Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TDEL0H033703.190ON1531538291e-115
ZYRO0A04906g3.190ON1601635604e-74
Kpol_1045.683.190ON1761784842e-62
YDL008W (APC11)3.190ON1651654772e-61
Suva_4.2393.190ON1651654632e-59
Smik_4.2243.190ON1651654599e-59
Skud_4.2433.190ON1651654572e-58
SAKL0C10516g3.190ON1441454388e-56
Kwal_56.231123.190ON1351544125e-52
KLTH0G16082g3.190ON1351533987e-50
AER016C3.190ON1471523911e-48
CAGL0I04576g3.190ON1491273892e-48
TBLA0A002603.190ON1841543871e-47
Ecym_53123.190ON1481523823e-47
KAFR0A012403.190ON1731453834e-47
TPHA0H006403.190ON1801813783e-46
NDAI0A065203.190ON2061293701e-44
KNAG0J012503.190ON2021513612e-43
KLLA0E17711g3.190ON1621713149e-37
NCAS0I019203.190ON1281222865e-33
KLTH0F19228g3.28ON1101041178e-08
TBLA0I019603.279ON184781181e-07
Ecym_20293.28ON1141041152e-07
NCAS0C044803.28ON1091041108e-07
Kwal_55.220543.28ON1111041081e-06
KAFR0C017803.28ON118691091e-06
ADL181W3.28ON1081041081e-06
SAKL0C13178g3.28ON138961092e-06
NDAI0G038603.28ON1231041082e-06
YOL133W (HRT1)3.28ON1211041082e-06
Suva_15.263.28ON1221041082e-06
Smik_15.203.28ON121691072e-06
Skud_15.203.28ON1211041063e-06
ZYRO0C03058g3.28ON1161041063e-06
Kpol_1014.163.28ON107691053e-06
KLLA0E07151g3.28ON110691054e-06
CAGL0E01567g3.28ON1021041027e-06
TPHA0I005908.799ON1591661088e-06
KLLA0C14344g8.799ON1518661088e-06
KNAG0A012803.28ON1141041021e-05
TBLA0B087103.28ON122691021e-05
TDEL0A004703.28ON118691012e-05
TPHA0P014703.28ON111691012e-05
KLLA0F18458g3.279ON140761003e-05
TDEL0B009808.799ON1559661025e-05
NCAS0A082803.279ON11872985e-05
TBLA0D006508.799ON1568661026e-05
Ecym_26583.279ON15960986e-05
SAKL0B06226g8.799ON1557591017e-05
NDAI0G052001.389ON15861171008e-05
NDAI0K007108.799ON159166991e-04
KLTH0E13992g8.799ON155066991e-04
Kwal_27.123278.799ON157466991e-04
ZYRO0F12760g8.799ON155566991e-04
Kpol_480.258.799ON157166991e-04
CAGL0H10274g3.279ON17570962e-04
ZYRO0E06996g3.279ON17276952e-04
KAFR0B036208.799ON156066963e-04
Suva_13.4328.799ON155966955e-04
YMR247C (RKR1)8.799ON156266955e-04
Skud_13.4198.799ON156466955e-04
Smik_13.4608.799ON156666955e-04
KNAG0J005408.799ON156166955e-04
NCAS0C006808.799ON156466946e-04
Ecym_74188.799ON154763938e-04
TBLA0G023102.542ON67465910.001
TDEL0C027707.416ON20880880.002
NDAI0A074503.279ON17371860.003
AGR034W3.279ON15950860.004
KLTH0F18502gsingletonON26769860.004
AGL079C2.542ON50649870.005
Kwal_55.21206singletonON27567860.005
ABL058C8.799ON154662870.005
KAFR0C004603.279ON15787840.005
KLLA0C05874g6.45ON55384860.005
CAGL0H02651g8.799ON154466870.006
Skud_2.1863.279ON17859840.008
TDEL0D034603.279ON14441820.011
Suva_15.223.22ON133673840.013
TBLA0B012602.157ON88562830.016
SAKL0E01958g6.45ON524134820.017
Kpol_1023.322.411ON117864820.021
KLTH0C05258g3.279ON15264800.023
KLLA0C15697g3.405ON30458810.025
KNAG0A074303.405ON10231770.027
Kwal_27.105463.279ON10443770.027
ZYRO0B02244g2.542ON56362810.027
Ecym_42508.317ON65772810.027
YBR062C3.279ON18059790.030
Smik_2.1963.279ON18559790.030
TDEL0A031802.542ON56759810.031
SAKL0E04488g2.411ON112748810.031
TPHA0F018402.157ON52141810.031
TPHA0C042502.542ON55649810.031
Suva_4.3023.279ON15059780.032
CAGL0L03960g2.157ON60347800.034
KAFR0I020901.389ON146630810.034
Ecym_72442.542ON53249800.035
TPHA0A039903.279ON17562790.036
NCAS0A04680singletonON27466790.036
TPHA0C042602.545ON75784800.037
KLTH0D07150g2.542ON54065800.038
Suva_8.422.542ON58549800.040
KAFR0F007402.157ON51047800.040
YHL010C (ETP1)2.542ON58549800.043
Skud_8.352.542ON58549790.045
NCAS0B069902.157ON521107790.045
Smik_8.322.542ON58549790.045
CAGL0K02563g2.542ON58655790.052
SAKL0A09746g2.542ON54856790.052
KLLA0E07019g7.416ON27961780.053
KAFR0A019902.542ON56055790.054
KNAG0C056602.542ON50763780.062
Kpol_505.182.157ON58537780.063
SAKL0D03058g3.279ON15559760.067
Suva_13.4158.761ON102849780.067
KNAG0J008503.279ON16277760.070
NCAS0G025202.157ON51841780.072
TBLA0F032803.405ON55529780.074
Kpol_1052.193.279ON10367740.076
KAFR0B014602.545ON76180780.077
NDAI0B018202.542ON62549780.077
KNAG0H035102.157ON55141780.077
YMR231W (PEP5)8.761ON102949770.089
KLTH0E09834g2.157ON47955770.094
TDEL0B061701.389ON147090770.098
Kwal_26.80902.542ON52065770.099
AGL217W8.808ON41446760.10
NCAS0A113503.405ON42860760.12
YOL138C (RTC1)3.22ON134173760.12
Kwal_47.179042.157ON47041760.12
SAKL0E10824g2.157ON47541760.13
Kwal_56.225226.45ON51335760.14
KLLA0F25740g2.542ON51752760.14
NDAI0G038103.22ON139360760.14
Ecym_26848.808ON38644750.15
KNAG0C034107.416ON21967740.16
YKL034W (TUL1)2.545ON75831750.16
KLTH0F11044g3.405ON29169740.19
NDAI0K018102.545ON76234740.20
TDEL0B052002.157ON52445740.20
NDAI0F027702.157ON55463740.21
ZYRO0B16258g2.157ON57932740.22
CAGL0E02299g6.45ON54563740.22
Skud_8.1762.157ON41341730.25
Ecym_54453.405ON32127730.25
Smik_15.163.22ON132660740.26
NCAS0C033108.317ON570124730.26
Suva_11.1892.545ON75831740.27
KNAG0A070902.545ON76231730.27
ACR267C2.157ON46741730.28
TBLA0B005606.45ON49235730.29
ZYRO0G13376g8.808ON44535730.32
Kpol_1002.72.545ON75432730.32
CAGL0G03553g7.416ON21054720.33
Suva_15.3112.157ON26941720.33
Kpol_1002.82.542ON55849730.35
KLTH0C10604g6.45ON51535720.35
ACL019C6.45ON57570720.37
Smik_13.4398.761ON103049730.37
TPHA0B036501.389ON157685730.38
SAKL0D02354g8.808ON33148720.39
NCAS0A125502.542ON57298720.40
Smik_11.2132.545ON75931720.41
CAGL0A03432g2.411ON115185720.42
KLTH0G18150g1.389ON155488720.46
Suva_16.4203.405ON29059710.47
Kpol_1048.731.389ON154989720.50
Smik_8.1932.157ON41633710.50
TBLA0I014902.545ON75031710.58
ABR104W3.405ON32849700.64
