Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0H03670na 1ON42642623030.0
ZYRO0D05434gna 1ON42842012371e-168
SAKL0H24838gna 1ON4104288171e-105
KLTH0F00594gna 1ON4334318111e-104
Kwal_33.13025na 1ON4234307705e-98
Ecym_1013na 1ON4114287495e-95
AFR741Wna 1ON4074307061e-88
KAFR0G012703.94ON293101712.3
KAFR0A033501.243ON25774712.5
NDAI0F041401.94ON225664723.3
YKL222CsingletonON70529704.6
NCAS0G039002.276ON57071696.2
TBLA0C006408.124ON57973687.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0H03670
         (426 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0H03670 Chr8 (607134..608414) [1281 bp, 426 aa] {ON}              891   0.0  
ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {...   481   e-168
SAKL0H24838g Chr8 (2160460..2161692) [1233 bp, 410 aa] {ON} cons...   319   e-105
KLTH0F00594g Chr6 complement(43649..44950) [1302 bp, 433 aa] {ON...   317   e-104
Kwal_33.13025 s33 complement(44353..45624) [1272 bp, 423 aa] {ON...   301   5e-98
Ecym_1013 Chr1 complement(22905..24140) [1236 bp, 411 aa] {ON} s...   293   5e-95
AFR741W Chr6 (1798195..1799418) [1224 bp, 407 aa] {ON} NOHBY667;...   276   1e-88
KAFR0G01270 Chr7 complement(285838..286719) [882 bp, 293 aa] {ON...    32   2.3  
KAFR0A03350 Chr1 complement(683830..684603) [774 bp, 257 aa] {ON...    32   2.5  
NDAI0F04140 Chr6 complement(994996..1001766) [6771 bp, 2256 aa] ...    32   3.3  
YKL222C Chr11 complement(3503..5620) [2118 bp, 705 aa] {ON} Prot...    32   4.6  
NCAS0G03900 Chr7 complement(721778..723490) [1713 bp, 570 aa] {O...    31   6.2  
TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.1...    31   7.9  

>TDEL0H03670 Chr8 (607134..608414) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/426 (100%), Positives = 426/426 (100%)

Query: 1   MTEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNIG 60
           MTEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNIG
Sbjct: 1   MTEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNIG 60

Query: 61  KRKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRAKTSNRAIELFSKEDVESTIG 120
           KRKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRAKTSNRAIELFSKEDVESTIG
Sbjct: 61  KRKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRAKTSNRAIELFSKEDVESTIG 120

Query: 121 YVTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSSDPAILDGRD 180
           YVTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSSDPAILDGRD
Sbjct: 121 YVTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSSDPAILDGRD 180

Query: 181 KIYYNNRRGTVYEYNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKYGK 240
           KIYYNNRRGTVYEYNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKYGK
Sbjct: 181 KIYYNNRRGTVYEYNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKYGK 240

Query: 241 SDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIMHAGF 300
           SDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIMHAGF
Sbjct: 241 SDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIMHAGF 300

Query: 301 QEEYRHSVHQQTNNRATNLHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDLRRAFK 360
           QEEYRHSVHQQTNNRATNLHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDLRRAFK
Sbjct: 301 QEEYRHSVHQQTNNRATNLHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDLRRAFK 360

Query: 361 DPERRGQYIWQCSSHYSGVECGGVRLADFNCNSLVVEKNAGEGSRWLADDDWEAKEAQKN 420
           DPERRGQYIWQCSSHYSGVECGGVRLADFNCNSLVVEKNAGEGSRWLADDDWEAKEAQKN
Sbjct: 361 DPERRGQYIWQCSSHYSGVECGGVRLADFNCNSLVVEKNAGEGSRWLADDDWEAKEAQKN 420

Query: 421 GTELPR 426
           GTELPR
Sbjct: 421 GTELPR 426

>ZYRO0D05434g Chr4 complement(469258..470544) [1287 bp, 428 aa] {ON}
           conserved hypothetical protein
          Length = 428

 Score =  481 bits (1237), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 233/420 (55%), Positives = 303/420 (72%), Gaps = 2/420 (0%)

Query: 1   MTEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNI- 59
           +TE+K+  L  LY D++P S +TESF LEIL +C+G+++ A  ++N+SLGV R  + +I 
Sbjct: 6   LTEKKLEQLSKLYRDIVPASPETESFYLEILVSCEGNLEAAVELINDSLGVQRTSETDIL 65

