRP 294

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 66/116 (56%), Gaps = 12/116 (10%)

Query: 273 ESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNND 332
           E AG+ +L+  ++  AD+D+R++L   +VL+GG+S  PGL  RI  EL +          
Sbjct: 412 EVAGIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSL-------- 463

Query: 333 PARLDKFKVRIEDPPR-RKHMVFIGGAVLASIMADKDHMWLSKQEWAESGPAAMAK 387
           PA   KF++      R R++  ++GG++LAS +     +W+ ++E+ E GP  + K
Sbjct: 464 PAL--KFRMLSSGHLRERQYQGWLGGSILAS-LGTFHQLWVGREEYEEVGPERLLK 516

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 128/293 (43%), Gaps = 36/293 (12%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEE-RGNLNIPLKDVMIGEEA 60
           D  S +V+D G+    IG +G + P    PS  G+     +E + + N      MI    
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFN---DQFMI---- 64

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
              R   +I   +ENG + +W   +  W +A  +++K  S  G    LTE   NP +NR+
Sbjct: 65  -MPRPDFEIKRILENGCVVDWEAAQEQWAWAIRDELKFESFKGTPAFLTEAIWNPEENRK 123

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           K  EV+ E  +F   Y+A  A    +A G  + +V+D G  V  + PV + + L+  + R
Sbjct: 124 KSLEVLLEGMEFEACYIAPTATCTSFAMGRPTCLVLDIGHDVASVCPVVDGMTLSKSSTR 183

Query: 181 LDVAGRDVTRHLIDLLSRR--------------------GYAFNRTAD-FETVR----QI 215
             +AG+ + + + + L  R                     +  +++ D F   R    + 
Sbjct: 184 NFLAGKLLNKLIENHLKPRELVPLYKVERKRPEFVPKKFEFTVSKSVDEFANSRGFLQEC 243

Query: 216 KEKLCYVSYDLELDTKLARETTTLVENYELPDGR-VIKVGQERFEAAECLFQP 267
           KE + +V+  +EL    +   TT   + E P G  +I     R+  AE LF+P
Sbjct: 244 KETMLHVAA-VELPKFQSELETTSKRSIEAPWGENIIFDSNARYSFAEQLFKP 295

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 60/116 (51%), Gaps = 16/116 (13%)

Query: 275 AGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPA 334
           AG+ +L+   I + D+D+R++L   +V++GGSS  PGL  R+  EL +            
Sbjct: 375 AGLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNK------------ 422

Query: 335 RLDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWAESGPAAMAK 387
           +L   K RI        R+   ++GG++L+S +     +W+ +QE+ E G   + K
Sbjct: 423 KLPALKFRILTSGHLRERQSRAWLGGSILSS-LGTFHQLWVGRQEYEEVGAERLLK 477

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 85.1 bits (209), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 108/241 (44%), Gaps = 12/241 (4%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           DP  PI +D G+  ++ G   ++ P H FP+++ +   R   + N      D ++ +   
Sbjct: 35  DPQLPIAIDFGSSKLRAGFVNQSAPTHVFPNVLTKFRDRKLNK-NFTFVGNDTLLDQ--- 90

Query: 62  AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTS-GGKVLLTEPPLNPLKNRE 120
           AVRS  Q   P +   + NW   E + DY F+    +P       +LLTE        R 
Sbjct: 91  AVRS--QSKSPFDGPFVTNWNFTEEILDYTFHHLGIVPENGISNPILLTERMATVQSQRA 148

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYA---QGLSSGVVIDSGDGVTHIVPVYESVVLNHL 177
              +++FE Y+  GV   I ++   Y     G  +G+VID G   T+++P+ +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYGFYNYYPSGKQTGLVIDCGHEDTNVIPIVDGAGILTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVS--YDLELDTKLARE 235
            +R++  G     +L DL++ +   F     +     + +  CYVS  YD ++D  L  E
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYQDYCYVSRNYDEDVDKILTLE 268

Query: 236 T 236
            
Sbjct: 269 N 269

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 61/143 (42%), Gaps = 36/143 (25%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGELL-------FNT----IQSADIDVRSSLYKAIVLSG 304
           ER    E +FQP +   + AG+ EL        F +    +    ID+ ++++    ++G
Sbjct: 617 ERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKLSQTSIDMANNVF----ITG 672

Query: 305 GSSMYPGLPSRIEKELKQLWYTRV-----LNNDPARLDKFKVRIEDPPRRKHMVFIGGAV 359
           G++  PGL  RI KE              +++DP+ LD +K               G A 
Sbjct: 673 GNAKVPGLKERIVKEFTGFLPVGTNININMSSDPS-LDAWK---------------GMAA 716

Query: 360 LASIMADKDHMWLSKQEWAESGP 382
           LA    +     +S++E+ E GP
Sbjct: 717 LAQNEEEYKRTIISRKEYEEYGP 739

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 85.1 bits (209), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 105/234 (44%), Gaps = 10/234 (4%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           DPH PI +D G+  ++ G   +  P H FP+++ +   R   + N      D ++ +   
Sbjct: 35  DPHLPIAIDFGSSRLRAGFVNQATPTHIFPNVLTKFRDRKLNK-NFTFVGNDTLLDQ--- 90

Query: 62  AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTS-GGKVLLTEPPLNPLKNRE 120
           AVRS  Q   P +   + NW   E + DY F+    LP+      +LLTE        R 
Sbjct: 91  AVRS--QSRSPFDGPFVTNWNFTEEIMDYTFHHLGVLPNNGISNPILLTERMATVQSQRA 148

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSGVVIDSGDGVTHIVPVYESVVLNHL 177
              +++FE Y+  GV   I ++ + Y     G  +G+VID     T +VP+ +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYSFYNNNPSGNKTGLVIDCSHEDTSVVPIVDGAGILTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTK 231
            +R++  G     +L DL++ +   F     +     + +  CYVS + + D K
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYQDYCYVSPNYDEDIK 262

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 58/134 (43%), Gaps = 18/134 (13%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGEL----LFNTIQSADIDVRSS---LYKAIVLSGGSSM 308
           ER    E +FQP +   + AG+ EL    L     S    + S+   +   I+++GG++ 
Sbjct: 617 ERIRVPEVVFQPTMGGQDQAGICELSETILMKKFGSQRGKLSSTSLDMVNNILITGGNAK 676

Query: 309 YPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKD 368
            PGL  RI KE  +  +  V  N         V I   P      + G A LA   A+  
Sbjct: 677 VPGLRERIVKEFTE--FLPVGTN-------VAVNISSNPSLD--AWRGMAALARNKAEYK 725

Query: 369 HMWLSKQEWAESGP 382
              +SK+E+ E GP
Sbjct: 726 KTVISKEEYEEYGP 739

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 126/293 (43%), Gaps = 34/293 (11%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           D  + +V+D G+    IG +G + P    PS  G      E+    N P K  +  E++ 
Sbjct: 12  DEITAVVIDPGSFSTNIGFSGTDCPQAILPSCYGEQKAETED----NAPKK--IFAEQSI 65

Query: 62  AV-RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
            + R   +I   ++N ++ +W   E  W +A  + + L S SG   LLTEP  N L+N+ 
Sbjct: 66  GIPRPDYEIKPIVQNSMVVDWDAAEEQWSWALKDILYLNSNSGIPALLTEPIWNTLENKT 125

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           K  E++ E   F   Y++       +A G  + +V+D G   T + PV + + L+  T R
Sbjct: 126 KSLEILLESLQFEACYLSSTPTCVSFASGRPNCLVVDLGHDTTSVSPVVDGMTLSKSTMR 185

Query: 181 LDVAGRDVTR------------HLIDLLSRRGYAFNRTADFET-------------VRQI 215
             +AG  +               L ++  R+     +T D++              +++ 
Sbjct: 186 NFLAGNCINELIKKPLKGKDLVPLFEIAQRKPEFKKKTFDYQIHPSLYNYANSRGFLQEC 245

Query: 216 KEKLCYVSYDLELDTKLARETTTLVENYELPDG-RVIKVGQERFEAAECLFQP 267
           KE LC V+    LD   ++  +    + E P    ++   + RF  AE LF P
Sbjct: 246 KETLCQVAPS-PLDKMDSQLESMAKRSIEAPWAEELVFDNKTRFGFAEQLFAP 297

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 59/111 (53%), Gaps = 16/111 (14%)

Query: 275 AGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPA 334
           AG  +L+  +I ++D+D+R++L   IVL+GG+S  PG   R+  EL +            
Sbjct: 374 AGAADLVNASILASDVDLRATLAHNIVLTGGTSSIPGFSDRLMSELNK------------ 421

Query: 335 RLDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWAESGP 382
           +L   K RI        R++  ++GG++L S +     +W+ KQE+ E GP
Sbjct: 422 KLPALKFRILTTGHLRERQYQAWLGGSILTS-LGSFHQLWVGKQEYEEVGP 471

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 103/236 (43%), Gaps = 27/236 (11%)

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMC 123
           RS  Q+   +ENG++ +W   E  W +A  E++ + S  G   LLTEP  N ++NR+K  
Sbjct: 156 RSDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSFKGIPALLTEPVWNTVQNRKKSL 215

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           EV+ EK +F   Y+        +A G  + +V+D G     + PV + + L    RR   
Sbjct: 216 EVLLEKMEFEACYLTTIPTNVSFAAGKPNCLVVDVGHDTCSVSPVIDGMTLTKSVRRNFF 275

Query: 184 AGRDVTRHLIDLL------------------SRRGYAFN-------RTADFETVRQIKEK 218
           AGR + R L + +                   R+ + FN          D +  ++ KE 
Sbjct: 276 AGRYLNRLLENYIKPREIIPLFMVEKRRPEFKRKIFDFNIDPSVISYANDHQFFQECKET 335

Query: 219 LCYVSYDLELDTKLARE-TTTLVENYELPDGRVIKVGQ-ERFEAAECLFQPNLVDV 272
           LC +  +      +  E  ++   + E P G  I+     RF  AE LF PN  ++
Sbjct: 336 LCQIYPNNSFLANVKDELESSAKRSIEAPWGEKIEFDNMTRFGFAEELFNPNESNI 391

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 76/154 (49%), Gaps = 21/154 (13%)

Query: 242 NYELPDGRVIKVGQERFEAAECLFQPNLVDVES-----AGVGELLFNTIQSADIDVRSSL 296
           N + P   + + G+   E  E +  P   D +       G+ +L+  T+ S+D+D+R++L
Sbjct: 452 NADTPSENINENGKRSIEDGENVDVPKKSDKKDIDNIIPGIADLVEATVNSSDVDLRATL 511

Query: 297 YKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPR---RKHMV 353
              ++L+GG+S+ PGL  R+  EL +            +L   K RI        RK+  
Sbjct: 512 AHNVILTGGTSLIPGLADRLMYELNK------------KLPALKFRILSSGHRRERKYQA 559

Query: 354 FIGGAVLASIMADKDHMWLSKQEWAESGPAAMAK 387
           ++GG++L S +     +W+ K+E+ E GP  + K
Sbjct: 560 WLGGSILTS-LGTFHQLWVGKREYEEVGPDRLLK 592

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 84.0 bits (206), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 91/203 (44%), Gaps = 6/203 (2%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEE---RGNLNIPLKDVMIGE 58
           D  + +++D G+    IG AG + P    PS  G  I  AEE     N     K   +  
Sbjct: 12  DEITAVIIDPGSYTTNIGYAGTDCPQSILPSSFGE-IHEAEESTSEDNTEKTRKTRKVFS 70

Query: 59  EASAV--RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPL 116
           E S    R   ++   +ENG + +W      W +A   ++ + S  G   +LTEP  N  
Sbjct: 71  EQSIPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRNELHIESNRGIPAMLTEPLWNSK 130

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNH 176
           +NR K  E++ E  +F   Y+   +    +A G  + +++D G  +  + PV + + L+ 
Sbjct: 131 ENRSKSLEILLEGMEFEACYLTATSTAVSFATGRPNSLIVDIGHDIASVTPVIDGMSLSK 190

Query: 177 LTRRLDVAGRDVTRHLIDLLSRR 199
            TR    AGR + + L D L  R
Sbjct: 191 STRCNHFAGRFLNKLLTDYLKPR 213

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 62/110 (56%), Gaps = 12/110 (10%)

Query: 273 ESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNND 332
           E  G+ +L+ ++I S D+D+R+SL   +V++GGSS  PGL  RI  EL   +        
Sbjct: 385 ELPGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKF-------- 436

Query: 333 PARLDKFKVRIEDPP-RRKHMVFIGGAVLASIMADKDHMWLSKQEWAESG 381
           PA   KF+V        R++  ++GG++L+S +     +W+ K+E+ E G
Sbjct: 437 PAL--KFRVLATGQSIERQYQSWLGGSILSS-LGTFHQLWIGKKEYEEVG 483

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 88/371 (23%), Positives = 149/371 (40%), Gaps = 72/371 (19%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIV----GRPILRAEERGNLNIPLKDVMIGEEA 60
           +PI++D G+  VK G A  + P     ++     G P L      N    LKD+      
Sbjct: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------ 52

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYE----QMKLPSTSGGKVLLTEPPLNPL 116
               S +Q   P E G + +W     +WDY  Y       ++ +T G  ++L+E  ++  
Sbjct: 53  ----SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108

Query: 117 KNREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGL----------------SSG------ 153
           +  +   +V+FE+Y+FG  +   +   +    Q L                S+G      
Sbjct: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168

Query: 154 ---VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFE 210
              +VIDSG   T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +  
Sbjct: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226

Query: 211 TVRQIKEKLCYVSYDLELDTKLARETTTLVENYELP-------------------DGRVI 251
            V  IKEK  ++S     ++   +E TT    Y LP                   D + I
Sbjct: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284

Query: 252 KVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPG 311
           K+  E F   E  F P +  +   G+ E +  +I      +R  +    V++GG+     
Sbjct: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344

Query: 312 LPSRIEKELKQ 322
              R+  EL++
Sbjct: 345 FARRLATELQR 355

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 84/366 (22%), Positives = 148/366 (40%), Gaps = 64/366 (17%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRS 65
           P+V+D G+  VK G +  + P     + + R    A    N    +KD+          S
Sbjct: 5   PLVVDNGSYEVKFGYSTTSQPFRAL-NALARDKFGATYLSNQINQIKDI----------S 53

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----YEQMKLPSTSGGKVLLTEPPLNPLKNRE 120
            +    P E G + +W     +WDY F     ++   L  + G  ++ +E  +   +  +
Sbjct: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ----------------GLSSG---------VV 155
            M +V+FE+Y+F  +  A  +    +++                G S+          +V
Sbjct: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTSTSETKDYEPFQMV 173

Query: 156 IDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215
           IDSG   T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231

Query: 216 KEKLCYVSYDLELDTKLARETTTLVENYELP-------------------DGRVIKVGQE 256
           KEK  ++S     D+  A++  T VE Y LP                   D + + +  E
Sbjct: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289

Query: 257 RFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRI 316
            F   E  F P +  +   G+ E +  ++      +R  +   I+ +GG+   P  P R+
Sbjct: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349

Query: 317 EKELKQ 322
             EL++
Sbjct: 350 ATELQR 355

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 100/390 (25%), Positives = 153/390 (39%), Gaps = 84/390 (21%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKD----VMIGEEASA 62
           +V+D G+  +K G +G + P            LRA     LN   KD      +  +   
Sbjct: 6   LVIDNGSYEIKFGESGWDQP------------LRA-----LNCLTKDKYSRFHLSNQTKK 48

Query: 63  VRSYLQ--ISYPMENGIIKNWTDMELLWDYAFYEQMKLP-------STSGGKVLLTEPPL 113
           +R   Q  I  P E G + +W     +WDY FY +            T    ++++E  +
Sbjct: 49  MRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLM 108

Query: 114 NPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VV 155
              +  + M +V+FE+YDF  ++    A    + QG                      +V
Sbjct: 109 TIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLV 168

Query: 156 IDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215
           IDSG   T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  I
Sbjct: 169 IDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNI 226

Query: 216 KEKLCYV---SYDLELDTKLARETTTLVENYELPD------GRVIKVGQER--------- 257
           KE+  +V   SY      K+     T VE Y LPD      G V K G+E+         
Sbjct: 227 KEQCTFVPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKLTDDAQTLL 281

Query: 258 -----FEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGL 312
                F   E  F P +  +   G+ E +   I      VR  L   IV +GG+   P  
Sbjct: 282 LTDEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341

Query: 313 PSRIEKELKQL----WYTRVLNNDPARLDK 338
             R++ EL++     W  +V  + P   DK
Sbjct: 342 HERLQTELQRQCPIDWSCKV--HSPQEKDK 369