SAKL0H15686g8.317ON59937710.64
KLTH0E09174g2.411ON114850710.67
YDR265W (PEX10)5.628ON33783700.68
TDEL0G042506.45ON51727700.75
Skud_12.992.411ON117182700.76
NDAI0E004408.808ON41664700.77
YHR115C (DMA1)2.157ON41641700.77
KAFR0B034208.761ON103671700.79
CAGL0B05049g1.389ON147045700.81
TPHA0A033403.405ON38456690.84
TBLA0H002303.22ON133342700.85
Ecym_54282.157ON47438690.86
TDEL0B063402.545ON76286700.86
Skud_15.1486.45ON54835690.93
YDR143C (SAN1)8.317ON61036690.95
KAFR0D016708.808ON35742690.97
Kpol_538.53.405ON33591690.99
Kpol_478.85.190ON202233691.0
AEL104W1.190ON108564691.1
Skud_11.1922.545ON75831691.1
KAFR0B046002.157ON40894681.1
TDEL0F044408.317ON55432681.2
Skud_4.4028.317ON61236681.2
NCAS0D020106.45ON51067681.2
TBLA0D004407.416ON29364681.2
TBLA0C013301.389ON145253691.2
Kpol_1035.506.45ON60127681.2
CAGL0L01947g2.545ON75759681.3
KLTH0C04664g8.808ON30643681.4
KAFR0A052406.45ON55327681.4
SAKL0H17116gsingletonON54437681.4
TBLA0B033708.761ON106466681.5
TDEL0F02870na 1ON26060671.6
SAKL0C01760gsingletonON147482681.6
SAKL0C03586gsingletonON147482681.6
Kpol_1030.298.761ON101666681.6
KLTH0D07216g2.545ON74731671.7
KLLA0F25674g2.545ON75736671.8
Kwal_27.104198.808ON30041671.8
Kwal_26.80992.545ON75031671.8
NCAS0A047602.545ON76131671.9
ZYRO0C07194g6.45ON55827672.0
YLR032W (RAD5)2.411ON116942672.0
KLLA0F12166g1.389ON152887672.0
Suva_14.2232.157ON58038672.0
YOL013C (HRD1)6.45ON55135672.0
KNAG0A060302.411ON115060672.1
Suva_15.1596.45ON55035662.2
SAKL0A09812g2.545ON75131662.3
Skud_14.2162.157ON53038662.3
ZYRO0C17424g3.405ON27327662.3
ZYRO0E05632g2.545ON76531662.4
Suva_10.1122.411ON116769662.4
Smik_15.1576.45ON55027662.4
KLLA0E04071g8.317ON70438662.4
Ecym_72412.545ON75831662.5
ZYRO0A13398g8.562ON253732662.5
KNAG0E027406.45ON55627662.5
Smik_4.3878.317ON63436662.5
NDAI0G026308.317ON66128662.6
YLR247C (IRC20)1.389ON155685662.7
ADL186C3.22ON136153662.7
YNL116W (DMA2)2.157ON52238652.8
SAKL0H01276g5.34ON133745662.9
Suva_2.3048.317ON62438653.0
TBLA0D040208.288ON117852663.0
Smik_5.881.448ON267104653.2
Ecym_30486.45ON67027653.2
SAKL0D10890g1.448ON26597643.4
ZYRO0E03498g1.448ON24399643.5
Skud_15.163.22ON133255653.5
Kwal_55.220763.22ON128653653.6
CAGL0I09988g8.808ON38733643.6
CAGL0K08052g3.405ON30585643.8
TPHA0J015708.761ON101848653.9
Smik_12.942.411ON117859653.9
Skud_10.591.190ON83255644.4
TDEL0C054203.405ON9327614.8
NCAS0B009908.808ON39232635.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TDEL0H03370
         (153 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON...   323   e-115
ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {O...   220   4e-74
Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {...   191   2e-62
YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Cataly...   188   2e-61
Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W (...   182   2e-59
Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W (...   181   9e-59
Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W (...   180   2e-58
SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar...   173   8e-56
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...   163   5e-52
KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some ...   157   7e-50
AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON} Sy...   155   1e-48
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...   154   2e-48
TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON} ...   153   1e-47
Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON} ...   151   3e-47
KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.19...   152   4e-47
TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.19...   150   3e-46
NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3....   147   1e-44
KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {O...   143   2e-43
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...   125   9e-37
NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.19...   114   5e-33
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    50   8e-08
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    50   1e-07
Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to A...    49   2e-07
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       47   8e-07
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    46   1e-06
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    47   1e-06
ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic hom...    46   1e-06
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    47   2e-06
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    46   2e-06
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    46   2e-06
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    46   2e-06
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    46   2e-06
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    45   3e-06
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    45   3e-06
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    45   3e-06
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    45   4e-06
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    44   7e-06
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    46   8e-06
KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} sim...    46   8e-06
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    44   1e-05
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    44   1e-05
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    44   2e-05