Query: 60  GKRKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRAKTSNRAIELFSKEDVESTI 119
             + +    + +   KVQKSLN FI+D   K + +S     K SNRAIELF+KED+E+ I
Sbjct: 66  CAKGKHEDEAVSPAPKVQKSLNSFIKDPNNKIKSVSEGSLGKISNRAIELFTKEDIETNI 125

Query: 120 GYVTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSSDPAILDGR 179
            YV++H+  LPE  ANSLL++L  D + F P +F+LFG KC+SNH +K +SS   I  G 
Sbjct: 126 KYVSVHKNVLPELLANSLLKKLSQDNDSFTPNQFYLFGKKCTSNHLTKMFSSSEEISAGN 185

Query: 180 DKIYYNNRR-GTVYEYNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKY 238
            +IYYN+     + +Y+D LK  QLLIED+VN+ I +   LP+QI SPNWKGDVVLVN+Y
Sbjct: 186 IRIYYNSYSLSRIAQYDDDLKMAQLLIEDLVNDCIAQRDLLPYQIRSPNWKGDVVLVNRY 245

Query: 239 GKSDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIMHA 298
            K  +L WHSD++TSIGPQPI+ASLSLGC REFR+R+ YPS+SQIY++RPPHN+L+IMHA
Sbjct: 246 YKESNLDWHSDKMTSIGPQPIIASLSLGCSREFRVRKNYPSNSQIYIIRPPHNTLVIMHA 305

Query: 299 GFQEEYRHSVHQQTNNRATNLHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDLRRA 358
           GFQEEYRH VH  + N     HPIS  VR NLTYR YL+K+++  P+C KC +PMDLRRA
Sbjct: 306 GFQEEYRHCVHGHSKNSPLKPHPISGHVRINLTYRCYLRKFLDRCPKCKKCGSPMDLRRA 365

Query: 359 FKDPERRGQYIWQCSSHYSGVECGGVRLADFNCNSLVVEKNAGEGSRWLADDDWEAKEAQ 418
           FKDP+ RGQYIWQCS  Y+G ECGGV  A F+ +SL V+    EGSRWLA DD EA  AQ
Sbjct: 366 FKDPKTRGQYIWQCSKSYTGQECGGVIRAKFDNDSLTVQNFDEEGSRWLAPDDQEAHSAQ 425

>SAKL0H24838g Chr8 (2160460..2161692) [1233 bp, 410 aa] {ON}
           conserved hypothetical protein
          Length = 410

 Score =  319 bits (817), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/428 (43%), Positives = 248/428 (57%), Gaps = 39/428 (9%)

Query: 2   TEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNIGK 61
           TEEKI  L  L+ D        + FLLE+LT+C GS++ A  +++ S  V++K D  +  
Sbjct: 10  TEEKIKKLNELFPDA------DDEFLLEVLTSCSGSIRQAVSLIDAS--VSQKYD-QLYS 60

Query: 62  RKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRAKTSNRAIELFSKEDVESTIGY 121
            KR          K Q +L + + D   K  P  S R  + +   I L +K++VEST+ Y
Sbjct: 61  TKRLKA-------KTQSTLTKLLSDSLTK--PGIS-RGPQKTRTPIALHTKDEVESTLAY 110

Query: 122 VTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSSDPAILDGRDK 181
            T H+  LP E AN +L  +M+D    +  EF+LFGNKC+SNH ++ YS      + R  
Sbjct: 111 CTYHKDILPSEVANKILELVMNDKSARSN-EFYLFGNKCTSNHKTRIYS----CAEHRKA 165

Query: 182 IYYNNRR-GTVYEYNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKYGK 240
           + YN R    V EY D +    LLIED VNE ++    LP+Q+    W   + + N Y  
Sbjct: 166 LTYNGRVIDDVGEYTDEMMVAHLLIEDFVNEVLQSRGTLPYQVKPGEWTSQMAVANVYKL 225

Query: 241 SDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIMHAGF 300
             +L WHSDRLT+IGPQ IVASLSLG  REFR+R  YPSDSQ+Y ++P HNSL+IMHAGF
Sbjct: 226 DSNLQWHSDRLTNIGPQAIVASLSLGFSREFRVRNIYPSDSQVYSIKPEHNSLLIMHAGF 285