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 114/274 (41%), Gaps = 32/274 (11%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNI-----PLKDVMI 56
           D  S +V+D G+    IG +G + P  T PS  G+ I   EE+           LK  + 
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGTDCPQVTLPSRYGQYISEEEEKDEQEQQEDDRKLKQKVF 71

Query: 57  GEEASAV-RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNP 115
            E++  + R+  QI   + NG + +W   +  W +A   ++   ST G    LTEP  N 
Sbjct: 72  SEQSIGLPRNNYQIKPIVRNGSVIDWDSAQEQWSWAIQHELHFESTKGMPAFLTEPIWNT 131

Query: 116 LKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLN 175
            +NR+K  EV+ E  +F   +++       +A G  + +V+D G  V  + PV + + L+
Sbjct: 132 EENRKKSLEVLLENMEFEACFLSPTPTCVSFAMGRPTCLVVDIGHDVCSVSPVVDGMTLS 191

Query: 176 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARE 235
             +    +AG      L++ L  +     +T     + Q         +D E+D  L   
Sbjct: 192 KSSTSNFIAG-----SLLNALLSKQLDPKKTVPLFQIAQRHPNFIPKKFDFEVDPSL--- 243

Query: 236 TTTLVENYELPDGRVIKVGQERF---EAAECLFQ 266
                           K G ER+   E  E LFQ
Sbjct: 244 ---------------FKFGNERWFFQECKETLFQ 262

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 65/118 (55%), Gaps = 16/118 (13%)

Query: 273 ESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNND 332
           E AG+ +L++++I + D+D+R++L   +V++GG+S  PGL  RI  EL +          
Sbjct: 389 EIAGLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNK---------- 438

Query: 333 PARLDKFKVRIEDP---PRRKHMVFIGGAVLASIMADKDHMWLSKQEWAESGPAAMAK 387
              L   K R+        R++  ++GG++L+S +     +W+ KQE+ E G + + K
Sbjct: 439 --SLPALKFRMLTSGHLKERQYQSWLGGSILSS-LGTFHQLWVGKQEYEEVGASRLLK 493

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 80.9 bits (198), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 87/185 (47%), Gaps = 7/185 (3%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           D  S +V+D G+    IG +G + P    PS  G+     E+ G  +    D  +G    
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQ-YTGGEKEGKKS--FNDQFMG---- 64

Query: 62  AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREK 121
             R   +I   +E+G + +W   +  W +A  +++K  S  G    LTE   N  +NR+K
Sbjct: 65  MARPDFEIKRILEDGCVVDWEAAQEQWTWAIRDELKFGSFKGTPAFLTEAIWNSEENRKK 124

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRL 181
             EV+ E  +F   Y+A  A    +A G  + +V+D G  V  + PV + + L+  + R 
Sbjct: 125 SLEVLLEGMEFEACYIAPTATCVSFAMGRPTCLVVDIGHDVASVCPVVDGMTLSKSSTRN 184

Query: 182 DVAGR 186
            +AG+
Sbjct: 185 FLAGK 189

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 16/116 (13%)

Query: 275 AGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPA 334
           AG+  L+   I   D+D+R++L   +V++GGSS   GL  R+  EL +            
Sbjct: 375 AGLANLVNTAIMETDVDLRATLAHNLVVTGGSSSILGLADRLMTELNK------------ 422

Query: 335 RLDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWAESGPAAMAK 387
           +L   K RI        R+   ++GG++L+S +     +W+ +QE+ E G   + K
Sbjct: 423 KLPALKFRILTSGHLRERQSRAWLGGSILSS-LGTFHQLWVGRQEYEEVGAERLLK 477

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 110/240 (45%), Gaps = 19/240 (7%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           D   PI +D G+  ++ G   ++ P H FP+ + R   R        I      IG + S
Sbjct: 34  DSTIPIAIDFGSSQIRAGYTNQSTPSHIFPNRLTRYRDRK-------INKTFTFIGNDVS 86

Query: 62  ---AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSG--GKVLLTEPPLNPL 116
              A+R+  Q   P +  II NW  +E +  Y F   + +   +G    +LLTE      
Sbjct: 87  LDQAIRT--QSKSPFDGSIITNWDYVEDIMQYIF-NHLGVVGHNGVSNPILLTEKLATLQ 143

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYA--QGLSSGVVIDSGDGVTHIVPVYESVVL 174
             R    +++FE +D   V + I ++ A Y   +  S+G+VID G+  T ++PV E   +
Sbjct: 144 SQRSNWYQLLFECFDIPEVTLGIDSMFAFYGLNERSSTGLVIDCGNEETDVIPVVEGAGM 203

Query: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVS--YDLELDTKL 232
               +R++  GR    +L DLL+ +   F         +++ +  CYV+  YD E+ T L
Sbjct: 204 LTDAKRINWGGRQAVDYLNDLLTLKYPYFPTKLSTAQYQRVYQDYCYVAKDYDQEIQTIL 263

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 7/72 (9%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGELL-------FNTIQSADIDVRSSLYKAIVLSGGSSM 308
           ER    E LFQP++   + AG+ EL        F + Q        ++   + ++GG+S 
Sbjct: 614 ERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSPTALAMANNLWITGGNSK 673

Query: 309 YPGLPSRIEKEL 320
            PG+  RI KE 
Sbjct: 674 LPGMKERIVKEF 685

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 92/400 (23%), Positives = 163/400 (40%), Gaps = 92/400 (23%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRS 65
           PIV+D G+  +K G +    P     +I       A+++ N       V +  +   ++ 
Sbjct: 5   PIVIDNGSYEIKFGVSNSRIPFRAINAI-------AKDKYNT------VYLSNQIKGIKD 51

Query: 66  YLQISY--PMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPLNPLKN 118
              +++  P E G + +W     +WDY FY     +  +L  TS   ++++E  L+  + 
Sbjct: 52  ISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111

Query: 119 REKMCEVMFEKYDFGGVYVA-----------IQAVLALYAQG------------------ 149
              +  ++FE+Y++G +Y +            + V+++  +                   
Sbjct: 112 SRNIDHIIFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKADDDDDDNNAKFQEQLVTN 171

Query: 150 -----LSS--------------GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTR 190
                +SS               ++IDSG   T I+PV + +      +++D+ GR +T 
Sbjct: 172 DLNTYISSEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTG 231

Query: 191 HLIDLLSRRGYAFNRTADFETVRQIKEKLCYV---SY--DLELDTKLARE------TTTL 239
            L + LS R Y  N T +   V  IKEK  +V   SY    +L  K A E       TT 
Sbjct: 232 LLKETLSFRHY--NVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTF 289

Query: 240 V------ENYELPD-GRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDV 292
           +         +LPD  ++I +  E F   E +F P +  +   G+ E +  ++      +
Sbjct: 290 MGYIKDNSKTKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVI 349

Query: 293 RSSLYKAIVLSGGSSMYPGLPSRIEKEL-KQL---WYTRV 328
           R  +   IV  GG+   P    R+  EL +QL   W T V
Sbjct: 350 RPLMVNNIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHV 389

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 85/189 (44%), Gaps = 18/189 (9%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLN-----IPLKDVMI 56
           D  + I++D G+    IG +G + P    PS  G+ I   E+    N     +P KD  I
Sbjct: 12  DEITAIIIDPGSFNTNIGYSGTDCPQAILPSCYGQYINDEEKPSLFNEQSIGLPRKDYEI 71

Query: 57  GEEASAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPL 116
            E    VRS          G + +W   +  W++A    +   S  G   LLTEP  N  
Sbjct: 72  KE---IVRS----------GEVVDWDKAQEQWEWAIKSVLLFESNKGLPALLTEPIWNSE 118

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNH 176
            NR+K  EV+ E  DF   Y+   A    +A G  + +V+D G  +T + PV + + L+ 
Sbjct: 119 DNRKKSLEVLLEGMDFEACYLTPTATAVSFAMGRPTCLVVDIGHDITSVSPVIDGMTLSK 178

Query: 177 LTRRLDVAG 185
            + R  +AG
Sbjct: 179 SSMRSFIAG 187

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 67/116 (57%), Gaps = 12/116 (10%)

Query: 273 ESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNND 332
           E +G+ +L+ ++I S D+D+R++L   +V++GGSS  PGL  RI  EL +        + 
Sbjct: 372 EISGLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNK--------SL 423

Query: 333 PARLDKFKVRIEDPPRRK-HMVFIGGAVLASIMADKDHMWLSKQEWAESGPAAMAK 387
           PA   KF++      R K +  ++GG++LAS +     +W+ KQE+AE G   + K
Sbjct: 424 PAL--KFRMLTSGQAREKQYQSWLGGSILAS-LGTFHQLWVGKQEYAEVGADRLLK 476

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 102/453 (22%), Positives = 176/453 (38%), Gaps = 96/453 (21%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           +P+VLD G+  +K G +    P   + ++ G  + +      L+  +K +    E +  R
Sbjct: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYGS-AYLSNQMKKIQEVSEVTLRR 59

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPLNPLKNR 119
                  P E G + +W     +WDY  Y     +  +L  +    ++++EP +   +  
Sbjct: 60  -------PHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112

Query: 120 EKMCEVMFEKYDFGGVYVA---------IQA----VLALYAQGLSSG------------- 153
           + M +V+FE+Y+F  ++ A         +QA    VL     G  +              
Sbjct: 113 KNMDQVIFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTIS 172

Query: 154 -------------------VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194
                              +VIDSG   T I+P+ + V      ++LD+ GR +T  L +
Sbjct: 173 TDNLKDDKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKE 232

Query: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELPD------- 247
            LS R Y  +   +   V  IKEK  +VS     D+  A+E T++   Y LPD       
Sbjct: 233 TLSFRHY--DLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSV--EYILPDISSSYLG 288

Query: 248 -------------GRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRS 294
                         +V+K+  E F   E  F P +  +   G+ E +  ++      +R 
Sbjct: 289 YTRENKSKPLPEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRP 348

Query: 295 SLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVF 354
            L   IV +GG+   P   +R+  EL+     R L  D      +  RI  P +   +  
Sbjct: 349 LLVANIVCTGGNFNLPHFAARLAAELQ-----RQLPTD------WTCRISVPKKECELFS 397

Query: 355 IGGAVLASIMADKDHMWLSKQEWAESGPAAMAK 387
                  +         +SK+E+ E GP  + K
Sbjct: 398 WKSMCQFANTDSYKKTRISKEEYYEHGPDWLTK 430

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 110/233 (47%), Gaps = 17/233 (7%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           +P++PI LD G+  V+ G   ++ P H FP+     I+R +ER    I      IG + S
Sbjct: 37  NPNTPIALDFGSYEVRAGFTSQDTPSHVFPT----KIVRYKER---KIQKALTFIGNDCS 89

Query: 62  ---AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTS-GGKVLLTEPPLNPLK 117
              AVRS+ +   P +  +I NW  ME +  Y F+     P+      ++LTE       
Sbjct: 90  LDNAVRSHSR--SPYDGSLITNWEYMEDMLSYTFHHLGVQPNDGISNPMILTEKMATVQA 147

Query: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGL--SSGVVIDSGDGVTHIVPVYESVVLN 175
            R    +++FE Y    V   I  + + YA     S+G++I+SG   T+I+PV +   + 
Sbjct: 148 QRSNWYQLLFECYGIPQVTFGIDGLFSFYANNSPDSTGLIINSGHEDTNIIPVIKGKGIL 207

Query: 176 HLTRRLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVSYDLE 227
              +R+D  G     +L  LLS +  Y  ++  D+   + + +  CY + + E
Sbjct: 208 SEAKRIDWGGNQSIDYLKSLLSLKYPYFPSKLTDYH-FQSMYQNHCYFAKNYE 259

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 7/72 (9%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGELL-------FNTIQSADIDVRSSLYKAIVLSGGSSM 308
           ER  A E +FQP++  ++ AG+ EL        F +  S        +   I ++GG++ 
Sbjct: 611 ERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLDMASNIFITGGNTK 670

Query: 309 YPGLPSRIEKEL 320
            P L  RI  E 
Sbjct: 671 IPNLRERIVNEF 682

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 82/376 (21%), Positives = 153/376 (40%), Gaps = 72/376 (19%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAV 63
            +PIV+D G+  VK G +    P+    ++  +    A    N    +KD+         
Sbjct: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPS-----TSGGKVLLTEPPLNPLKN 118
            S + I  P E G + +W     +WDY F+   + P+     T G  ++++E  +   + 
Sbjct: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111

Query: 119 REKMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLSS 152
              M +VMFE+Y+F  ++ +  A                          +  + +Q + +
Sbjct: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171

Query: 153 -----GVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207
                 +VIDSG   T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229

Query: 208 DFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELPD-------------------- 247
           +   V  IKEK  ++S    +D+   ++  ++  +Y LPD                    
Sbjct: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287

Query: 248 -GRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGS 306
             +VI +  E F   E +F P +  +   G+ E +  ++      +R  L   IV  GG+
Sbjct: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347

Query: 307 SMYPGLPSRIEKELKQ 322
              P   SR+  EL++
Sbjct: 348 FNMPNFGSRLATELQR 363

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 102/232 (43%), Gaps = 10/232 (4%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           +P SPI +D G+  ++ G      P H FP+ + +   R   + N      D ++ +   
Sbjct: 35  NPQSPIAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNK-NFTFVGNDTLLDQ--- 90

Query: 62  AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTS-GGKVLLTEPPLNPLKNRE 120
           AVRS  Q   P +   + NW   E + DY F+    +P       +LLTE        R 
Sbjct: 91  AVRS--QSRSPFDGPFVTNWNLTEEILDYTFHHLGVVPDNGIPNPILLTERLATVQSQRT 148

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYA---QGLSSGVVIDSGDGVTHIVPVYESVVLNHL 177
              +++FE Y+  GV   I ++ + Y     G  +G+VI  G   T+++PV +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLFSFYNYNPSGNKTGLVISCGHEDTNVIPVVDGAGILTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELD 229
            +R++  G     +L DL++ +   F     +     + +  CYVS + + D
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYKDYCYVSRNYDED 260

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 58/139 (41%), Gaps = 28/139 (20%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGELLFNTI------QSADIDVRS-SLYKAIVLSGGSSM 308
           ER    E +FQP +   + AG+ EL    +      Q   +   S  +   ++++GG++ 
Sbjct: 617 ERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQTSIDMVNNVLITGGNAK 676

Query: 309 YPGLPSRIEKELKQLWYTRV-----LNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASI 363
            PGL  RI KE      T       +++DP+ LD +K               G A LA  
Sbjct: 677 VPGLKERIVKEFTGFLPTGTNITVNMSSDPS-LDAWK---------------GMAALARN 720

Query: 364 MADKDHMWLSKQEWAESGP 382
                   +SK+E+ E GP
Sbjct: 721 EEQYRKTVISKKEYEEYGP 739

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 87/379 (22%), Positives = 144/379 (37%), Gaps = 70/379 (18%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           +P+V+D G+  VK G A    P     +I       A    N    +KD+          
Sbjct: 4   TPVVIDNGSYRVKFGPASLEAPYCALNAIANDK-YDASYLSNQIKSIKDI---------- 52

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPLNPLKNR 119
           S + I  P   G + +W    L+WDY  Y         +  T    ++ +E  +   +  
Sbjct: 53  SSVSIKRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELG 112

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVI----------------------- 156
           + M +V+FE+Y+FG +  +  A    + +     ++I                       
Sbjct: 113 KNMDQVIFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLV 172

Query: 157 -DSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215
            DSG   T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 173 VDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNI 230

Query: 216 KEKLCYVSYDLELDTKLARETTTLVENYELP----------------------DGRVIKV 253
           KEK  +VS     D+   ++ T+    Y LP                      D + I +
Sbjct: 231 KEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITL 288

Query: 254 GQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLP 313
             E F   E  F P +  +   G+ E +  ++      +R  +   I+  GG+   P   
Sbjct: 289 KDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFA 348

Query: 314 SRIEKEL-KQL---WYTRV 328
           SR+ KEL +QL   W  R+
Sbjct: 349 SRVAKELQRQLPTDWKCRI 367

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/362 (22%), Positives = 144/362 (39%), Gaps = 60/362 (16%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRS 65
           PIV+D G+  +K G      P   F + + R    +    N    +KD+          S
Sbjct: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPLNPLKNRE 120
            +    P E G + +W     +WDY F+         L  + G  ++++E  +   +  +
Sbjct: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLSSG------------------VVIDSG 159
            M +V+FE+Y+F  ++ +  A  A + +    +S                    +VID G
Sbjct: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173