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    44   2e-05
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    43   3e-05
TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8....    44   5e-05
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    42   5e-05
TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8....    44   6e-05
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    42   6e-05
SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} simil...    44   7e-05
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    43   8e-05
NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8...    43   1e-04
KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} sim...    43   1e-04
Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR...    43   1e-04
ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa...    43   1e-04
Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON} (57636.....    43   1e-04
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    42   2e-04
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    41   2e-04
KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {...    42   3e-04
Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] ...    41   5e-04
YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}...    41   5e-04
Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] ...    41   5e-04
Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] ...    41   5e-04
KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.7...    41   5e-04
NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8....    41   6e-04
Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar ...    40   8e-04
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    40   0.001
TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON...    39   0.002
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    38   0.003
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    38   0.004
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    38   0.004
AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON} S...    38   0.005
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    38   0.005
ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON} ...    38   0.005
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    37   0.005
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...    38   0.005
CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} simil...    38   0.006
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    37   0.008
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    36   0.011
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    37   0.013
TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.1...    37   0.016
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...    36   0.017
Kpol_1023.32 s1023 complement(68737..72273) [3537 bp, 1178 aa] {...    36   0.021
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    35   0.023
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    36   0.025
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    34   0.027
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    34   0.027
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    36   0.027
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    36   0.027
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    35   0.030
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    35   0.030
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    36   0.031
SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} simil...    36   0.031
TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {O...    36   0.031
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    36   0.031
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    35   0.032
CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa] ...    35   0.034
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    36   0.034
Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}...    35   0.035
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    35   0.036
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      35   0.036
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    35   0.037
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    35   0.038
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    35   0.040
KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.1...    35   0.040
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    35   0.043
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    35   0.045
NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa] ...    35   0.045
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    35   0.045
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    35   0.052
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    35   0.052
KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some si...    35   0.053
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    35   0.054
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    35   0.062
Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}...    35   0.063
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    34   0.067
Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR23...    35   0.067
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    34   0.070
NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.1...    35   0.072
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    35   0.074