Query: 301 QEEYRHS---VHQQTNNRATNLHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDLRR 357
           QEEY+H    V + +       HPIS   R N+TYR+ + K     P C KC  PM+LRR
Sbjct: 286 QEEYKHCVPPVPKCSRVPKDEFHPISGTTRVNMTYRNRIMK---KTPSCIKCGYPMELRR 342

Query: 358 AFKDPERRGQYIWQCSSHYS-------GVECGGVRLADFNCNSLVVEKNAGEGSRWLADD 410
            FK P+ RG Y+WQCS  Y+       G EC G+R A+FN N  VV  +    SRWLADD
Sbjct: 343 TFKKPDNRGMYMWQCSKSYTEENDFKAGKECKGMRYANFN-NDSVVTDDESNCSRWLADD 401

Query: 411 DWEAKEAQ 418
           D +A+EAQ
Sbjct: 402 DIQAREAQ 409

>KLTH0F00594g Chr6 complement(43649..44950) [1302 bp, 433 aa] {ON}
           conserved hypothetical protein
          Length = 433

 Score =  317 bits (811), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/431 (43%), Positives = 249/431 (57%), Gaps = 46/431 (10%)

Query: 2   TEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNIGK 61
           TEEKIA L +LY D           LL++L +C GS+K ++ +L ++             
Sbjct: 33  TEEKIAELQNLYPDYGVDG------LLDVLVSCGGSLKRSAQLLGDT------------- 73

Query: 62  RKRDTGNSDNRCYKV--QKSLNQFIEDDAKKFRPISSDRRAKTSNRAIELFSKEDVESTI 119
               T  S ++ +K   Q++LN+F+  D +     +       ++R IEL SKEDVEST+
Sbjct: 74  ---TTPESSSKRFKSRQQQTLNRFL--DVRLLPKAAIKTNGSKASRPIELHSKEDVESTL 128

Query: 120 GYVTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSSDPAILDGR 179
            Y T H   LP E AN LL  L  D   F P EF+LFGNKC SN  S+ +  +  I    
Sbjct: 129 KYCTYHPNVLPLELANKLLEALSKD-TSFKPNEFYLFGNKCISNCKSRIFLPENRI---- 183

Query: 180 DKIYYNNRRGTVYE-YNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKY 238
           +  YYN +R   Y  Y+D +   Q+L+E++VN+ + +   LPFQ+ +  W+   VL N Y
Sbjct: 184 EPFYYNGKRVESYSTYSDEIMMAQILVEELVNDVLSQRTALPFQVEAGKWEVQAVLSNSY 243

Query: 239 GKSDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIMHA 298
            +  +L WHSDRLT+IGP  I+ASLSLG  REFR+RR +PS+S  Y +RP HNSLIIMHA
Sbjct: 244 SRDSNLDWHSDRLTNIGPHAIIASLSLGFTREFRVRRVHPSNSSTYSLRPQHNSLIIMHA 303

Query: 299 GFQEEYRHSV---HQQTNNRATNLHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDL 355
           GFQEEY+H V    +  N  A ++HPIS DVR NLT+R+Y    +     C  C  PMDL
Sbjct: 304 GFQEEYKHCVPFLPKNCNIPAEDVHPISNDVRVNLTFRNYA---LTTKVFCKLCGFPMDL 360

Query: 356 RRAFKDPERRGQYIWQCSSHYS-------GVECGGVRLADFNCNSLVVEKNAGEGSRWLA 408
           RR+FKDP +RG YI+QCS  Y+       G EC G   A F       E    +GSRW+A
Sbjct: 361 RRSFKDPSKRGLYIFQCSKSYTEENSFKEGRECKGFAFACFKKKPPFTEFET-DGSRWIA 419

Query: 409 DDDWEAKEAQK 419
           DDD EAK+AQ+
Sbjct: 420 DDDLEAKQAQR 430

>Kwal_33.13025 s33 complement(44353..45624) [1272 bp, 423 aa] {ON}
           [contig 123] FULL
          Length = 423

 Score =  301 bits (770), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 179/430 (41%), Positives = 251/430 (58%), Gaps = 41/430 (9%)

Query: 2   TEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNIGK 61
           T+EK+  L  L+    PK  DT+  LL++L +CDGS+K ++  L  S+      D +  +
Sbjct: 5   TDEKLLHLKELF----PK-YDTDG-LLDVLVSCDGSLKRSADFLGGSVSQTDTPDLHPKR 58