Query: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231

Query: 220 CYVSYDLELDTKLARETTTLVENYELP-------------------DGRVIKVGQERFEA 260
            +VS     ++   +E T +   Y LP                   D + +++  E F  
Sbjct: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289

Query: 261 AECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKEL 320
            E  F P +  +   G+ E +  ++      +R  +   IV +GG+   P   +R+  EL
Sbjct: 290 PETFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349

Query: 321 KQ 322
           ++
Sbjct: 350 QR 351

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 109/233 (46%), Gaps = 17/233 (7%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           +P + I +D G+  V+ G   +  P H FP+ + R   R   R NL        IG + +
Sbjct: 34  NPETAIAIDFGSSEVRAGYGNQERPSHIFPNRIARWRDRKLNR-NL------TFIGNDTN 86

Query: 62  ---AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSG--GKVLLTEPPLNPL 116
              +VRS  Q   P +  ++ NW   E + +Y F+  + +  T G    +++TE      
Sbjct: 87  LDLSVRS--QSRSPYDGALVTNWDYTEDIMEYTFH-HLGVKGTDGIPNPIIMTEKLGALH 143

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQ--GLSSGVVIDSGDGVTHIVPVYESVVL 174
             R+   +++FE +    V   + ++ + YA     +SG+VI SG+  THI+PV +   +
Sbjct: 144 SQRDNWYQLLFECFGAPQVTFGLDSLFSFYANNDASASGLVISSGNEDTHIIPVVDGKGV 203

Query: 175 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLE 227
               +R++  GR    +L +LL+ +   F         + + ++ CYVS D +
Sbjct: 204 LGEAKRINWGGRQSVDYLSNLLALKYPYFPIKPSTHQFKALYDEFCYVSPDYQ 256

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGELL-------FNTIQSADIDVRSSLYKAIVLSGGSSM 308
           ER    E +FQP++  ++ AG+ E+        F + +S    +  SL   + L+GG+  
Sbjct: 609 ERIRVPEVIFQPSMGGLDQAGIIEICETNFLKKFGSSRSELSSISRSLASNVFLTGGNMR 668

Query: 309 YPGLPSRIEKELKQL 323
            PG+  R+ +E + L
Sbjct: 669 LPGMRERVVREFRGL 683

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 84/385 (21%), Positives = 142/385 (36%), Gaps = 80/385 (20%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           SPIV+D G+  +K   +    P     ++  +         N    +KD+          
Sbjct: 4   SPIVIDNGSYEIKFAPSTNEMPFRALNAL-AKDKFGTSYLSNHIKNIKDI---------- 52

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQ-----MKLPSTSGGKVLLTEPPLNPLKNR 119
           S +    P E G +  W     +WDY F+         L    G  ++ +E  +   +  
Sbjct: 53  SSITFRRPHELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELS 112

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------SSGV------ 154
           +   +V+FE+Y+F  ++ +  AV   + +                     +SG+      
Sbjct: 113 KHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSR 172

Query: 155 -----------------VIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLS 197
                            VIDSG   T I+PV + +      ++LD+ GR +T  L + LS
Sbjct: 173 ECGSAQNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLS 232

Query: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTL------------------ 239
            R Y  N   +   V  +KEK  +VS     D+  A++   L                  
Sbjct: 233 FRHY--NMMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNP 290

Query: 240 -VENYELP-DGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLY 297
             EN  LP D + I +  E F   E  F P +  +   G+ E +  ++      VR  + 
Sbjct: 291 REENSPLPEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMV 350

Query: 298 KAIVLSGGSSMYPGLPSRIEKELKQ 322
             IV +GG+   P    R+  EL++
Sbjct: 351 GNIVCTGGNFNLPNFAQRLAAELQR 375

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/369 (22%), Positives = 150/369 (40%), Gaps = 60/369 (16%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRS 65
           PI++D G+  +K G +    P            L  ++ G  ++  +   I E ++    
Sbjct: 4   PIIIDNGSYEIKFGPSSLKSPYRALNC------LARDKYGRYHLSNQMKQIREVSNC--- 54

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFYEQ----MKLPSTSGGKVLLTEPPLNPLKNREK 121
              +  P E G + +W   E +WDY  +        L  +    ++++E  ++  +  + 
Sbjct: 55  --HVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112

Query: 122 MCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VIDSGD 160
           M +V+FE+Y+FG +       Y+     +A Y    S G+              V+DSG 
Sbjct: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171

Query: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLC 220
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229

Query: 221 Y---VSY--------DLELDTKLARETTTLVENYELP------DGRVIKVGQERFEAAEC 263
           +   VSY        +  +D  L    T+L+     P      D + + +  E F   E 
Sbjct: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289

Query: 264 LFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQL 323
            F P + ++   G+ E +  +I      +R  +   I + GG+       SR+  EL++ 
Sbjct: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349

Query: 324 ----WYTRV 328
               W  RV
Sbjct: 350 CPTDWSVRV 358

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 81/368 (22%), Positives = 146/368 (39%), Gaps = 65/368 (17%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           +P+++D G+  +K G + +  P     ++             +N  +KD+          
Sbjct: 4   APLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQIN-NIKDI---------- 52

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPLNPLKNR 119
           S + I  P + G + +W     +WDY FY     +  ++   S   ++LTE P+   +  
Sbjct: 53  SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELS 112

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS------------------------GVV 155
               +V+FE+Y F  +Y A  A    + +   +                         +V
Sbjct: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172

Query: 156 IDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215
           IDSG   + I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  I
Sbjct: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNI 230

Query: 216 KEKLCYVSYDLELDTKLARETTTLVENYELPDGRVIKVG--------------------- 254
           KE   ++S  +       ++  T VE Y LPD +   +G                     
Sbjct: 231 KENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288

Query: 255 QERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPS 314
            E F   E  F P + +V   G+ E +  ++      +RS +   IV +GG+   P   S
Sbjct: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348

Query: 315 RIEKELKQ 322
           RI  EL++
Sbjct: 349 RIYTELQK 356

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 103/233 (44%), Gaps = 11/233 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           +PI +D G+  V+ G    + P H FP+ + R   R   +        DV++ +    VR
Sbjct: 37  TPIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRHRDRKLSK-TFTFIGNDVLLDQ---TVR 92

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKN-REKMC 123
           S  Q   P +   I NW  +E +  Y F     +   S    L+   PL  L++ R+   
Sbjct: 93  S--QSKSPFDGSFIANWDYVEDIMQYTFNHLGVVGDNSVRNPLIINEPLGSLQSQRKNWY 150

Query: 124 EVMFEKYDFGGVYVAIQAVLALYA--QGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRL 181
           E++FE +    V   I  +   YA  +G   G+VI+  +  T ++PV +   +    +R+
Sbjct: 151 ELLFECFHLPNVSFGIDGMFGFYANNEGNQDGIVINCSNEETDVIPVVDGRGVLTDAKRI 210

Query: 182 DVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL--ELDTKL 232
           +  GR    +L DL+S +   F         +Q+    CYVS D   ++DT L
Sbjct: 211 NWGGRQAVDYLSDLMSLKYPYFPSKLSTFQYQQMYTNYCYVSPDYSNDIDTML 263

 Score = 37.4 bits (85), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 7/72 (9%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGEL----LFNTIQSADIDVRSS---LYKAIVLSGGSSM 308
           ER    E LFQP +   + AG+ EL    L N   S   ++  +   + K I L+GG S 
Sbjct: 614 ERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPRELSETSLGMAKNIWLTGGHSK 673

Query: 309 YPGLPSRIEKEL 320
            PGL  RI KE 
Sbjct: 674 LPGLRERIVKEF 685

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 106/241 (43%), Gaps = 15/241 (6%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           DP+ PI +D G+  V+ G   ++ P H FP+ + R   R        I      +G + +
Sbjct: 34  DPNVPIAIDFGSSEVRAGYTNQSLPSHVFPTRLTRHRDRK-------INKTFTFVGNDTN 86

Query: 62  AVRSY-LQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSG--GKVLLTEPPLNPLKN 118
             ++   Q   P +  +I NW  +E + +Y F   + +    G    +LLTE        
Sbjct: 87  LEQTLRTQSRSPFDGPMITNWDYVEDMMEYTF-NHLGVVGHDGISNPILLTEKMATLQSQ 145

Query: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYA--QGLSSGVVIDSGDGVTHIVPVYESVVLNH 176
           R    ++MFE +    +   I ++ + +A  Q  S+G+VI SG+  T+++PV     +  
Sbjct: 146 RSNWYQLMFECFGVPKLTFGIDSLFSYFANNQSDSTGLVISSGNEDTNVIPVVCGKGILS 205

Query: 177 LTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVS--YDLELDTKLAR 234
             +R++  GR    +  +LLS +   F         + I    CYVS  YD E+   L  
Sbjct: 206 EAKRINWGGRHSVEYTTNLLSLKYPYFPTKLVSSQFQSIYHDFCYVSRDYDEEIQNILTM 265

Query: 235 E 235
           E
Sbjct: 266 E 266

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 58/139 (41%), Gaps = 28/139 (20%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGEL-------LFNTIQSADIDVRSSLYKAIVLSGGSSM 308
           ER    E +FQP +  ++ AG+ EL        F + +     V   +   + L+GG+  
Sbjct: 610 ERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKFGSSRRQLSSVSQEMANNVFLTGGNVR 669

Query: 309 YPGLPSRIEKELKQLW-----YTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASI 363
            PGL  RI +E  +       Y   + +DPA +D +K               G A  A  
Sbjct: 670 VPGLRDRIVREFTEFLPVGTKYNIKVASDPA-IDAWK---------------GMAKFAQS 713

Query: 364 MADKDHMWLSKQEWAESGP 382
             D    +++K+E+ E GP
Sbjct: 714 STDYKGSYVTKKEYEEYGP 732

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 82/371 (22%), Positives = 148/371 (39%), Gaps = 65/371 (17%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR- 64
           P++++ G+  +K G A    P         R  L  +  G  ++         +   +R 
Sbjct: 4   PLLMENGSYEIKFGPANLETPYR------ARNCLTRDRYGRYHL-------SNQMDQIRD 50

Query: 65  -SYLQISYPMENGIIKNWTDMELLWDYAFYEQ----MKLPSTSGGKVLLTEPPLNPLKNR 119
            S+  I  P E G + +W   E +WDY  +       +L  +    ++ +E  +   +  
Sbjct: 51  ISHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEIS 110

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVIDSGD 160
           + M +V+FE+Y+FG +     A    + +                 SG     +V+DSG 
Sbjct: 111 KNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGF 170

Query: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLC 220
             T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C
Sbjct: 171 NCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCC 228

Query: 221 YVSYDLELDTKLARETTTLVENYELPD-------------------GRVIKVGQERFEAA 261
           ++      D+   R+  T VE Y LPD                    +++++  E F   
Sbjct: 229 FMPPVSYFDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVP 286

Query: 262 ECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELK 321
           E  F P + ++   G+ E +   +      +R  L   IV  GG+       +R+  EL+
Sbjct: 287 ETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQ 346

Query: 322 QL----WYTRV 328
           +     W  RV
Sbjct: 347 RQCPTDWKVRV 357

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 86/393 (21%), Positives = 144/393 (36%), Gaps = 96/393 (24%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVM----IGEEA 60
           +PIV+D G+  +K G           PS   +P  RA     LN   KD      +    
Sbjct: 4   APIVIDNGSYEIKFG-----------PSTNEKP-FRA-----LNALAKDKFGTSYLSNHI 46

Query: 61  SAVRSYLQISY--PMENGIIKNWTDMELLWDYAFYEQMK-----LPSTSGGKVLLTEPPL 113
             ++    +++  P E G +  W     +WDY F+  ++     L    G  ++ +E  +
Sbjct: 47  KNIKDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCM 106

Query: 114 NPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------- 153
              +  +   +V+FE+Y+F  ++ +  A    + +   S                     
Sbjct: 107 TLPELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNE 166

Query: 154 ----------------------VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRH 191
                                 +VIDSG   T I+PV + +      ++LDV GR +T  
Sbjct: 167 ADMPSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGL 226

Query: 192 LIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELP----- 246
           L + LS R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LP     
Sbjct: 227 LKETLSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTS 282

Query: 247 -----------------DGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSAD 289
                            D + I +  E F   E  F P +  +   G+ E +  ++    
Sbjct: 283 FLGYVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLP 342

Query: 290 IDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQ 322
             VR  +   IV +GG+   P    R+  EL++
Sbjct: 343 EIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 87/371 (23%), Positives = 146/371 (39%), Gaps = 62/371 (16%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           M     IV+D G+  VK G A E  P       V    L  ++ G  ++  +   I + +
Sbjct: 1   MTADQAIVIDNGSYQVKFGLASEVRPR------VALNALAKDKYGVTHLSNQVQNIKDIS 54

Query: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQ----MKLPSTSGGKVLLTEPPLNPL 116
           S V        P E G + +W     +WDY  Y      +   S     V+L+E  +   
Sbjct: 55  SVV-----FRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLP 109

Query: 117 KNREKMCEVMFEKYDFGGVYVA-IQAVLALYA--------------------QGLSSG-- 153
           +  +   +V+FE+Y+   +Y A   A +  Y                     + + +G  
Sbjct: 110 ELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKE 169

Query: 154 -----VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTAD 208
                +VIDSG   T ++P+ + V      ++LDV GR +   L + +S R Y  N   +
Sbjct: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVMDE 227

Query: 209 FETVRQIKEKLCYV---SYDLELDTKLARETTTLVENYE-------------LPD-GRVI 251
              V  IKE+  YV   SY      K   +   ++ +++             LPD  +++
Sbjct: 228 SILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQIL 287

Query: 252 KVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPG 311
            +  ERF   E  F P +      G+ E +  +I      +R  +   IV  GG+   PG
Sbjct: 288 TLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPG 347

Query: 312 LPSRIEKELKQ 322
              R+  EL++
Sbjct: 348 FTDRLVSELQR 358

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 97/234 (41%), Gaps = 17/234 (7%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           +P  PI +D G+  V+ G   E  P H FP+ + R   R        I       G + S
Sbjct: 34  NPEIPIAIDFGSSTVRAGYTNEARPSHIFPTKLTRYRDRK-------INKTFTFTGNDCS 86

Query: 62  ---AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTS-GGKVLLTEPPLNPLK 117
               +RS  Q+  P +  +I NW  +E +  Y F     +P       +++TE       
Sbjct: 87  LDQTIRS--QMKSPFDGALITNWDYVEDILQYTFNHLGVVPDHGVQNPIIITEKLATIQS 144

Query: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALY----AQGLSSGVVIDSGDGVTHIVPVYESVV 173
            R    +++FE Y+       I ++ A Y        S+G+VID     T+I+P+ +   
Sbjct: 145 QRSNWYQLLFETYNVPKATFGIDSLFAFYNNNNGSATSTGMVIDCSHEETNIIPIVDGQG 204

Query: 174 LNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLE 227
           +    +R++  GR    +L +LL+ +   F           + +  CYVS D +
Sbjct: 205 ILTDAKRINWGGRHAIDYLSNLLALKYPYFPTKLSSYQYESMYQNFCYVSQDYD 258

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 60/139 (43%), Gaps = 18/139 (12%)

Query: 251 IKVGQERFEAAECLFQPNLVDVESAGVGEL-------LFNTIQSADIDVRSSLYKAIVLS 303
           I +  ER    E +FQP++  ++ AG+ EL        F +      ++  ++   I L+
Sbjct: 611 IHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELSLTMANNIWLT 670

Query: 304 GGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASI 363
           GG+S  PGL  RI KE ++               +F V +   P      + G A LA  
Sbjct: 671 GGNSKIPGLRERIVKEFREFLPVNT---------QFNVNMTSDP--TFDAWNGMAKLAQN 719

Query: 364 MADKDHMWLSKQEWAESGP 382
             D     +SK+E+ E GP
Sbjct: 720 ETDYKKTIISKKEYEEYGP 738

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 87/390 (22%), Positives = 145/390 (37%), Gaps = 92/390 (23%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVM----IGEEAS 61
           PIV+D G+  +K G           PS   +P  RA     LN   KD      +     
Sbjct: 5   PIVIDNGSYEIKFG-----------PSTNKKP-FRA-----LNALAKDKFGTSYLSNHIK 47

Query: 62  AVRSYLQISY--PMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPLN 114
            ++    I++  P E G +  W     +WDY  +     +   L    G  ++ +E  + 
Sbjct: 48  NIKDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMT 107