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    33   0.076
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    35   0.077
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     35   0.077
KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {O...    35   0.077
YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}  PEP5Comp...    34   0.089
KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {...    34   0.094
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    34   0.098
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    34   0.099
AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic ho...    34   0.10 
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    34   0.12 
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    34   0.12 
Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {...    34   0.12 
SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {...    34   0.13 
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...    34   0.14 
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    34   0.14 
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    34   0.14 
Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {O...    33   0.15 
KNAG0C03410 Chr3 (669679..670338) [660 bp, 219 aa] {ON} Anc_7.41...    33   0.16 
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    33   0.16 
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    33   0.19 
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    33   0.20 
TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.1...    33   0.20 
NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {O...    33   0.21 
ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]...    33   0.22 
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...    33   0.22 
Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON...    33   0.25 
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    33   0.25 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    33   0.26 
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     33   0.26 
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    33   0.27 
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    33   0.27 
ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON} S...    33   0.28 
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...    33   0.29 
ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]...    33   0.32 
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    33   0.32 
CAGL0G03553g Chr7 complement(345057..345689) [633 bp, 210 aa] {O...    32   0.33 
Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {O...    32   0.33 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    33   0.35 
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...    32   0.35 
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...    32   0.37 
Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR23...    33   0.37 
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    33   0.38 
SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly ...    32   0.39 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    32   0.40 
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    32   0.41 
CAGL0A03432g Chr1 (349884..353339) [3456 bp, 1151 aa] {ON} simil...    32   0.42 
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    32   0.46 
Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa] {O...    32   0.47 
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    32   0.50 
Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON...    32   0.50 
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    32   0.58 
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    32   0.64 
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    32   0.64 
KLTH0E09174g Chr5 (830858..834304) [3447 bp, 1148 aa] {ON} simil...    32   0.67 
YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}  PEX10Perox...    32   0.68 
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...    32   0.75 
Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032...    32   0.76 
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    32   0.77 
YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}  ...    32   0.77 
KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8....    32   0.79 
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    32   0.81 
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    31   0.84 
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    32   0.85 
Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}...    31   0.86 
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    32   0.86 
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...    31   0.93 
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    31   0.95 
KAFR0D01670 Chr4 complement(332442..333515) [1074 bp, 357 aa] {O...    31   0.97 
Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)...    31   0.99 
Kpol_478.8 s478 complement(33393..38306,38308..39462) [6069 bp, ...    31   1.0  
AEL104W Chr5 (431236..434493) [3258 bp, 1085 aa] {ON} Syntenic h...    31   1.1  
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    31   1.1  
KAFR0B04600 Chr2 complement(956458..957684) [1227 bp, 408 aa] {O...    31   1.1  
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    31   1.2  
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    31   1.2  