Query: 62  RKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRA-KTSNRAIELFSKEDVESTIG 120
            K           K Q+SL++++E +A    PI +   A K+  R +EL  KE +E+ I 
Sbjct: 59  LKT----------KSQQSLSRYLEVNA--LHPIPNKVPASKSKPRPLELHGKEQIEANIP 106

Query: 121 YVTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSSDPAILDGRD 180
           Y T H   LP E A+ LL+QL++D     P +F+LFGN C+SN  S+ +     + + R+
Sbjct: 107 YCTYHTDVLPSEVADKLLQQLLED-RNHKPNKFYLFGNLCTSNCASRLF-----VPEARE 160

Query: 181 KIYYNNRRGT--VYEYNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKY 238
           K ++ N +       Y D +   Q++IE++VNE I K  PLPFQ+ +  W+   VL N Y
Sbjct: 161 KPFFYNGKEVKNPGNYTDEMMLAQVVIENVVNEAISKRPPLPFQVKANEWEAQAVLSNVY 220

Query: 239 GKSDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIMHA 298
            K  +L WHSDRLT+IGPQ I+ASLSLG  REFR+R+ YPS+SQ++ + P HNSLIIMHA
Sbjct: 221 KKDSNLDWHSDRLTNIGPQAIIASLSLGFSREFRVRKSYPSNSQVFSLLPQHNSLIIMHA 280

Query: 299 GFQEEYRHSVHQQTNNR---ATNLHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDL 355
           GFQEEY+H V +          +LHPIS   R NLTYR+Y+   +     C  C  PM+L
Sbjct: 281 GFQEEYKHCVPKLGKGSRIPKEDLHPISGTTRVNLTYRNYV---MTENVFCKLCGCPMEL 337

Query: 356 RRAFKDPERRGQYIWQCSSHYSGV-------ECGGVRLADFNCNSLVVEKNAGEGSRWLA 408
           RR FK+P +RG YI+QCS  Y+         EC G   A+F C +  +     EGS WLA
Sbjct: 338 RRTFKEPRKRGSYIYQCSRSYTAANGFHENQECKGFAFANF-CKTPPLVSVDSEGSHWLA 396

Query: 409 DDDWEAKEAQ 418
           +DD EA+E Q
Sbjct: 397 EDDTEARELQ 406

>Ecym_1013 Chr1 complement(22905..24140) [1236 bp, 411 aa] {ON}
           similar to Ashbya gossypii AFR741W
          Length = 411

 Score =  293 bits (749), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 176/428 (41%), Positives = 245/428 (57%), Gaps = 44/428 (10%)

Query: 2   TEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNIGK 61
           T+EK+A L +L+             LL++L +C+GSV++A+L+L+ S           G 
Sbjct: 7   TDEKLAYLQNLFPSA------NAEVLLDLLVSCNGSVRDATLLLDLS---------EEGT 51

Query: 62  RKRDTGNSDNRCYKV--QKSLNQFIEDDAKKFRPISS--DRRAKTSNRAIELFSKEDVES 117
           +  +  +   +  KV  Q+SL+ F+        P+ S  +R+++ S + I L+ K+D+E 
Sbjct: 52  QLEEQRSPPRKVAKVKGQQSLSSFL--------PLQSLYNRQSRPSGKPIILYGKKDIEL 103

Query: 118 TIGYVTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSSDPAILD 177
            + Y T H   LPEE AN LL+  M++ +   P EF+LFGNKC SN  S  YS+  A   
Sbjct: 104 ELKYCTYHTDVLPEELANRLLKFTMNE-QNSKPNEFYLFGNKCVSNCRSAIYSNLSA--- 159

Query: 178 GRDKIYYNNRR-GTVYEYNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVN 236
             D  YYN  R  TV  +ND +  T+ +IE +VNE ++K   LPFQ    +WK  VV+ N
Sbjct: 160 EEDDYYYNGMRVQTVNRFNDDMVITRSIIEKLVNEQLQKRLTLPFQTKPGDWKSPVVISN 219

Query: 237 KYGKSDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIM 296
            Y K   L WHSDR+T IGP  ++A+LSLG  R  R RR YPS+SQIY V P HNS++IM
Sbjct: 220 IYAKDSDLQWHSDRMTYIGPHSVIATLSLGFSRGVRFRRVYPSNSQIYTVMPEHNSVLIM 279