Query: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS----------------------- 151
             +  +   +V+FE+Y+F  ++ +  AV   + +                          
Sbjct: 108 LPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDST 167

Query: 152 ------------SG-------VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHL 192
                       SG       +VIDSG   T I+PV + +      ++LD+ GR +T  L
Sbjct: 168 NSTSSESKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLL 227

Query: 193 IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTL------------- 239
            + LS R Y  N   +   V  IKE+  +VS     D+   ++   L             
Sbjct: 228 KETLSFRHY--NMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLG 285

Query: 240 ------VENYELP-DGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDV 292
                  EN  LP D ++I +  E F   E  F P +  +   G+ E +  ++      V
Sbjct: 286 YVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIV 345

Query: 293 RSSLYKAIVLSGGSSMYPGLPSRIEKELKQ 322
           R  +   IV +GG+   P    R+  EL++
Sbjct: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 104/234 (44%), Gaps = 15/234 (6%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA- 60
           DP+ PI +D G+  ++ G    + P H FP+   +     + + N  +P     IG +  
Sbjct: 38  DPNIPIAIDFGSYELRAGYTNISRPSHIFPNRFSK---YRDRKTNKYLPC----IGYDTW 90

Query: 61  --SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKN 118
                RS  Q   P +  ++ NW  +E +  Y F+     P       ++    L  L++
Sbjct: 91  LDQTTRS--QARSPFDGPLVVNWDMVEDILQYTFHHLGVQPDNGVTNPIIINEKLACLQS 148

Query: 119 -REKMCEVMFEKYDFGGVYVAIQAVLALYAQ--GLSSGVVIDSGDGVTHIVPVYESVVLN 175
            R    + +FE +    V +A++ +LA Y    G S+G+VID G   T+++P+ E   + 
Sbjct: 149 QRSNWYQTLFESFGVPKVSMAVEGMLAFYGHNGGSSTGIVIDCGYEDTNVIPIVEGQGMM 208

Query: 176 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELD 229
              +R++  G     +L +LL  +   F     +    ++ +  CYVS D E D
Sbjct: 209 LDAKRINWGGHSSIDYLSNLLYLKYPYFPTKLSYLQYEKMYKDYCYVSQDYETD 262

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 61/138 (44%), Gaps = 18/138 (13%)

Query: 251 IKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSA------DIDVRS-SLYKAIVLS 303
           + +  ER    E +FQP L   + AG+ E+    I         ++  +S  + K + L 
Sbjct: 612 MHINVERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLV 671

Query: 304 GGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASI 363
           GG++  PGL SR+ KE     +T  L +D     K  V I + P     V+ G   LA+ 
Sbjct: 672 GGNAQVPGLKSRVVKE-----FTEFLPSDT----KINVNISEAPTLD--VWNGMYRLANT 720

Query: 364 MADKDHMWLSKQEWAESG 381
             D     ++ +E+ E G
Sbjct: 721 EEDYQRTIVTSEEYDECG 738

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 89/383 (23%), Positives = 143/383 (37%), Gaps = 75/383 (19%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRS 65
           P V+D G+  +K G A    P      I  +    A    N    ++D+          S
Sbjct: 3   PFVIDNGSYEIKFGHANLVTPFRANNGI-AKDKYGASYLSNHMKTIRDI----------S 51

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFYEQMKLP------STSGGKVLLTEPPLNPLKNR 119
              I  P E G + +W     +WDY  Y   +        +T    ++LTE      +  
Sbjct: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQ-----------GLSSGV-------------- 154
           +   +V+FE+Y+F  ++ +  +    +A            G  + V              
Sbjct: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRD 171

Query: 155 ---VIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211
              VIDSG   T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229

Query: 212 VRQIKEKLCYVSYDLELDTKLARETTTLVENYELPDGRV--------------------- 250
           +  IKEK  +VS     D+   ++   +   Y LPD +                      
Sbjct: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287

Query: 251 -IKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMY 309
            I +  ERF   E  F P + ++   G+ E +   I      +R  L   IV  GG+   
Sbjct: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347

Query: 310 PGLPSRIEKEL-KQL---WYTRV 328
           P + SR+  EL +QL   W  RV
Sbjct: 348 PHMSSRLTSELQRQLPTDWTCRV 370

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 81/372 (21%), Positives = 143/372 (38%), Gaps = 72/372 (19%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           SPI +D G+  +K G    + P   + +I    I +               +  +   ++
Sbjct: 4   SPIAIDNGSYEIKFGTTDLSSP---YRAINAFAIDKYHT----------TYLSNQIKNIK 50

Query: 65  SYLQISY--PMENGIIKNWTDMELLWDYAFYEQMKLP-----STSGGKVLLTEPPLNPLK 117
               +++  P E G + +W     +WDYA +   + P        G  ++ +E  +   +
Sbjct: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110

Query: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGV----------------------- 154
             + M +V+FE+Y+F   Y +  A    +A   ++ +                       
Sbjct: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170

Query: 155 ----VIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGY-AFNRTADF 209
               VIDSG   T I+PV + V      ++LD+ GR +   L + LS R Y   + T   
Sbjct: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI-- 228

Query: 210 ETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELP-------------------DGRV 250
             V  IKE   +VS     D+    +  T VE Y LP                   + + 
Sbjct: 229 -LVNNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQT 285

Query: 251 IKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYP 310
           IK+  E F   E  F P +  +   G+ E +  ++      +R  L   +V +GG+   P
Sbjct: 286 IKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLP 345

Query: 311 GLPSRIEKELKQ 322
              +R+  EL++
Sbjct: 346 HFATRLTSELQR 357

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 107/245 (43%), Gaps = 32/245 (13%)

Query: 3   PHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERG--------NLNIPLKDV 54
           P  PI +D G+  VK G   ++ P H F + + R   R   +         NL+ PL+  
Sbjct: 35  PDIPIAIDFGSYNVKAGYTNQSLPTHVFTNKLTRYRDRKLAKTMTFIGNDTNLDQPLR-- 92

Query: 55  MIGEEASAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSG---GKVLLTEP 111
                       +Q   P +   I NW   E ++DY  +  + + +T+G     ++LTE 
Sbjct: 93  ------------IQAKRPYDGLFIANWEYAEEIFDYTLH-HLGVQTTNGSISNPIILTEK 139

Query: 112 PLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGL----SSGVVIDSGDGVTHIVP 167
                  R    +++FE +D       + ++ A Y        S G+VI+ G   T+IVP
Sbjct: 140 MACLQSQRANWYQLLFETFDVPSATFGLDSLYAFYNNCANPFESDGLVINCGHEDTNIVP 199

Query: 168 VYESVVLNHLTRRLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVSYDL 226
           + +   +    +R++  GR  T +L  LL+ +  Y   + ++F+  + + E  CYVS + 
Sbjct: 200 IVQGKGILTEAKRINWGGRHSTEYLSSLLTLKYPYFPTKLSEFQ-YQTMYEDFCYVSPNY 258

Query: 227 ELDTK 231
             D K
Sbjct: 259 NEDIK 263

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 61/142 (42%), Gaps = 18/142 (12%)

Query: 251 IKVGQERFEAAECLFQPNLVDVESAGVGEL-------LFNTIQSADIDVRSSLYKAIVLS 303
           I +  ER    E +FQP++   + AG+ EL        FN+       +   +   + L+
Sbjct: 617 IHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLSSISERMLNNVWLT 676

Query: 304 GGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASI 363
           GG +  PGL  RI KE     YT  L   P    K  + I + P      + G A LAS 
Sbjct: 677 GGHAKLPGLKERIVKE-----YTEFL---PVGT-KMSINISNDPSLD--TWKGMAKLASN 725

Query: 364 MADKDHMWLSKQEWAESGPAAM 385
                 + ++K+++ E GP  M
Sbjct: 726 TDYLKKIQVTKKDYEEYGPEYM 747

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 110/240 (45%), Gaps = 13/240 (5%)

Query: 3   PHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASA 62
           P  PI +D G+  ++ G      P H F + + R   R   +  +     DV + +   A
Sbjct: 35  PDVPIAVDFGSNQLRAGLINRATPSHVFTNRITRFRDRKLMK-TMTFIGNDVNLDQ---A 90

Query: 63  VRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTS-GGKVLLTEPPLNPLKNREK 121
           VR+  Q   P +  ++ NW  +E + +Y F      P+      +L+TE        R  
Sbjct: 91  VRA--QSKSPFDGPMVTNWDYVEDILEYTFNHLGSTPNNGISNPILVTERLATLQTQRSS 148

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGL--SSGVVIDSGDGVTHIVPVYESVVLNHLTR 179
             +V+FE ++  GV   I ++ A Y      S+G+VI  G+  T+I+PV +   +    +
Sbjct: 149 WYQVLFECFNVPGVTFGIDSLFAYYQNTTANSTGLVIGCGNEDTNIIPVVDGQGMLTEAK 208

Query: 180 RLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVS--YDLELDTKLARET 236
           R++  G     +L +L++ +  Y   + ++F   R + E  CYVS  YD EL + L  +T
Sbjct: 209 RINWGGSQAADYLTNLMTLKYPYFPTKLSNFH-YRTMYEDYCYVSQDYDEELKSFLKLDT 267

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 55/134 (41%), Gaps = 18/134 (13%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGELL-------FNTIQSADIDVRSSLYKAIVLSGGSSM 308
           ER    E  FQP +   + AGV EL        F         + S + K + ++GG++ 
Sbjct: 612 ERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVTGGNAK 671

Query: 309 YPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKD 368
            PGL  RI KE     +T  L   P     F V I   P      + G A  A    D  
Sbjct: 672 IPGLRERIVKE-----FTGFL---PVNT-SFNVNISSDPSLD--AWRGMAKYAQNETDYK 720

Query: 369 HMWLSKQEWAESGP 382
             ++SK+E+ E GP
Sbjct: 721 KSFISKKEYEEYGP 734

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 82/384 (21%), Positives = 141/384 (36%), Gaps = 80/384 (20%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRS 65
           PIV+D G+  +K G +    P     + + +         N    +KD+          S
Sbjct: 5   PIVIDNGSYEIKFGPSTNKMPFRAL-NALAKDKFGTSYLSNHIKNIKDI----------S 53

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFY-----EQMKLPSTSGGKVLLTEPPLNPLKNRE 120
            +    P E G +  W     +WDY  +     +   L    G  ++ +E  +   +  +
Sbjct: 54  SVTFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLS------SG--------------------- 153
              +V+FE+Y+F  ++ +  AV   + +         SG                     
Sbjct: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKE 173

Query: 154 ---------------VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198
                          +VIDSG   T I+PV + +      ++LD+ GR +T  L + LS 
Sbjct: 174 PVDETNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSF 233

Query: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTL------------------- 239
           R Y  N   +   V  IKEK  +VS     D+  ++    L                   
Sbjct: 234 RHY--NMMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPN 291

Query: 240 VENYELP-DGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYK 298
            E+  LP D + I +  E F   E  F P +  +   G+ E +  ++      VR  +  
Sbjct: 292 EEDSPLPTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIG 351

Query: 299 AIVLSGGSSMYPGLPSRIEKELKQ 322
            IV +GG+   P    R+ +EL++
Sbjct: 352 NIVCTGGNFNLPNFAQRLARELQR 375

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 112/242 (46%), Gaps = 21/242 (8%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           +P+ PI +D G+  ++ G   +  P H FP+ + R   R        +      IG + S
Sbjct: 34  NPNVPIAIDFGSSKLRAGYVNDPNPSHIFPNRLTRYRDRK-------LAKTMTFIGNDTS 86

Query: 62  ---AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSG--GKVLLTEPPLNPL 116
              AVR  +Q     +  ++ NW  +E   +Y F   + + +  G    +++ E      
Sbjct: 87  LDQAVR--VQAKSAFDGPLVTNWDYVEDTLEYTF-NHLGVAANGGISNPLVINERLATIQ 143

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQG--LSSGVVIDSGDGVTHIVPVYESVVL 174
             R    +++FE +D  GV   I ++   Y      S+G+VI  G+  T+++PV +   +
Sbjct: 144 SQRANWYQILFECFDVPGVTFGIDSLFGFYHNSGPNSTGLVIGCGNEDTNVIPVVDGKGV 203

Query: 175 NHLTRRLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYV--SYDLELDTK 231
              ++R++  G   T +L +L+S +  Y   + + F+  + + E  CYV  SYD EL+  
Sbjct: 204 LTESKRINWGGNQATEYLTNLMSLKYPYFPTKLSPFQ-YKTMYEDYCYVSQSYDEELEKY 262

Query: 232 LA 233
           L+
Sbjct: 263 LS 264

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 63/134 (47%), Gaps = 18/134 (13%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGELL-------FNTIQSADIDVRSSLYKAIVLSGGSSM 308
           ER    E LFQPN+   + AG+ EL        F + Q    DV +S+ + + ++GG++ 
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLLLRKFGSTQRQLSDVSTSMAQNVWITGGNAK 670

Query: 309 YPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKD 368
            PGL  RI KE  +     + +  P     F +R    P      + G A LA    D  
Sbjct: 671 LPGLRERIVKEFSEF----LPSGSP-----FSIRKSQDPSLD--AWRGMAKLAQNTEDFK 719

Query: 369 HMWLSKQEWAESGP 382
           H +++KQE+ E GP
Sbjct: 720 HGYITKQEYLEYGP 733

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 101/227 (44%), Gaps = 10/227 (4%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           DP++ I +D G+  ++ G   +N P + FP+ + +   R  ++        D ++ +   
Sbjct: 34  DPNARIAIDFGSYNIRAGYTNQNTPSYIFPTRLTKHRDRKLQK-TFTFIGNDTLLDQ--- 89

Query: 62  AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSG-GKVLLTEPPLNPLKN-R 119
            +RS  Q   P +  ++ NW  +E + +Y F+  + +   +G    L+    L  L++ R
Sbjct: 90  TIRS--QSKSPFDGTLLTNWDYVEDMLEYTFH-HLGVSGNNGVSNPLIINERLACLQSQR 146

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVIDSGDGVTHIVPVYESVVLNHLT 178
               +++FE +D   V   I ++ + Y       G+VI+ G+  T ++P+     +    
Sbjct: 147 NSWYQLLFETFDLPEVSFGIDSLFSFYGNSTKEDGLVINCGNEETDVIPIVGGRGILSEC 206

Query: 179 RRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYD 225
           +R++  G   T  L  LL+ +   F          Q+ E  CY S D
Sbjct: 207 KRINWGGSQSTNFLSSLLTLKYPYFPAKLSTLQYTQMYEDYCYTSPD 253

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 66/144 (45%), Gaps = 28/144 (19%)

Query: 251 IKVGQERFEAAECLFQPNLVDVESAGVGELLFNTI------QSADIDVRSS-LYKAIVLS 303
           + +  ER    E LF+P++   + AG+ EL    +      +  ++   SS +   + ++
Sbjct: 608 LHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWIT 667

Query: 304 GGSSMYPGLPSRIEKELKQLW-----YTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGA 358
           GG++  PG+ +RI KE  +        +  ++ DP+ LD +K               G A
Sbjct: 668 GGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSEDPS-LDAWK---------------GMA 711

Query: 359 VLASIMADKDHMWLSKQEWAESGP 382
            LA+   D  +  ++++E+ E GP
Sbjct: 712 KLANNETDYKNTAVTRKEYEEYGP 735

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 101/232 (43%), Gaps = 19/232 (8%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS 61
           D   PI +D GT  VK G   +  P   FP+ + R   R   R           IG + +
Sbjct: 35  DSSIPIAIDFGTCSVKAGYVNKADPAFNFPTRLTRFRDRKMSRTM-------TFIGNDTN 87

Query: 62  ---AVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSG--GKVLLTEPPLNPL 116
              AVRS  Q   P +   + NW   E + +Y F + + + +  G    +++TE      
Sbjct: 88  LDYAVRS--QSKTPFDGPFVTNWEYAEDILEYTF-KHLGVTANHGISNPLIMTEKLATLQ 144

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQ--GLSSGVVIDSGDGVTHIVPVYESVVL 174
             R    +++FE ++   V   I  V A YA     SSG+V    +  T+++P+ +   +
Sbjct: 145 SQRANWYQLLFETFNTSNVSFGIDNVFAFYANTDKHSSGLVFGLNNQDTNVIPIIDGKPV 204

Query: 175 NHLTRRLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVSYD 225
              T+R++  G     +L DL++ +  Y   +  +F+     K+  CYVS D
Sbjct: 205 LTDTKRINWGGSQSVGYLSDLMTLKYPYFPTKLTEFQYETLYKD-YCYVSPD 255