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...    31   1.2  
TBLA0D00440 Chr4 (107763..108644) [882 bp, 293 aa] {ON} Anc_7.41...    31   1.2  
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    31   1.2  
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...    31   1.2  
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    31   1.3  
KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some si...    31   1.4  
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...    31   1.4  
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    31   1.4  
TBLA0B03370 Chr2 complement(784352..787546) [3195 bp, 1064 aa] {...    31   1.5  
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      30   1.6  
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    31   1.6  
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    31   1.6  
Kpol_1030.29 s1030 complement(56650..59700) [3051 bp, 1016 aa] {...    31   1.6  
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    30   1.7  
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    30   1.8  
Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W...    30   1.8  
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    30   1.8  
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    30   1.9  
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...    30   2.0  
YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA ...    30   2.0  
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    30   2.0  
Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116...    30   2.0  
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...    30   2.0  
KNAG0A06030 Chr1 complement(909762..913214) [3453 bp, 1150 aa] {...    30   2.1  
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...    30   2.2  
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    30   2.3  
Skud_14.216 Chr14 (398407..399999) [1593 bp, 530 aa] {ON} YNL116...    30   2.3  
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    30   2.3  
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    30   2.4  
Suva_10.112 Chr10 (211443..214946) [3504 bp, 1167 aa] {ON} YLR03...    30   2.4  
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...    30   2.4  
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    30   2.4  
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    30   2.5  
ZYRO0A13398g Chr1 complement(1057353..1064966) [7614 bp, 2537 aa...    30   2.5  
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...    30   2.5  
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    30   2.5  
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     30   2.6  
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    30   2.7  
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    30   2.7  
YNL116W Chr14 (408341..409909) [1569 bp, 522 aa] {ON}  DMA2Ubiqu...    30   2.8  
SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa] ...    30   2.9  
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    30   3.0  
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    30   3.0  
Smik_5.88 Chr5 complement(126509..127312) [804 bp, 267 aa] {ON} ...    30   3.2  
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...    30   3.2  
SAKL0D10890g Chr4 (904673..905470) [798 bp, 265 aa] {ON} similar...    29   3.4  
ZYRO0E03498g Chr5 complement(274104..274835) [732 bp, 243 aa] {O...    29   3.5  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    30   3.5  
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    30   3.6  
CAGL0I09988g Chr9 complement(951638..952801) [1164 bp, 387 aa] {...    29   3.6  
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    29   3.8  
TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON} Anc_8...    30   3.9  
Smik_12.94 Chr12 (191768..195304) [3537 bp, 1178 aa] {ON} YLR032...    30   3.9  
Skud_10.59 Chr10 complement(99006..101504) [2499 bp, 832 aa] {ON...    29   4.4  
TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}...    28   4.8  
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    29   5.1  
NCAS0A04120 Chr1 complement(833424..836837) [3414 bp, 1137 aa] {...    29   5.3  
Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON} (83624..84...    29   5.4  
KLTH0E04312g Chr5 complement(388173..391268) [3096 bp, 1031 aa] ...    29   5.4  
Kwal_55.20318 s55 complement(347619..350318) [2700 bp, 899 aa] {...    29   5.7  
Smik_14.212 Chr14 (387986..389575) [1590 bp, 529 aa] {ON} YNL116...    29   6.3  
ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 ...    28   6.7  
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    29   6.8  
Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] ...    29   6.8  
KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {O...    28   7.1  
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    28   7.5  
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    28   7.5  
Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W ...    28   7.6  
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    28   7.7  
Smik_10.76 Chr10 complement(121615..124152) [2538 bp, 845 aa] {O...    28   7.8  
KAFR0H02090 Chr8 complement(397562..400285) [2724 bp, 907 aa] {O...    28   8.7  
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    28   9.0  
ZYRO0G15642g Chr7 complement(1271054..1274128) [3075 bp, 1024 aa...    28   9.0  
KNAG0G03280 Chr7 complement(703783..704838) [1056 bp, 351 aa] {O...    28   9.7  

>TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON}
           Anc_3.190 YDL008W
          Length = 153

 Score =  323 bits (829), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 153/153 (100%), Positives = 153/153 (100%)

Query: 1   MKVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGC 60
           MKVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGC
Sbjct: 1   MKVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGC 60

Query: 61  PLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQW 120
           PLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQW
Sbjct: 61  PLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQW 120

Query: 121 QTRQQEFGDQQDPETNPLEDQDDPMMDQGLIVR 153
           QTRQQEFGDQQDPETNPLEDQDDPMMDQGLIVR
Sbjct: 121 QTRQQEFGDQQDPETNPLEDQDDPMMDQGLIVR 153

>ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {ON}
           similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 160

 Score =  220 bits (560), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 122/163 (74%), Gaps = 13/163 (7%)

Query: 1   MKVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGC 60
           MKV + EVHSVFAWTWHIPK+++D   E  DD   DDVCGICRASYNATCP CK+PGD C
Sbjct: 1   MKVDIEEVHSVFAWTWHIPKDNKDGSLEADDD---DDVCGICRASYNATCPSCKYPGDEC 57

Query: 61  PLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQW 120
            LVVGECNHNFHVHCIYRWLDT TS+GLCPMCRQ FQLK+GLAINDSQ+ KF+EL+ ++ 
Sbjct: 58  SLVVGECNHNFHVHCIYRWLDTTTSKGLCPMCRQLFQLKRGLAINDSQLEKFKELQLRKR 117

Query: 121 QTRQQEFGDQQDPET----------NPLEDQDDPMMDQGLIVR 153
                EF D+ D E             ++DQ D +MDQGL+VR
Sbjct: 118 TNTAGEFADEDDEEAIERAMAQQDQAEVDDQGDVIMDQGLVVR 160

>Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {ON}
           complement(160586..161116) [531 nt, 177 aa]
          Length = 176

 Score =  191 bits (484), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 125/178 (70%), Gaps = 27/178 (15%)