Query: 297 HAGFQEEYRHSVHQQTNNRATN---LHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPM 353
           HAG QEE++H V     N   +   ++PIS+  R +LT+RDY K        C KC  PM
Sbjct: 280 HAGCQEEFKHCVPPLPKNHQISKSAINPISQTTRVSLTFRDY-KVNTYEPVHCDKCGYPM 338

Query: 354 DLRRAFKDPERRGQYIWQCSSHYSG-------VECGGVRLADFNCNSLVVEKNAGEGSRW 406
           DLRR +K PE+RG YIW C+  Y+         ECGG++ A FN + L       EGS W
Sbjct: 339 DLRRIYKTPEKRGHYIWLCTKSYTAGNGLNNKQECGGLKFARFN-HPLPTTTTESEGSFW 397

Query: 407 LADDDWEA 414
           +ADDD+EA
Sbjct: 398 VADDDFEA 405

>AFR741W Chr6 (1798195..1799418) [1224 bp, 407 aa] {ON} NOHBY667; No
           homolog in Saccharomyces cerevisiae
          Length = 407

 Score =  276 bits (706), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 171/430 (39%), Positives = 242/430 (56%), Gaps = 40/430 (9%)

Query: 2   TEEKIATLISLYEDVIPKSRDTESFLLEILTACDGSVKNASLMLNESLGVARKVDCNIGK 61
           T+EK+A L    + +IP S DTE+ LL++L  C G+++ A+ +L   +  A + D    K
Sbjct: 7   TDEKLAKL----KAIIP-SADTEA-LLDVLVCCGGNLEEAAALLRNGIDPADEKDARPLK 60

Query: 62  RKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRAKTSNRAIELFSKEDVESTIGY 121
           + R          + Q+SL+++      K  P+ +        R I L  K D+E  + Y
Sbjct: 61  KPR---------LQTQQSLSRYF---GLKKSPVPA-----LGGRPIVLHGKRDIEGALRY 103

Query: 122 VTMHEKALPEEFANSLLRQLMDDLEGFAPYEFHLFGNKCSSNHTSKKYSS-DPAILDGRD 180
            T H   LP   A  LL  +M D E   P EF+LFG++C +N  +  Y + DPA      
Sbjct: 104 CTYHTNVLPAALAERLLEVVMTD-ERAKPNEFYLFGSRCVTNCRTLLYGNLDPA---DAG 159

Query: 181 KIYYNNRRGTVYEYNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKYGK 240
           +++YN R  T+  YN  L   Q ++E +VN  + K   LPFQ+ + +W+  V + N Y K
Sbjct: 160 RVFYNGRISTLTSYNADLCEAQRIVEHLVNAELAKRAKLPFQVPAGSWRCPVAVANIYEK 219

Query: 241 SDHLMWHSDRLTSIGPQPIVASLSLGCVREFRIRRCYPSDSQIYVVRPPHNSLIIMHAGF 300
              L WHSDRLT IGP  IVASL+LG  REFR+RR YP+DSQIY +   HNS++IMHAG 
Sbjct: 220 DSDLQWHSDRLTYIGPHAIVASLTLGFEREFRLRRVYPADSQIYSIPLAHNSVLIMHAGC 279

Query: 301 QEEYRHSV---HQQTNNRATNLHPISKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDLRR 357
           QEE++H V    ++    A  LHPIS  VR +LT+R Y   +  +A  CP+C  PMDLRR
Sbjct: 280 QEEFKHCVPPLGKRKKVSAAELHPISGSVRVSLTFRHYKVDFPRDA-LCPECGYPMDLRR 338

Query: 358 AFKDPERRGQYIWQCSSHYS-----GVE--CGGVRLADFNCNSLVVEKNAGEGSRWLADD 410
            +K P +RG YIW CS  YS      VE  C G++ A  + +  V +  + EG+ WLADD
Sbjct: 339 TYKTPSKRGHYIWICSRGYSSGNDKSVESFCKGIKYACVDASPPVTDIES-EGNVWLADD 397

Query: 411 DWEAKEAQKN 420
           D+EA   +K+
Sbjct: 398 DFEALNFRKS 407

>KAFR0G01270 Chr7 complement(285838..286719) [882 bp, 293 aa] {ON}
           Anc_3.94 YDR489W
          Length = 293

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 45/101 (44%), Gaps = 23/101 (22%)