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 61/134 (45%), Gaps = 18/134 (13%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGEL-------LFNTIQSADIDVRSSLYKAIVLSGGSSM 308
           ER    E LFQP +   + AG+ EL        F +  S   D   ++ K + ++GG + 
Sbjct: 618 ERPRVPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQ 677

Query: 309 YPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKD 368
            PGL +RI KE     +T  L ND     KF V I   P      + G A  +S  AD  
Sbjct: 678 LPGLKTRIVKE-----FTSFLPNDA----KFSVNISKHPSLD--AWKGMAKFSSDDADFK 726

Query: 369 HMWLSKQEWAESGP 382
              +SK+E+ E GP
Sbjct: 727 SSLISKKEYEEYGP 740

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 98/231 (42%), Gaps = 21/231 (9%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA---SA 62
           PI +D G+  V+ G      P   FP+ + R   R   R           +G +    ++
Sbjct: 42  PIAIDFGSYEVRAGYVANKEPALVFPTRLARYRDRKASRTY-------TFVGRDTGLDAS 94

Query: 63  VRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGG----KVLLTEPPLNPLKN 118
           +R+  Q   P +  ++ NW  ++ +  Y F+    L    GG     V+LTE        
Sbjct: 95  IRT--QSRSPFDGPMVTNWDYVDDMLAYTFHH---LGVRGGGGVPNAVVLTERLATLQSQ 149

Query: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYAQGL--SSGVVIDSGDGVTHIVPVYESVVLNH 176
           R    E+++E Y+   V   I ++ + Y +    S+G+V+ SG+  T +VPV +   +  
Sbjct: 150 RANWYELLYEAYNLQEVTFGIDSLFSFYGERGPGSTGLVVSSGNEDTCVVPVVDGRGVVS 209

Query: 177 LTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLE 227
             +R++  G+    +L  LL+ +   F           I  + CYV+ D E
Sbjct: 210 EAKRINWGGQQAVDYLTGLLALKYPYFPTKLSGSQFETIYREHCYVAEDFE 260

 Score = 37.4 bits (85), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 7/77 (9%)

Query: 251 IKVGQERFEAAECLFQPNLVDVESAGVGELL-------FNTIQSADIDVRSSLYKAIVLS 303
           + +  ER    E +FQP++  ++ AGV EL        F++ + A       + K + ++
Sbjct: 609 MHINVERIRVPEVIFQPSIGGLDQAGVVELCETVLLKKFDSSRRALSATCEKMAKNVFIT 668

Query: 304 GGSSMYPGLPSRIEKEL 320
           GG++  PG+  RI +E 
Sbjct: 669 GGNTKLPGIRERIVREF 685

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 100/231 (43%), Gaps = 17/231 (7%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEAS---A 62
           PI +D G+  +K G   ++ P   FP+ + R   R      LN  +    IG + S   A
Sbjct: 39  PIAIDFGSNTLKAGYTNQDVPSLVFPTRLTRFRDR-----RLNRTM--TFIGNDISLDQA 91

Query: 63  VRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLK-NREK 121
           VR+  Q   P +  ++ NW  ++ + +Y F     L        L+    L  ++  R +
Sbjct: 92  VRA--QSKSPFDGSMVTNWEYIDEMLEYTFKHLGVLGDNGISNPLIFSEKLAVVQAQRSQ 149

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGL--SSGVVIDSGDGVTHIVPVYESVVLNHLTR 179
             +++FE ++       I    A +A     S+G++I   +  T+++P+   V      +
Sbjct: 150 WYQLLFETFNISKATFGIDNQFAFFANNSIDSTGLMIGCNNEDTNVIPIVNGVASLQECK 209

Query: 180 RLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVSYDLELD 229
           R++  G     ++ +LLS +  Y   +  D +  +++    CYVS D   D
Sbjct: 210 RINWGGNHAVSYMNNLLSLKYPYFPTKLTDLQ-YQKLYHDYCYVSPDYSAD 259

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 33/72 (45%), Gaps = 7/72 (9%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGELL-------FNTIQSADIDVRSSLYKAIVLSGGSSM 308
           ER    E LFQP +   + AGV EL        F +  +        +   I LSGG++ 
Sbjct: 613 ERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLSGGNAK 672

Query: 309 YPGLPSRIEKEL 320
            PGL +RI KE 
Sbjct: 673 VPGLKNRIVKEF 684

>SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 311

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/241 (19%), Positives = 104/241 (43%), Gaps = 24/241 (9%)

Query: 83  DMELLWD--YAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQ 140
           D E LW   Y  Y    + + S  KV++ E  L PL  +E +C+V+ ++     +     
Sbjct: 37  DEEFLWRLFYKCYHDELMVAPSSTKVVIIENVLLPLNCKELLCQVLLKRLLVSSIVFVPD 96

Query: 141 AVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRG 200
            ++  ++ G+  G+VID G     +VP+ +  +L++ +   + AG+ +  +L ++L    
Sbjct: 97  VLMTCFSSGVKDGLVIDVGWEYVAVVPILDLRILDNWSHISNKAGKFLYDNLKEILPPG- 155

Query: 201 YAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELPDGRVIKVGQERFEA 260
                                   D+ +   +A E     +  E+   + ++ G  +   
Sbjct: 156 ---------------------TDLDILVPQIMACEGDKDFQYREISITKEVRNGFLKKTI 194

Query: 261 AECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKEL 320
                 P   D +   + +++  T++   +DV+  ++  ++++G +S  PG   ++ KE+
Sbjct: 195 GHFDEDPLEYDDDELPISQVVLKTLKDLPVDVKKRVFPHLMITGLASNIPGFKMKLLKEV 254

Query: 321 K 321
           K
Sbjct: 255 K 255

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 103/250 (41%), Gaps = 21/250 (8%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64
           +PI +D G+  V+ G   +  P   F + + R   R   R           +G + +  +
Sbjct: 37  TPIAIDFGSYEVRAGYVNQGDPALVFTNRLARYRDRKASRTY-------TFVGNDTNLDQ 89

Query: 65  SY-LQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSG--GKVLLTEPPLNPLKNREK 121
           S   Q   P +  +I NW  ++ +  Y F+  + +    G    VL+TE        R  
Sbjct: 90  SIRTQSKSPFDGSMITNWDYVDDILAYTFH-HLDVRGNGGVPNPVLITERMAALQSQRSN 148

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGL--SSGVVIDSGDGVTHIVPVYESVVLNHLTR 179
             E++FE Y+   V   I ++ + Y +    ++G+ I+SG+  T ++PV     +    +
Sbjct: 149 WYELLFECYNLQKVTFGIDSLFSFYGEHPPGTTGIAINSGNEDTSVIPVVNGKGILTEAK 208

Query: 180 RLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTL 239
           R++  G+    +L  LLS +   F           +    CY S + E       E +TL
Sbjct: 209 RINWGGQQSVGYLNGLLSLKYPYFPTKLVNNQFESMYRDFCYFSTNFE------EEISTL 262

Query: 240 V--ENYELPD 247
           +  EN E  D
Sbjct: 263 LTMENLESKD 272

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 7/72 (9%)

Query: 256 ERFEAAECLFQPNLVDVESAGVGELL-------FNTIQSADIDVRSSLYKAIVLSGGSSM 308
           ER    E +FQP++  ++ AG+ EL        F + +    ++   + K I ++GG++ 
Sbjct: 609 ERIRVPEVIFQPSIGGLDQAGIVELCETLLLKKFGSNRRELSEISKMMAKNIFITGGNAK 668

Query: 309 YPGLPSRIEKEL 320
            PG+  R+ +E 
Sbjct: 669 LPGIRERVVREF 680

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 83/197 (42%), Gaps = 9/197 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVM-IGEEASAVRS 65
           IV+ QGT     G    + P    PS      +  ++   +   L D++ I         
Sbjct: 13  IVIQQGTNTTIAGFNNSDLPQCVIPSTY----IYDKQEDKMIFGLYDMLDIATSLEDADR 68

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKN---REKM 122
           Y   +   +NGI  NW  +E  W+Y F + ++  S     +++T P +    +    EK 
Sbjct: 69  YEVFTILDKNGIPYNWEALEQQWNYLFNDVLRC-SPEEYPLVITIPSMKKEIDGEVLEKY 127

Query: 123 CEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLD 182
             ++FE++ F    + ++ +    + G SSG+VID G     + P+ +  V+ +      
Sbjct: 128 FSLVFERFKFPVFQIILEPLAITLSLGKSSGLVIDMGSSGCRVTPIIDGTVIKNAVLSSK 187

Query: 183 VAGRDVTRHLIDLLSRR 199
             G  +   +I+ L ++
Sbjct: 188 YGGAFLDYQIIETLQKK 204

>AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR141C (ARP8)
          Length = 791

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 65/150 (43%), Gaps = 15/150 (10%)

Query: 69  ISYPMENGIIK----NWTDM-ELLWDYAFYEQMKLPSTSGG---------KVLLTEPPLN 114
           I YP  NG       +++ + ELL D        L  T  G         KV+L  P L 
Sbjct: 302 IRYPFSNGAFNVECPDYSSLQELLNDVTKLITFALSETKLGISRSQFPNYKVILIIPDLF 361

Query: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVIDSGDGVTHIVPVYESVV 173
                E+M  ++  + +F  V +  +++   Y  GLS S  VID G   T I  V E  V
Sbjct: 362 EKNYVEQMIRLLLSEMNFQAVALIQESLATCYGAGLSNSTCVIDIGASETKISCVDEGQV 421

Query: 174 LNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203
           + +   RL   G D+TR  ++LL +  + +
Sbjct: 422 IQNSCIRLSYGGDDITRLFVELLLQSNFPY 451

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 73/341 (21%), Positives = 139/341 (40%), Gaps = 52/341 (15%)

Query: 75  NGIIKNWTDMELLWDYAFYEQM--KLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDF 132
            G+  NW  +E  W +   +++  +L  T+   V+ T  P  P   R +  E+   +   
Sbjct: 16  QGVPYNWDALEAQWRWICEDKLGCRLEETA---VVATVAPDLPAAARARYLEMALGRLKI 72

Query: 133 GGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHL 192
               + ++ +    + G ++ +++D G     + PV +  V+     R   AG  +   +
Sbjct: 73  PVFQLVVEPLAVALSLGRNTALIVDLGAAKATVTPVIDGTVVQAAIGRSRFAGDFLDLQV 132

Query: 193 IDLLSRR-----GYAFNRTADFETVRQIKEKLC-YVSYDLE--------LDT-KLARETT 237
             LLS +     G   +     E  R  +  +  + SY L+        LD+  L     
Sbjct: 133 GKLLSEKDDKQNGEESHEPTPLELWRNSRTWIQDFKSYMLQVAPSKLQDLDSAALDMMGL 192

Query: 238 TLVENYELPDGRVIKVGQERFEA-AECLFQPNLVD---VESAGVGELLFNTIQSADID-- 291
           + V+N+     + I + Q+   A AE LFQP+ V      S G+ E++   ++ A     
Sbjct: 193 SYVKNFLYRRQKTISLMQKECCALAEGLFQPSYVSQQFASSEGLSEIVAKAVKKAGASTA 252

Query: 292 -------------VRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNN--DPARL 336
                        + ++L   IV++G SS+ PGL  RI  +L   +    L++  +P  L
Sbjct: 253 TNSSATNATTPEQIHAALLTNIVITGSSSLIPGLEQRIVNDLSYQFPQYKLSSFANPLVL 312

Query: 337 DKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEW 377
           D           RK   + GG  +A++ +     W+S+ ++
Sbjct: 313 D-----------RKLQSWQGGVTMANLPSWDLGEWISQSDY 342

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 73/351 (20%), Positives = 143/351 (40%), Gaps = 48/351 (13%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRSY 66
           +V+  GT     G +    P    PS      L+ ++ G+      D+M   E     S 
Sbjct: 9   VVIHNGTSTTIAGFSNSEIPKCIIPS----SYLKKKD-GSFVFGTFDMMDSLEDEGAESD 63

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPL----NPLKNR--E 120
           +      + G+  NW  +E  W+Y F +Q+K   T    VL+T P        ++N+  E
Sbjct: 64  IFTIVDSQLGVPYNWEALEKQWEYIFEKQLKCDPTEL-PVLITIPSSISKNEDIENKVIE 122

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVID-SGDGVTHIVPVYESVVLNH--- 176
           + C++ FEK+    + +  +++      G  + +VID SG G + + P+ + V++ +   
Sbjct: 123 QYCKIAFEKFKIPYLQIVNESLSISLGLGKKTSLVIDISGSG-SSVTPIVDGVIIKNGIV 181

Query: 177 ------------LTRRLDVAGRDVTRHLID----LLSRRGY--AFNRTADFETVRQIKEK 218
                       + ++      D+   + +     +S   +   F +T    T +++++ 
Sbjct: 182 KSKYGGDFLDYQIIKKFSTIDEDLEEEMTNSSNIWVSSNSWIKNFKKTMLQVTDKKLQDV 241

Query: 219 LCYVSYDLELDTKLARETT---------TLVENYELPDGRVIKV-GQERFEAAECLFQPN 268
             Y    L L  +L  + +         ++ + Y     + +    +E ++  E LFQP 
Sbjct: 242 EKYYEEQLRLQAELQNQGSITSVGTNPLSVKKEYLYRSRKTVTFESRELYQFGEYLFQPQ 301

Query: 269 LVDVE---SAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRI 316
           L   +     G+GEL++ +I SA +    +   A    GGSS   G  S +
Sbjct: 302 LASEQYNRDDGLGELIYRSITSAAMGNMPAAVAASNNIGGSSGATGGDSNV 352

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 74/365 (20%), Positives = 139/365 (38%), Gaps = 71/365 (19%)

Query: 76  GIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGV 135
           G   NW  +E  W +  YEQ+   S     +++T PP      R K  E+  EK      
Sbjct: 64  GCPYNWEALEQQWRW-IYEQVLEISPEELPLVITVPPDLSAGTRSKYLELALEKLKVPVF 122

Query: 136 YVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAG----RDVTRH 191
            + ++ +    + G ++ +V+D G     + P+ +  V+     R   AG      V  +
Sbjct: 123 QMVVEPLAISLSLGRNTSLVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLDYQVAEN 182

Query: 192 LIDLL--------SRRGYAFNRTADFET-VRQIKEKLCYVSYDLELDTKLARETTTLVEN 242
           L + L        S+   +F       T +   K  +  VS     + +  ++T     N
Sbjct: 183 LKNSLPIEPAGEDSKVPESFKYWESSRTWIHDFKATMLQVSPSKIQELEGMQDTMAFSHN 242

Query: 243 ---------YELPDGRVIKVGQERFEAAECLFQPNLVDVESA---GVGELLFNTIQSADI 290
                    Y+  +  +    +E ++ AE LFQP L   + A   G+ EL+   ++ A  
Sbjct: 243 PLDNKKYFLYKKGNKTLTLEQRECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGA 302

Query: 291 --------------------------------DVRSSLYKAIVLSGGSSMYPGLPSRIEK 318
                                            + ++L   IV++G +S+ PG+  RI  
Sbjct: 303 AVTTSNSGPAGGGGPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVN 362

Query: 319 ELKQLWYTRVLNN--DPARLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQE 376
           EL   +    L++  +P  LD           RK   + GG  ++++ + +   W+++QE
Sbjct: 363 ELSYQFPQYKLSSFANPMVLD-----------RKLQSWQGGVTMSNLPSWELGNWITRQE 411

Query: 377 WAESG 381
           +  +G
Sbjct: 412 YDANG 416

>KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7.448
           YPR034W
          Length = 490

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 55/115 (47%), Gaps = 4/115 (3%)

Query: 74  ENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLN---PLKNREKMCEVMFEKY 130
           ENG+  NW  +E  W Y F  ++K  S     +++T P +     L+  E+  ++ F K+
Sbjct: 70  ENGVPYNWEALERQWKYIFENELKCKSDEF-PLVITVPIMKDAVALRVMERYFDLAFNKF 128

Query: 131 DFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAG 185
           +   + V I+ +    + G SS +V+D G    ++ PV +  V  +   +   AG
Sbjct: 129 NVPVLQVIIEPLAIALSMGKSSALVVDLGSSSCNVTPVIDGTVAKNSVLKSKYAG 183

>TPHA0N01430 Chr14 (314740..316158) [1419 bp, 472 aa] {ON} Anc_2.593
           YMR033W
          Length = 472

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 95/237 (40%), Gaps = 45/237 (18%)