Query: 116 ESTIGYVTMHEKALPEEFANSLLRQLMDDLEGF-----------AP----YEFHLFGNKC 160
           ES + Y   H   L + F NS+L+ L  +L+             AP    + F L     
Sbjct: 177 ESEVVYHQKHFNILLKIFNNSILQHLPSELQAINDTEGSVNMIDAPDWDKFVFVLVTGPP 236

Query: 161 SSNHTSKKYSSDPAILDGRDKIYYNNRRGTVYEYNDLLKAT 201
           +SN     +S DP ++  +DK YYN    TV E N+ ++ T
Sbjct: 237 NSN-----FSEDPLLIKSQDKFYYN---VTVEELNEDIELT 269

>KAFR0A03350 Chr1 complement(683830..684603) [774 bp, 257 aa] {ON}
           Anc_1.243 YKR041W
          Length = 257

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 191 VYEYNDLLKATQLLIEDIVNETIKKFKPLPFQISSPNWKGDVVLVNKYGKSDHLMWHSDR 250
           +Y YN  L  T   IE I  E+++ F  L       +W  + +L     K + + WH D+
Sbjct: 175 LYRYNSSLAETN--IEQITTESVRTFYELSCNAVRKDW--ETLL-----KKERIRWHPDK 225

Query: 251 LTSIGPQPIVASLS 264
            + I P+  +  ++
Sbjct: 226 FSRISPETSLKKVT 239

>NDAI0F04140 Chr6 complement(994996..1001766) [6771 bp, 2256 aa] {ON}
            Anc_1.94 YNL262W
          Length = 2256

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 271  FRIRRCYPSDSQIYVVRPPHNSLIIMHAGFQEEYRHSVHQQTN--NRATNLHPISKDVRF 328
            F + + + +   + V++P + +  +  +  ++ YR S H+++N   + T+L  + +DV F
Sbjct: 1530 FTLFKSWGNTINVLVLKPSNQAQELNQSILEQTYRESYHKRSNKIKKFTHLVDVKEDVEF 1589

Query: 329  NLTY 332
            N  Y
Sbjct: 1590 NFEY 1593

>YKL222C Chr11 complement(3503..5620) [2118 bp, 705 aa] {ON} Protein
           of unknown function that may interact with ribosomes,
           based on co-purification experiments; similar to
           transcriptional regulators from the zinc cluster
           (binuclear cluster) family; null mutant is sensitive to
           caffeine
          Length = 705

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 203 LLIEDIVNETIKKFKPLPFQISSPNWKGD 231
           L+IED+   TIK FKPL F +++ N  G+
Sbjct: 425 LIIEDLKKFTIKMFKPLDFYLNASNLNGN 453

>NCAS0G03900 Chr7 complement(721778..723490) [1713 bp, 570 aa] {ON}
           Anc_2.276 YIL099W
          Length = 570

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 5/71 (7%)

Query: 309 HQQTNNRATNLHPI-----SKDVRFNLTYRDYLKKYINNAPRCPKCDNPMDLRRAFKDPE 363
           +Q T + A  ++P+     S D + N T    L KY+NN+    + DNP      ++D +
Sbjct: 124 YQWTRDAALVMNPLILNLFSSDEKVNGTIASTLLKYLNNSYALQQLDNPSGNGTKYQDLK 183

Query: 364 RRGQYIWQCSS 374
             G+  W+ +S
Sbjct: 184 GLGEPKWEVNS 194

>TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.124
           YGL171W
          Length = 579

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 3/73 (4%)

Query: 50  GVARKVDCNIGKRKRDTGNSDNRCYKVQKSLNQFIEDDAKKFRPISSDRRAKTSNR---A 106
           G + K D N  K+ RD  NS N     QKS N  I++D +  + +   R  +  NR    
Sbjct: 10  GASVKKDTNAAKQLRDVDNSRNDENSEQKSSNNLIKEDVQITKELDFFRNKRIVNRIEKQ 69

Query: 107 IELFSKEDVESTI 119
            EL +K   E TI
Sbjct: 70  KELENKTSAEPTI 82

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,253,218
Number of extensions: 2274888
Number of successful extensions: 6312
Number of sequences better than 10.0: 29
Number of HSP's gapped: 6488
Number of HSP's successfully gapped: 29
Length of query: 426
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 314
Effective length of database: 40,638,807
Effective search space: 12760585398
Effective search space used: 12760585398
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)