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQG-LSSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           EK+ + +FE        +   ++ A +A   L + +VID G   T I+P+ +   L H +
Sbjct: 133 EKINQHVFEILKLNSFLMLPTSLAATHAMAALQNSIVIDIGKTHTDILPIVDYSQLTHFS 192

Query: 179 RRLDVAGRDVTRHLIDLL-----------------------SRRGYAFNRTADFETVRQI 215
             + + G D+  HL  +L                       +++ YA    AD +     
Sbjct: 193 STIPIGGNDINTHLKSILPSLSDDQIEDLKLSNIYEVLNAEAKKNYADLHQADEDEDDSA 252

Query: 216 KEKLCYVSYDLELDTKLARETTTLVENYELP------------DGRVIKVGQERFEAAEC 263
            +    ++   +    L  E     EN  LP            +G++I VG++RF+  E 
Sbjct: 253 IDVAAIITSGRDAREILEGERKNKNEN-SLPNSELDKNSFVDRNGQLISVGKQRFQGCE- 310

Query: 264 LFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKEL 320
               NL+   S  VG   +      DI+ + ++++ IV+ G +S+  G    +  +L
Sbjct: 311 ----NLIKAISKRVG---YTISMVQDINKQKAMWENIVIVGNTSLLTGFQDSLLTKL 360

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/197 (19%), Positives = 83/197 (42%), Gaps = 5/197 (2%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRSY 66
           +V+  GT     G    + P    P++  +     +++   N  L D+           Y
Sbjct: 11  VVIQNGTNTTLAGFNNVDLPQCVIPTVYIQDN-STQKKIFGNFELLDIASSRSNDDAGRY 69

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNR---EKMC 123
              +    NG+  NW  ++  W+Y + E +K  S     +++T P  N   +    +K  
Sbjct: 70  EVFTIFDRNGLPYNWDALKEQWEYIYREVLKCNSDE-YPLVITIPSANKDVDEIILKKYF 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDV 183
           E+ FE ++   + + I+ +    + G SS +V++ G    ++ P+ +  V+ H   +   
Sbjct: 129 ELAFETFNVPVLQIIIEPLAVALSLGKSSSLVVNLGASGCNVTPIVDGTVIKHAVMKSKY 188

Query: 184 AGRDVTRHLIDLLSRRG 200
            G  +   ++++L  +G
Sbjct: 189 GGDFLDFQIVNILQEKG 205

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 68/167 (40%), Gaps = 17/167 (10%)

Query: 54  VMIGEEASAV-RSYLQISYPMENGIIKNW------------TDMELLWDYAFY---EQMK 97
           +  GEEA    +    I YP   G   N             +D+  L++YA     E + 
Sbjct: 380 IYFGEEAERCNKENFIIRYPFNKGGSLNLDSPYYSSLPELLSDVTRLFEYALTKRDESIT 439

Query: 98  LPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-VVI 156
                  KV+L  P L    + E +  ++ ++  F  V +  +++ A Y  G+S+   ++
Sbjct: 440 QAQIQQCKVILVIPDLFEKSHIETLYRILLKEMQFQAVAIMQESLAACYGAGISTASCIV 499

Query: 157 DSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203
           + G   T I  V E  VL +   +LD  G D+TR     L    + F
Sbjct: 500 NIGATQTTIACVDEGTVLENSLIKLDYGGDDITRLFTLFLLENNFPF 546

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/301 (20%), Positives = 115/301 (38%), Gaps = 60/301 (19%)

Query: 72  PMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVL---LTEPPLNPLKNR-------EK 121
           P+ENG+I N    +    Y +   +K              T  PL  L N        E 
Sbjct: 66  PIENGMIINLEAFQEFLKYIYISLLKQKHDENADSFEYSFTNIPLLLLNNHKWSQFQMES 125

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQ-GLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180
           +   +FEK    G+ +   ++ A Y+   L +  +ID G   T IVP+ +   +NHL+  
Sbjct: 126 ITNFVFEKLKLNGLMLLPISLGASYSMVSLQNCCIIDIGLNHTDIVPIVDYTTINHLSNT 185

Query: 181 LDVAGRDVTRHLIDLL----SRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKL---- 232
           L+  G  +   L  LL     ++     ++  FE + + ++      ++  + T      
Sbjct: 186 LNYGGSYINTILQKLLPELNDQQIEDLKKSPIFEVLTEDEKNDSAFDFNNPITTSTKNKD 245

Query: 233 --------------ARETTTLVENYE-------LP------------DGRVIKVGQERFE 259
                          ++T  ++   E       LP            +G  IK+G++RF+
Sbjct: 246 DDDADFDVASIINSGKDTREILAEREKKNQKKSLPNSQLEFNTFKDNNGNQIKIGKQRFQ 305

Query: 260 AAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKE 319
             + L Q       S  VG  +    Q  D+  + ++++ IV+ G +S+  G    +  +
Sbjct: 306 GCDELIQK-----ISTRVGHTIN---QLEDLSKQRAIWENIVIVGNTSLITGFKEALLNQ 357

Query: 320 L 320
           L
Sbjct: 358 L 358

>KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 788

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 50/103 (48%), Gaps = 1/103 (0%)

Query: 102 SGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVIDSGD 160
           S  +V+L  P L      E M  ++  + DF  + +  +++ + Y  GLS S  VID G 
Sbjct: 325 SNYRVVLIVPDLFDKTFVESMIHLLLIELDFQSIALIQESLASCYGAGLSNSTCVIDIGA 384

Query: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203
             T I  V + VV+ +   RL+  G D+TR    +L +  + +
Sbjct: 385 KQTKIACVDDGVVVKNSALRLNYGGDDITRLFAHMLLQNKFPY 427

>KLLA0F11913g Chr6 complement(1094612..1095373) [762 bp, 253 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 253

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/98 (16%), Positives = 51/98 (52%)

Query: 91  AFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGL 150
           +++  + + ++ G K++++EP    +  ++++C+V+F +     +      + A    G+
Sbjct: 47  SWFHDILMYNSKGVKIVISEPLWLSILRKQRLCKVLFGRLKVNSICFVPNCLAAFIGAGI 106

Query: 151 SSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDV 188
            +G+ I+     T ++P+++  +L+  +R   +   +V
Sbjct: 107 RNGLYIEVNSKNTELIPIFDGRILDSYSRSSKLGSDNV 144

>Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii AFR135W
          Length = 775

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 1/103 (0%)

Query: 102 SGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVIDSGD 160
           S   V+L  P L      E+M  ++  + DF  V +  +++ + Y  GLS S  VID G 
Sbjct: 333 SSYNVVLIIPDLFEKSYVEQMIRLLISEMDFQAVALIQESLASCYGAGLSNSTCVIDIGG 392

Query: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203
             T I  V E  V+ +   +L   G D+T+   +LL +  + +
Sbjct: 393 SETKISCVDEGQVIQNSCIKLSYGGDDITKLFAELLLQSNFPY 435

>Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}
           similar to Ashbya gossypii ABR084W
          Length = 407

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 78/345 (22%), Positives = 139/345 (40%), Gaps = 68/345 (19%)

Query: 71  YPMENGIIKNWTDMELLWDYAFY----EQMKLPSTSGGKVLLTEPPLNPLKN-------R 119
           YP+ NG I N  D  L +  A Y    +Q    +  G +  ++  P+  + +       +
Sbjct: 3   YPINNGSITN-LDAFLYFLKAIYKSVLQQRIKENPEGWEAQVSNIPMFLITHYSWSQSEQ 61

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQG-LSSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           E + + +FE        +   ++   YA G L + VVID G   T I+P+ +   L +L 
Sbjct: 62  EILTQFVFESMKLNNFMIMPNSLATSYAFGSLQNCVVIDIGGAHTDIIPIVDYTPLEYLA 121

Query: 179 RRLDVAGRDVTRHLIDLLSRRGYA----FNRTADFETV-RQIKEKLCYV----------- 222
               V G  +   L   L     A      R++ FE + +  K+K  +            
Sbjct: 122 YSAPVGGDAINAKLASFLPGWSAASIEDLKRSSVFEVLSKDAKDKSKFNFNEDEEASEED 181

Query: 223 --SYDLELDTKLARETTTLVE------------NYELP-------DGRVIKVGQERFEAA 261
             + D+       R+T  ++E            N +L        DG  + VG++RF+  
Sbjct: 182 EGALDVAAIITSGRDTREILEERERNKNKEQVSNSQLETNSFVDRDGNDVTVGKQRFQGC 241

Query: 262 ECLFQPNLVDVESAGVGELLFNTIQSADIDVRS---SLYKAIVLSGGSSMYPGLPSRIEK 318
           +     +L+   S   G +L      + ID  S   ++++ +++SGG+S   G     E 
Sbjct: 242 D-----DLIKEISRACGMVL------SQIDEGSRCKAVWENVLISGGTSEIAGFR---EA 287

Query: 319 ELKQLWYTRVLNN-DPARLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
            L QL    ++   D  R  + +  + + P+++   FIGGAV  S
Sbjct: 288 LLTQLCEDHLIYEPDHERQQREQDLMANMPKQRKNKFIGGAVAQS 332

>Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {ON}
           YOR141C (REAL)
          Length = 883

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 61/139 (43%), Gaps = 4/139 (2%)

Query: 67  LQISYPMENGIIKNWTDMELLWDYAF-YEQMKLPSTSGG--KVLLTEPPLNPLKNREKMC 123
             I+ P    + +  +D+  L +YA   E + + ST     KV+L  P +    + E   
Sbjct: 410 FNINSPYYESLAELISDVTKLLEYALASETLNVKSTKFNQYKVVLVIPDVFKKNHVETFI 469

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVIDSGDGVTHIVPVYESVVLNHLTRRLD 182
            V+  +  F  V V  +++   Y  G+S S  V++ G   T I  V E  VL H    L+
Sbjct: 470 RVLLTELQFQAVAVIQESLATCYGAGISTSTCVVNIGATETRIACVDEGTVLEHSAVTLN 529

Query: 183 VAGRDVTRHLIDLLSRRGY 201
             G D+TR    LL +  +
Sbjct: 530 YGGDDITRLFALLLLQSDF 548

>Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034W
           (REAL)
          Length = 480

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

Query: 76  GIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLN---PLKNREKMCEVMFEKYDF 132
           G+  NW  +EL W Y +  Q+K+ S     +++T P  N    +   E+  E+ F+K   
Sbjct: 75  GLPYNWEALELQWRYMYETQLKV-SPEELPLVITMPATNGKPDMSILERYYELAFDKLKV 133

Query: 133 GGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAG 185
               + I+ +    + G SS  VID G    ++ P+ + +V+ +   R    G
Sbjct: 134 PVFQIVIEPLAIALSMGKSSAFVIDMGASGCNVTPIIDGIVVKNAVVRSKFGG 186

>Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {ON}
           YOR141C (REAL)
          Length = 873

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 56/128 (43%), Gaps = 4/128 (3%)

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFYEQ---MKLPSTSGGKVLLTEPPLNPLKNREKMC 123
             I+ P    + +  +D+  L +YA   +   +K    +  KV+L  P +    + E   
Sbjct: 400 FNINSPYYKSLAELISDVTKLLEYALKSETLNVKPAKFNQYKVVLVIPDIFKKSHIETFI 459

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVIDSGDGVTHIVPVYESVVLNHLTRRLD 182
            V+  +  F  V +  +++   Y  G+S S  V++ G   T I  V E  VL H    LD
Sbjct: 460 RVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGASETRIACVDEGTVLEHSAITLD 519

Query: 183 VAGRDVTR 190
             G D+TR
Sbjct: 520 YGGDDITR 527

>Smik_13.203 Chr13 (331960..331989,332074..333447) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 93/229 (40%), Gaps = 44/229 (19%)

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQ-GLSSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           E++ + +FE  +   +     ++ A Y+   L +  +ID G   T I+P+ +   L+HL 
Sbjct: 125 ERITQYVFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTYHTDIIPIVDYAQLDHLV 184

Query: 179 RRLDVAGRDVTRHLIDLLSR----RGYAFNRTADFETVRQIKEKLCYVSYDLE------- 227
             + + G+ +   L  LL +    +  +  ++  FE +    +KL    +  E       
Sbjct: 185 SSIPIGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSDDAKKLSSFDFGNENEDEDEG 244

Query: 228 -----------LDTKLA---RETTTLVENYELPD----------GRVIKVGQERFEAAEC 263
                       DT+     RE    V N +  D          G  IKVG++RF+    
Sbjct: 245 TLNVAEIITSGRDTREVLEERERGQKVRNVKNSDLEFNTFWDEKGNEIKVGKQRFQGCN- 303

Query: 264 LFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGL 312
               NL+   S  VG  L N     DI+   ++++ I++ GG++   G 
Sbjct: 304 ----NLIKNISNRVGLTLDNI---DDINKAKAVWENIIIVGGTTSISGF 345

>Skud_13.189 Chr13 (324460..324489,324579..325952) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 95/229 (41%), Gaps = 44/229 (19%)

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQ-GLSSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           E++ + +FE  +   +     ++ A Y+   L +  +ID G   T ++P+ +   L+HL 
Sbjct: 125 ERITQYIFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTYHTDVIPIVDYAQLDHLV 184

Query: 179 RRLDVAGRDVTRHLIDLL----SRRGYAFNRTADFETVRQIKEKLCYVSY------DLEL 228
             + + G+ +   L  LL      +  +  +++ FE +    +KL    +      D E 
Sbjct: 185 SSIPMGGQSINESLKKLLPQWDDHQIESLKKSSIFEVLSDDAKKLSNFDFANENEEDDEG 244

Query: 229 DTKLA------RETTTLVENYEL-------------------PDGRVIKVGQERFEAAEC 263
              +A      R+T  ++E  E                     +G  IKVG++RF+    
Sbjct: 245 TLNVAEIITSGRDTREVLEERERGQKAKNVKNSDLEFNTFWDENGNEIKVGKQRFQGCN- 303

Query: 264 LFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGL 312
               NL+   S  VG  L N     DI+   ++++ I++ GG++   G 
Sbjct: 304 ----NLIKNISNRVGLTLDNI---DDINKARAVWENIIIVGGTTSITGF 345

>YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}
           ARP7Component of both the SWI/SNF and RSC chromatin
           remodeling complexes; actin-related protein involved in
           transcriptional regulation
          Length = 477

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 79/183 (43%), Gaps = 8/183 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRSY 66
           +V+  G+     G +    P    PS     I R +E G          + + A+  R+ 
Sbjct: 8   VVIHNGSHRTVAGFSNVELPQCIIPSSY---IKRTDEGGEAEFIFGTYNMIDAAAEKRNG 64

Query: 67  LQISYPMEN-GIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLN---PLKNREKM 122
            ++   +++ G+  NW  +E+ W Y +  Q+K+ S     +++T P  N    +   E+ 
Sbjct: 65  DEVYTLVDSQGLPYNWDALEMQWRYLYDTQLKV-SPEELPLVITMPATNGKPDMAILERY 123

Query: 123 CEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLD 182
            E+ F+K +     + I+ +    + G SS  VID G    ++ P+ + +V+ +   R  
Sbjct: 124 YELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIGASGCNVTPIIDGIVVKNAVVRSK 183

Query: 183 VAG 185
             G
Sbjct: 184 FGG 186

>Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034W
           (REAL)
          Length = 476

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

Query: 76  GIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNR---EKMCEVMFEKYDF 132
           G+  NW  +EL W Y +  Q+K+ S     +++T P  N   +    E+  E+ F+K   
Sbjct: 75  GLPYNWEALELQWRYLYDTQLKV-SPEELPLVITMPATNGKPDMGILERYYELAFDKLKV 133

Query: 133 GGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAG 185
               + I+ +    + G SS  VID G    ++ P+ + +V+ +   R    G
Sbjct: 134 PVFQIVIEPLAIALSMGKSSAFVIDMGASGCNVTPIIDGIVVKNAVVRSKFGG 186

>YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON}
           ARP8Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes; has mRNA binding activity
          Length = 881

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 105 KVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVIDSGDGVT 163
           KV+L  P +    + E    V+  +  F  V +  +++   Y  G+S S  V++ G   T
Sbjct: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508

Query: 164 HIVPVYESVVLNHLTRRLDVAGRDVTR 190
            I  V E  VL H    LD  G D+TR
Sbjct: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535

>SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 794

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 69/165 (41%), Gaps = 18/165 (10%)

Query: 57  GEEAS-AVRSYLQISYPMENGIIKNWT-----------DMELLWDYAFYEQMKLPST--- 101
           GEEA+  + S+  + YP   G     +           D++ L +Y   +Q K+  T   
Sbjct: 297 GEEATRCLPSHFTLRYPFARGSFNVESPYYMSFQELLGDVQSLLEYCL-KQEKIDVTKQQ 355

Query: 102 -SGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVIDSG 159
            +  K++L  P L      E    ++  +  F  V +  +++   Y  G+S S  V+D G
Sbjct: 356 FANYKIVLVIPDLYDKNYVETFIHLLLVQMGFQAVAIIQESLATTYGAGISNSTCVVDIG 415

Query: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFN 204
              T I  V E  VL +    LD  G D+TR     L +  + ++
Sbjct: 416 ATSTKIACVDEGTVLGNSAVTLDYGGDDITRLFSQFLLQSKFPYD 460

>Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034W
           (REAL)
          Length = 479

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/191 (20%), Positives = 82/191 (42%), Gaps = 24/191 (12%)

Query: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRSY 66
           +V+  G+     G +    P    PS     + R +E G + +      + + A+  R+ 
Sbjct: 8   VVIHNGSHRTVAGFSNVELPQCIIPSSY---VKRTDEAGKVELIFGTYDMTDAAAEKRNG 64

Query: 67  LQISYPMEN-GIIKNWTDMELLWDYAFYEQMK-----------LPSTSGGKVLLTEPPLN 114
            ++   +++ G+  NW  +E  W Y +  Q+K           +P+T+G      +P ++
Sbjct: 65  DEVYTLVDSQGLPYNWEALESQWRYLYDTQLKVSPNELPLVITMPATNG------KPDMS 118

Query: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVL 174
            L+   +  E+ F+K +     + I+ +    + G SS  VID G    ++ P+ + +V+
Sbjct: 119 ILR---RYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDMGASGCNVTPIIDGIVV 175

Query: 175 NHLTRRLDVAG 185
            +   R    G
Sbjct: 176 KNAVVRSKFGG 186

>Suva_13.202 Chr13 (328209..328238,328325..329698) [1404 bp, 467 aa]
           {ON} YMR033W (REAL)
          Length = 467

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 95/229 (41%), Gaps = 44/229 (19%)

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQ-GLSSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           E + + +FE  +   +     ++ A Y+   L +  +ID G   T I+P+ +   L+HL 
Sbjct: 125 ETITQYIFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTYHTDIIPIVDYAQLDHLV 184

Query: 179 RRLDVAGRDVTRHLIDLLSR----RGYAFNRTADFETVRQIKEKLCYVSY-------DLE 227
             L V G+ +   L  LL +    +  +  ++  FE +    +KL    +       D E
Sbjct: 185 SSLPVGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSDDAKKLSNFDFGNDNEDEDEE 244

Query: 228 -----------------LDTKLARETTTLVENYELP-------DGRVIKVGQERFEAAEC 263
                            L+ +   + T  V+N +L        +G  IKVG++RF+    
Sbjct: 245 TLNVAEIITSGRDTREVLEERERSQKTKNVKNSDLEFNTFWDRNGNEIKVGKQRFQGCNS 304

Query: 264 LFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGL 312
           L +       S  VG L  + I   DI+   ++++ I++ GG++   G 
Sbjct: 305 LLKSI-----SNRVG-LTLDKID--DINKARAVWENIIIVGGTTSISGF 345

>YMR033W Chr13 (337788..337817,337904..339277) [1404 bp, 467 aa]
           {ON}  ARP9Component of both the SWI/SNF and RSC
           chromatin remodeling complexes; actin-related protein
           involved in transcriptional regulation
          Length = 467

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 93/229 (40%), Gaps = 44/229 (19%)

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQ-GLSSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           E + + +FE  +   +     ++ A Y+   L +  +ID G   T I+P+ +   L+HL 
Sbjct: 125 EIITQYVFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTHHTDIIPIVDYAQLDHLV 184

Query: 179 RRLDVAGRDVTRHLIDLLSR----RGYAFNRTADFETVRQIKEKLCYVSYDLE------- 227
             + + G+ +   L  LL +    +  +  ++  FE +    +KL    +  E       
Sbjct: 185 SSIPMGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSDDAKKLSSFDFGNENEDEDEG 244

Query: 228 -----------LDTKLA---RETTTLVENYELPD----------GRVIKVGQERFEAAEC 263
                       DT+     RE    V+N +  D          G  IKVG++RF+    
Sbjct: 245 TLNVAEIITSGRDTREVLEERERGQKVKNVKNSDLEFNTFWDEKGNEIKVGKQRFQGCN- 303

Query: 264 LFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGL 312
               NL+   S  VG  L N     DI+   ++++ I++ GG++   G 
Sbjct: 304 ----NLIKNISNRVGLTLDNI---DDINKAKAVWENIIIVGGTTSISGF 345

>Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii AGR099C
          Length = 305

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/217 (19%), Positives = 91/217 (41%), Gaps = 28/217 (12%)

Query: 105 KVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTH 164
           K+++ E  L  +  ++++C V+ ++     V      ++A  A G++  +V+D G   T 
Sbjct: 61  KIVILENVLLDVPKKKRLCHVLLDRLMVSSVVFLPDILMACVAGGVTDAIVVDIGWENTV 120

Query: 165 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSY 224
           + P+ +  +L        +  + +        S+    F    + + VR IK        
Sbjct: 121 VAPIMDMRILEQHMGISKIGAKWIG-------SKLSSTFEIDGE-KIVRMIK-------- 164

Query: 225 DLELDTKLARETTTLVENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNT 284
              LDT +       +E  ++ D   I     + +  EC       D++   +  L+  +
Sbjct: 165 ---LDTDINCNGVQ-IEWRDIEDCMEILWNINK-QDPEC-------DIDEFPIISLVLES 212

Query: 285 IQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELK 321
           I+   IDV+S + + +++ GG S   GL  R+ + L+
Sbjct: 213 IKQLPIDVKSKVLQNVIIIGGLSKIQGLKERLIENLR 249

>KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q05123 Saccharomyces cerevisiae YMR033W ARP9
           Actin-related protein
          Length = 432

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 100/234 (42%), Gaps = 41/234 (17%)

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQG-LSSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           E + + +FE+           A+ + YA G L + VVID     T ++P+ + + L HL 
Sbjct: 98  ETIAQFVFEQLQINNFMFLPSALASSYALGSLQNCVVIDIHTNGTDVIPILDYIQLGHLA 157

Query: 179 RRLDVAGRDVTRHLIDLLSR----RGYAFNRTADFETVRQIKEKLCYVSY---------D 225
            +++  G  + + L  LL +    +     +++ FE + +  +K   +++         D
Sbjct: 158 VKVEHGGSQIDQELAKLLPQWTPEQIEDLKKSSIFEVLSEDAKKSSSLNFKHGEDEGALD 217

Query: 226 LELDTKLARETTTL------------VENYELPD-------GRVIKVGQERFEAAECLFQ 266
           +       R+T  +            VEN E  +       G+ I VG++RF+  E    
Sbjct: 218 VAALVTSDRDTREILEEREKNKDKHNVENSEQENNVFVDRHGKQIIVGKQRFKGCE---- 273

Query: 267 PNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKEL 320
            +LV   S  VG +L    Q  D     ++++ I++ GG++   G    + ++L
Sbjct: 274 -SLVAEISKTVGRVL---SQIDDFHKLRAMWENILVVGGTTSISGFKEALLQKL 323

>KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.477
           YOR141C
          Length = 842

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 1/100 (1%)

Query: 105 KVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVIDSGDGVT 163
           K +L  P L    + E+M  ++  +  F  V +  +++   Y  G+S S  V++ G   T
Sbjct: 382 KAILVIPDLFEKSHVEEMIRLLLTELPFNAVAIIQESLATCYGAGISTSTCVVNVGASET 441

Query: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203
            +  + E VVL +    L+  G D+TR    LL    + +
Sbjct: 442 SVSCIDEGVVLENSLINLNYGGDDITRLFSVLLKMNNFPY 481

>TBLA0F00450 Chr6 (119190..120638) [1449 bp, 482 aa] {ON} Anc_7.448
           YPR034W
          Length = 482

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 52/124 (41%), Gaps = 21/124 (16%)

Query: 75  NGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPL-------------KNREK 121
           NG+  NW  +   W+Y + EQ+K          +TE PL  L             + +E+
Sbjct: 88  NGLPYNWEGIAKQWEYIYKEQLKCD--------MTEYPLLALMPVIGKDKKELEKQIKEE 139

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRL 181
             ++ FEK+    +Y+    +   ++ G  S +V+D G     + P+ +  ++     + 
Sbjct: 140 YYKLAFEKFRIPILYLIPSPLAIAFSLGKKSALVVDIGAKTCQVTPILDGTIIKDAVMKS 199

Query: 182 DVAG 185
             AG
Sbjct: 200 KFAG 203

>Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON}
           complement(1914..3305) [1392 nt, 464 aa]
          Length = 463

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 58/285 (20%), Positives = 116/285 (40%), Gaps = 58/285 (20%)

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQ-GLSSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           EK+   +FE            ++ + YA   L +  +ID G+  T IVPV + + ++H+ 
Sbjct: 125 EKITHFVFEALQLNSFITLPVSLASNYAMISLQNSCIIDIGETHTDIVPVIDYLQMDHIA 184

Query: 179 RRLDVAGRDV----TRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSY----DLELDT 230
             +   G+ +    ++ L DL   +     ++A FE + +  +K     +    D E D+
Sbjct: 185 SSIKYGGQTINDSLSKILTDLSPEQIEDLKKSAIFEVLSEDAKKESAFKFQSSDDNEDDS 244

Query: 231 KL--------ARETTTLVENYE-------LP------------DGRVIKVGQERFEAAEC 263
            L         R+T  ++E  E       +P            DG  I +G++RF   + 
Sbjct: 245 ALDVAAIITSGRDTREILEERERNKNSENVPNSQLETNSFTDRDGNSISIGKQRFHGCD- 303

Query: 264 LFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQL 323
               +L+   S  VG +  + I   DI  +  +++  V+ G +S   G          + 
Sbjct: 304 ----DLISKISKRVG-ITLSLIN--DITKQRPVWENFVIIGSTSSIKG--------FNEA 348

Query: 324 WYTRVLNN------DPARLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
             TR++++      D  +  + +    +P  +K   F+G + ++S
Sbjct: 349 LLTRLIDDHLIAEPDNEKKGREQDAASNPLNKKKTKFMGSSFVSS 393

>KNAG0B02110 Chr2 complement(399743..401200) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 70/160 (43%), Gaps = 10/160 (6%)

Query: 19  GRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRSYLQISYPMENGII 78
           G + +  P+   PS  G   L ++++  +    + V +G+  +    Y       EN + 
Sbjct: 20  GFSNKEVPEGVIPS--GYAKLSSDDKTLVFDKYEMVSMGKSGAGAEVYTLFD---ENDVP 74

Query: 79  KNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLN-PLKNREKMCEVM---FEKYDFGG 134
            NW  +   W Y  YE +   + +   +++T P  + P + R  M   M   F +++   
Sbjct: 75  YNWDALAQQWGY-IYESVLQCTANEVPLVVTMPAFSKPERARLVMMRYMDMAFYRFNVPV 133

Query: 135 VYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVL 174
           V   I+ +    + G SS +VID G     + PVY+ VV+
Sbjct: 134 VQFVIEPLAIALSMGKSSALVIDIGTNGCTVTPVYDGVVV 173

>CAGL0F05907g Chr6 (591411..592799) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q05123 Saccharomyces cerevisiae YMR033w ARP9
           Actin-related protein
          Length = 462

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 83/196 (42%), Gaps = 40/196 (20%)

Query: 149 GLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAG----RDVTRHLIDLLSRRGYAFN 204
            L + +VID G   T I+PV +   + HLT  +++ G     ++ + L  L   +     
Sbjct: 158 SLQNSLVIDIGTTHTDIIPVVDYTPMEHLTSTINLGGDSINTELAKKLPQLTETQIETLK 217

Query: 205 RTADFETV----RQI-----KEKLCYVSYDLELDTKLARETTTLVE------------NY 243
           R+  FE +    R+I      E++   + D+       R+T  ++E            N 
Sbjct: 218 RSTIFEVLSADAREILDTNDGEEMDEGALDVAAIVTSGRDTREVLEERERKKKQRNVKNA 277

Query: 244 EL-------PDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSL 296
           EL        DG+ I VG++RFE  E      L++  S  VG +L +    A       +
Sbjct: 278 ELDTNSFYDDDGQEITVGKQRFEGTE-----KLIESISHRVGNVLAHIHDKAKA---RHI 329

Query: 297 YKAIVLSGGSSMYPGL 312
           ++ I++ GG+S   G 
Sbjct: 330 WENIIVVGGTSSIVGF 345

>NCAS0B03900 Chr2 complement(696792..697631) [840 bp, 279 aa] {ON}
           Anc_8.251 YDR106W
          Length = 279

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/118 (17%), Positives = 55/118 (46%), Gaps = 3/118 (2%)

Query: 71  YPMENGIIKNWTDMEL--LWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFE 128
           Y + N  +++++++E+   +   F E +++ +T    ++L E  L  L  ++K C ++  
Sbjct: 28  YEIPNPPLRDYSELEMSRFFKKCFREGLQM-ATKDIDIILCEEILCSLLEKQKYCVILLR 86

Query: 129 KYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGR 186
                 V      ++   + G  +G+VI+    +    P+Y+  +++H  +    A +
Sbjct: 87  MLQCSSVTFIPSPIMHCLSSGTRTGLVINIDYCMATCTPIYDLRIMDHFLKSTSRAKK 144

>ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 465

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 4/127 (3%)

Query: 76  GIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNP---LKNREKMCEVMFEKYDF 132
           G+  NW  +E  W Y + +Q+++   S   ++++ P  +    +K   K  E+ FEK   
Sbjct: 74  GLPYNWEALESQWRYIYEKQLQI-DPSELPLIISVPASSSEVDMKIVHKYFELAFEKLRV 132

Query: 133 GGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHL 192
             + + ++ +    +   SS +VID G     I PV +  V+     +   AG  +   +
Sbjct: 133 PTLQIVVEPLAIALSMSKSSALVIDIGARECKITPVIDGTVVKSGVMKSKFAGDFLDFQV 192

Query: 193 IDLLSRR 199
            +LL  R
Sbjct: 193 TELLKDR 199

>KLLA0E06315g Chr5 complement(567309..568625) [1317 bp, 438 aa] {ON}
           similar to uniprot|Q75BT7 Ashbya gossypii ACR184C
           ACR184Cp and weakly similar to uniprot|Q12406
           Saccharomyces cerevisiae YPR034W ARP7 Actin-related
           protein involved in transcriptional regulation subunit
           of the chromatin remodeling Snf/Swi complex
          Length = 438

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 89/225 (39%), Gaps = 22/225 (9%)

Query: 74  ENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFG 133
           +NG+  +W  M+  W Y F + + +        ++    LN  + +  M +++   Y F 
Sbjct: 69  KNGLPNDWDMMDAQWQYIF-QSLGIQFEDYPVCVVLPSDLNSARRKRFMEQLL--GYGFP 125

Query: 134 GVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLI 193
            V +  +AV    +QG SSG+V+D G     +  V + V+     +   + G  +   + 
Sbjct: 126 MVQLLNEAVCNTLSQGRSSGIVVDIGHSGVKVDVVIDGVLFKQYRKENKIGGAFLNWQIC 185

Query: 194 DLL----SRRGYAFNRTADFETVRQIKEKLCYVS-------YDLELDTKLARETTTLVEN 242
           D      S +     R A  E +   K  +  VS       YD+    +       L +N
Sbjct: 186 DQYLKQDSGKSTKIWRDAT-EWLPNFKNSMLQVSPIELDANYDVAPHYQHMVSPMDLTKN 244

Query: 243 YELPDGRVIKVGQERFEAAECLFQPNLV-------DVESAGVGEL 280
           + L    +    ++ +   E LF+P +        DVE A V ++
Sbjct: 245 FLLDKKTLTFTNKQLYTIGELLFKPVIHVSNNANGDVEMADVNDI 289

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 56/116 (48%), Gaps = 5/116 (4%)

Query: 74  ENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLN----PLKNREKMCEVMFEK 129
           ++GI  NW  +E L+ Y + +++K+   S   +++T P +       K  E   E+ FEK
Sbjct: 87  DHGIPYNWKALERLYRYIYEKELKV-DPSELPLVITLPSMTNRELETKIVENYMELAFEK 145

Query: 130 YDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRRLDVAG 185
                + + ++ +  + + G SS +VID G     + P+ +  +L +   +   AG
Sbjct: 146 LKVPVLQIVVEPLGIMLSTGKSSSLVIDVGATGCTVTPIIDGTILRNSIVKSRFAG 201

>Kwal_26.8331 s26 (741843..743141) [1299 bp, 432 aa] {ON} YMR033W
           (ARP9) - actin related protein, subunit of the chromatin
           remodeling Snf/Swi complex [contig 59] FULL
          Length = 432

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 93/234 (39%), Gaps = 41/234 (17%)

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQG-LSSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           E + + +FE+            +   YA G L + VVID     T + P+ + + LNHL 
Sbjct: 98  EAIAQFVFEQLQVNNFMFLPSNLACSYALGSLQNCVVIDIHTDKTDVTPILDYIQLNHLA 157

Query: 179 RRLDVAGRDVTRHLIDLLSR----RGYAFNRTADFETVRQIKEKLCYVSY---------D 225
            R    G  + + L  LL +    +     ++  +E + +  +K   +++         D
Sbjct: 158 TRAKCGGSLIDQELTKLLPQWKPEQIEDLKKSPIYEVLSEDTKKSSTLNFKQGDDEGALD 217

Query: 226 LELDTKLARETTTLVE---------NYELPD----------GRVIKVGQERFEAAECLFQ 266
           +       R+T  L+E         N +  D          G+ I +G++RF+  E    
Sbjct: 218 VAALITSDRDTRELLEEREKNKDQQNIQNSDQETNVFTDRFGKSIVIGKQRFKGCE---- 273

Query: 267 PNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKEL 320
            +L+   S  VG  L    Q  D     ++++ I++ GG+S   G    + + L
Sbjct: 274 -SLIAEISKAVGHAL---SQIDDFHKLRAMWENILIVGGTSSITGFKEALLQRL 323

>KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141C ARP8
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin- remodeling enzyme
           complexes
          Length = 775

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 45/105 (42%), Gaps = 6/105 (5%)

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           E    ++     F  V V  +++ + Y  G+  S  V+D G   T I  V E +V+++  
Sbjct: 358 ETFIRLLITDLKFQAVAVIQESLASCYGAGIGDSTCVVDIGATTTKIACVDEGLVIDNSV 417

Query: 179 RRLDVAGRDVTRHLIDLLSRRGYAF-----NRTADFETVRQIKEK 218
             LD  G D+T+     L    + +     N    +  + Q+KEK
Sbjct: 418 ITLDYGGDDITKLFAKFLLESNFPYQDLDLNSPEGWSLMEQLKEK 462

>Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141C
           (ARP8) - actin-related protein [contig 130] FULL
          Length = 775

 Score = 37.4 bits (85), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 51/123 (41%), Gaps = 6/123 (4%)

Query: 102 SGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGL-SSGVVIDSGD 160
           S  KV++  P L      E    ++    +F  V +  +++ + Y  G+  S  V+D G 
Sbjct: 340 SNYKVVIVVPDLYDKAYVETFIRLLLVDLNFQAVAIIQESLASCYGAGIGESTCVVDIGA 399

Query: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF-----NRTADFETVRQI 215
             T I  V E +V  +    LD  G D+TR     L    + +     +    +  V Q+
Sbjct: 400 TTTKIACVDEGLVNENSIINLDYGGDDITRLFARFLLESNFPYQDLDLDSPQGWSLVEQL 459

Query: 216 KEK 218
           KEK
Sbjct: 460 KEK 462

>YDR106W Chr4 (667004..667858) [855 bp, 284 aa] {ON}  ARP10Component
           of the dynactin complex, localized to the pointed end of
           the Arp1p filament; may regulate membrane association of
           the complex
          Length = 284

 Score = 36.6 bits (83), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 17/92 (18%), Positives = 47/92 (51%), Gaps = 1/92 (1%)

Query: 79  KNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVA 138
           KN  +++ ++++ +++   +      +VL+ E     +  +  +C ++F+++D   V   
Sbjct: 39  KNREELKKIFEH-YFQICNILGNREVQVLILEDIFISVVEKRIICSILFKEFDCAHVSFV 97

Query: 139 IQAVLALYAQGLSSGVVIDSGDGVTHIVPVYE 170
            +A++   +    + +VID G   T  VP+++
Sbjct: 98  PRAIVHCLSCNTRNAIVIDIGTNYTTCVPIFD 129

>AGR099C Chr7 complement(924366..925283) [918 bp, 305 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR106W
           (ARP10)
          Length = 305

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 87/217 (40%), Gaps = 28/217 (12%)

Query: 105 KVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTH 164
           K+++ E  L  +  ++++C+V+  +     V      ++A  + G+S+ +V+D G   T 
Sbjct: 61  KIVVLENILLDIPRKKRLCQVLLNRLRVNSVVFLPDVLMACVSAGVSNALVVDVGWEQTA 120

Query: 165 IVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSY 224
           +VPV +  +L+          RDV    +  L  R +A      F    +   +      
Sbjct: 121 VVPVVDMRILD----------RDVG---VSKLGARWFAAELEQHFAGCGEAVMR------ 161

Query: 225 DLELDTKLARETTTLVENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNT 284
                  L        E   +P G V  V  ERF     L      D +   +  L+   
Sbjct: 162 ------SLKVGQGGRYEGNSIPWGDVSAVF-ERFLGTAGLSVE--YDADEYALVPLVLRA 212

Query: 285 IQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELK 321
           +++   DV+ ++   IV+ G  +  PGL  R+  E++
Sbjct: 213 VRNLSADVKRNVLPNIVIIGSMARMPGLRQRLIVEIQ 249

>ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp,
           462 aa] {ON} similar to uniprot|Q05123 Saccharomyces
           cerevisiae YMR033W ARP9 Actin-related protein involved
           in transcriptional regulation; subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 462

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 93/228 (40%), Gaps = 43/228 (18%)

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQG-LSSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           E + + +FE     G  +   A+ + YA G L +  VID G   T I+PV +   L  LT
Sbjct: 125 ESIVQFLFEALRVNGAMLLSTALSSTYAMGSLQNCCVIDIGTAHTDIIPVVDYAPLVPLT 184

Query: 179 RRLDVAGRDVTRHLIDLLSRRG----YAFNRTADFETVRQIKEKLCYVSY---------- 224
             +   G  +  +L  +L         +  +++ FE +    +K    ++          
Sbjct: 185 STIPYGGNTINENLARILPELSGNTIESLKKSSIFEVLSDDAKKSSAFTFHENPEEDEGA 244

Query: 225 -DLELDTKLARETTTL------------VENYELP-------DGRVIKVGQERFEAAECL 264
            D+       R+T  +            ++N ++        +G  + VG++RF+  +  
Sbjct: 245 LDVAAIVTSGRDTREILEEREKQKKEKNIKNAQMEKNTFIDDEGNSVTVGKQRFQGCD-- 302

Query: 265 FQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGL 312
               L++  S  VG++L    Q  D+    ++++ I++ GG+S   G 
Sbjct: 303 ---ELINRISDRVGKVL---DQIDDVIKLRAIWENIIIVGGTSSIQGF 344

>KAFR0I01580 Chr9 complement(332644..334023) [1380 bp, 459 aa] {ON}
           Anc_2.593 YMR033W
          Length = 459

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 97/229 (42%), Gaps = 44/229 (19%)

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQ-GLSSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           E++ + +FE  +   + +   ++ A Y+   L +  VID G   T I+P+ +   LNHL 
Sbjct: 121 ERITQFVFESLNVNNLLLLPSSLAASYSMVSLQNCCVIDIGKEHTDIIPIVDYTPLNHLA 180

Query: 179 RRLDVAGRDVTRHLIDL---LSRRGYAFNRTAD-FETVR----QIKEKLCYVSYDLELDT 230
             +   G  VT +L  +   L++      ++++ FE +     Q    L   + D E DT
Sbjct: 181 SSIPNGGDFVTENLAKILPNLTKEQIEHLKSSEIFEVLSDDMLQKNSDLVNEALDEEDDT 240

Query: 231 -------KLARETTTLVENYE-------LPD-------------GRVIKVGQERFEAAEC 263
                     R+T   +E  +       LP+              + I VG+ERF+    
Sbjct: 241 INVADIITSGRDTREFLEERDRKKKEKNLPNVDMETNSFWDPTTKQNISVGKERFQGCH- 299

Query: 264 LFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGL 312
               +L+   S  VG L+ N  Q  DI+    +++ IV+ GG+S   G 
Sbjct: 300 ----DLISKISKRVG-LILN--QVDDINRVKQIWENIVILGGTSSINGF 341

>ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR033W
           (ARP9); 1-intron
          Length = 464

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQG-LSSGVVIDSGDGVTHIVPVYESVVLN 175
           + +E + + +FE+       V   A+   YA G + + +VID G   T IVP+ + V L+
Sbjct: 115 REQELITQYVFEEMRLNHFMVVPAALSISYAFGSIQNCLVIDIGATHTDIVPIVDYVPLD 174

Query: 176 HLTRRLDVAGRDVTRHLIDLL 196
           ++     + G D+   L  LL
Sbjct: 175 YMAYSAPIGGDDINAKLATLL 195

>TBLA0E04320 Chr5 (1102481..1103311) [831 bp, 276 aa] {ON} Anc_8.251
           YDR106W
          Length = 276

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/80 (18%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 97  KLPSTSGGKVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVI 156
           KLP  S   + L E     +KN++  C+++ ++ +   +      +++ +A G+ +G+V+
Sbjct: 52  KLPKDSS--ITLVEETFCSMKNKKNFCDILLKELECRYINFFPSCLMSCFAAGIENGIVV 109

Query: 157 DSGDGVTHIVPVYESVVLNH 176
           +        +P+    +L+ 
Sbjct: 110 EIEQDYAAYIPIANYRILDQ 129

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 47/104 (45%), Gaps = 4/104 (3%)

Query: 74  ENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVL---LTEPPLNPLKNREKMCEVMFEKY 130
           +NG+  NW  +E  W Y +  ++K+       V+    T   ++P +  E   ++   K 
Sbjct: 66  KNGMPYNWEALEAQWRYLYEYELKVDPQELPLVISVPATHSEIDP-QVVENYFDLALNKL 124

Query: 131 DFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVL 174
               + + ++ +    A G SS +VID G   T + P+ +  V+
Sbjct: 125 QVPALQIVVEPLAVALAMGKSSALVIDVGARGTTVTPIVDGTVV 168

>TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 78/184 (42%), Gaps = 16/184 (8%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60
           MD  + +V+  GT     G +    P    PS          ++ N +I      + +EA
Sbjct: 1   MDNTNYVVIHNGTASTIAGFSCSESPKCMIPS-------SYIQKANGDIVFGTFEMLDEA 53

Query: 61  SAVRSYLQISYPMEN--GIIKNWTDMELLWDYAFYEQMK-----LPSTSGGKVLLTEPPL 113
           +      ++   M++  G+  NW  +E  W Y + E +K     LP       +LT+   
Sbjct: 54  AKNEDNDEVFTIMDSKFGVPYNWEALEKQWRYIYEEHLKVSPDQLPLAITVPSILTKNVE 113

Query: 114 NPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVID-SGDGVTHIVPVYESV 172
              K  E+ C++ F K     + V  +++    + G  + ++ID SG G + + P+ + +
Sbjct: 114 LETKIIEEYCKIAFLKLGIPSLRVVNESLAISLSLGKKNSLIIDLSGSGCS-VTPILDGI 172

Query: 173 VLNH 176
           ++ +
Sbjct: 173 LIKN 176

>CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141c ARP8
           Actin-related protein
          Length = 837

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 105 KVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSS-GVVIDSGDGVT 163
           K ++  P L    + E    ++  + DF  V +  +++   Y  G+S+   V++ G    
Sbjct: 403 KAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQI 462

Query: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAF 203
            I  V +  ++      LD  G DVT  L  LL +  + +
Sbjct: 463 RIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPY 502

>Suva_2.265 Chr2 (461152..461997) [846 bp, 281 aa] {ON} YDR106W
           (REAL)
          Length = 281

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 8/100 (8%)

Query: 106 VLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS--SGVVIDSGDGVT 163
           VL+ E     +  +  +C ++ +  + G  YV+    + +Y       + +VID G   T
Sbjct: 65  VLILEDIFISVAEKRIICGIILK--ELGCAYVSFIPRVLMYCLSCDVINALVIDVGINAT 122

Query: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLI-DLLSRRGYA 202
             VP+++   L  L + +  + RD  RHL+ D LS   Y 
Sbjct: 123 TCVPIFD---LRPLQKYIRYSKRDKRRHLLNDTLSSCPYT 159

>NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {ON}
           Anc_5.477 YOR141C
          Length = 863

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 55/135 (40%), Gaps = 7/135 (5%)

Query: 105 KVLLTEPPLNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SGVVIDSGDGVT 163
           KV+L  P      + E    ++  +  F  V +  +++   Y  GL  S  V++ G   T
Sbjct: 431 KVVLVIPDSFEKSHVELFIRLLVTELQFQAVAIIQESLSVCYGSGLGGSTCVVNVGSKET 490

Query: 164 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL-----SRRGYAFNRTADFETVRQIKEK 218
            +  V E +VL++    LD    DVT+     L       + +  N T  +    ++  K
Sbjct: 491 TVACVDEGIVLDNSLITLDYGSNDVTKLFAKFLLDCDFPYKNWDLNSTEGWRLAEELM-K 549

Query: 219 LCYVSYDLELDTKLA 233
            C    D ++  +L+
Sbjct: 550 QCVTFQDADITVQLS 564

>Ecym_6381 Chr6 complement(746240..746623) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFR055W
          Length = 127

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 6/68 (8%)

Query: 283 NTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARL--DKFK 340
           N I S DIDVRSSL + +V+ GG   Y  + + ++K +      R L  D   L  D+  
Sbjct: 10  NLIGSFDIDVRSSL-RLVVIVGG---YILIRNHVQKIIANRELKRKLKEDEDSLSTDRMN 65

Query: 341 VRIEDPPR 348
             +EDP +
Sbjct: 66  SLVEDPDK 73

>TPHA0L01200 Chr12 (250506..251474) [969 bp, 322 aa] {ON} Anc_8.466
           YDL209C
          Length = 322

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 198 RRGYAFNRTADFETVRQIKEKLC-YVSYDLELDTKLARE 235
           R  +AF+R  + ET+R I+ K C +V+Y  + + + A+E
Sbjct: 157 RLRFAFSRLGEIETIRYIEAKNCAFVTYRFQANAEFAKE 195

>KNAG0H00570 Chr8 complement(91418..92827) [1410 bp, 469 aa] {ON}
           Anc_2.593 YMR033W
          Length = 469

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQ-GLSSGVVIDSGDGVTHIVPVYESVVLNHLT 178
           E++ + +FE      +++   A+   YA     + ++ID G   T IVPV +   L ++ 
Sbjct: 124 ERITQFVFEHLQMSSLFLLSSALATTYALVSQPNSIIIDIGTSYTDIVPVIDYTALAYIG 183

Query: 179 RRLDVAGRDVTRHLIDLL 196
            RL + G  + + L  LL
Sbjct: 184 SRLKMGGDRINQTLKKLL 201

>Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON}
           YOR141C (REAL)
          Length = 879

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 49/114 (42%), Gaps = 9/114 (7%)

Query: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELPDGRVIKVGQERF 258
           R    N   D+ ++ Q + K   +  +L  D K+  +T        L    +I   Q++ 
Sbjct: 636 RDLFTNELNDWNSLSQFESKEGDLYCNLNDDLKILNKT--------LDAHTMIDQLQDKP 687

Query: 259 EAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGL 312
           E      + NL  +E A +  +  N   +AD+   SS Y  I++ GGSS  P L
Sbjct: 688 EKYGSTSKENLTPLEKAIIQSIT-NASVTADVTRMSSFYSNILIVGGSSKIPAL 740

>ADR128C Chr4 complement(934445..937048) [2604 bp, 867 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL073W
           (LHS1)
          Length = 867

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 26/44 (59%)

Query: 299 AIVLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVR 342
           A++L+GGSS  P +  R+ K + +   ++ +N D A ++   +R
Sbjct: 373 AVILTGGSSRVPSVQDRLAKCVGEALISKSVNADEAAVNGVAIR 416

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,638,137
Number of extensions: 1772317
Number of successful extensions: 4344
Number of sequences better than 10.0: 202
Number of HSP's gapped: 4029
Number of HSP's successfully gapped: 278
Length of query: 391
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 279
Effective length of database: 40,638,807
Effective search space: 11338227153
Effective search space used: 11338227153
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)