Query: 1   MKVKLREVHSVFAWTWHIPKES--------QDAHAET---IDDNDGDDVCGICRASYNAT 49
           MKV++++VH VF+W+WHIPK +        +DA  +    + ++D +DVCGICRAS+N T
Sbjct: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60

Query: 50  CPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQI 109
           CP CKFPGDGCPLV+GEC HNFHVHCIY WLDT+TSRGLCPMCRQ FQLKKG++INDS I
Sbjct: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120

Query: 110 SKFQELRNKQWQTRQQEF--------------GDQQDPETNPLEDQDDPMMDQGLIVR 153
            +F+EL  K+ Q  Q EF               +Q+D   N +++Q D +MDQ L+VR
Sbjct: 121 ERFRELAIKR-QQEQNEFESNLDDDAAIARAIAEQEDTGRN-VDNQGDIIMDQDLVVR 176

>YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Catalytic
           core subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; contains a RING-H2 domain that is required
           for activity
          Length = 165

 Score =  188 bits (477), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 92/165 (55%), Positives = 120/165 (72%), Gaps = 12/165 (7%)

Query: 1   MKVKLREVHSVFAWTWHIPKESQD--AHAETIDDNDGDDVCGICRASYNATCPGCKFPGD 58
           MKVK+ EVHSVFAW+WHIP  S +  A+ + I +++ +DVCGICRASYN TCP CKFPGD
Sbjct: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60

Query: 59  GCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNK 118
            CPLV+G C+HNFH HCIYRWLDT TS+GLCPMCRQTFQL+KGLAIND+ + KF E+ ++
Sbjct: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120

Query: 119 QWQTR-----QQEFGDQQDP----ETNPL-EDQDDPMMDQGLIVR 153
           + +        +EF D  +P      NP+   Q D ++D+  ++R
Sbjct: 121 RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR 165

>Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  182 bits (463), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 90/165 (54%), Positives = 118/165 (71%), Gaps = 12/165 (7%)

Query: 1   MKVKLREVHSVFAWTWHIPKESQDAHA-ETIDDNDGD-DVCGICRASYNATCPGCKFPGD 58
           MKVK+ +VHSVFAW+WHIP+ S +    E  ++ND D DVCGICRASYN TCP CKFPGD
Sbjct: 1   MKVKINQVHSVFAWSWHIPRISDENETNEVTNENDDDEDVCGICRASYNGTCPSCKFPGD 60

Query: 59  GCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNK 118
            CPLV+G C+HNFH HCIYRWLDT+ S+GLCPMCRQ FQL+KGLAIND+ I KF E+ ++
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQVFQLQKGLAINDAHIRKFVEVVSR 120

Query: 119 QWQTRQQE-----FGD-----QQDPETNPLEDQDDPMMDQGLIVR 153
           + +   +E     F D     +Q+ ++     Q D ++D+  ++R
Sbjct: 121 RREEMIEEGVAEDFVDFDEPIRQNTDSAIDRQQVDTVLDEDFLLR 165

>Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  181 bits (459), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 116/165 (70%), Gaps = 12/165 (7%)

Query: 1   MKVKLREVHSVFAWTWHIPKES-QDAHAETIDDND-GDDVCGICRASYNATCPGCKFPGD 58
           MKVK+ EVHSVFAWTW IP  S +    + ++DND  +DVCGICRASYN TCP CKFPGD
Sbjct: 1   MKVKINEVHSVFAWTWQIPSISDEKVTNDKLNDNDENEDVCGICRASYNGTCPSCKFPGD 60

Query: 59  GCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNK 118
            CPLV+G C+HNFH HCIYRWLDT TS+GLCPMCRQ FQL+KGLAIND+ I KF E+ ++
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120

Query: 119 QWQTRQQE-----FGDQQDPETNPLED-----QDDPMMDQGLIVR 153
           + +   +E     F D  +P     ++     Q D ++D+  ++R
Sbjct: 121 RREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165

>Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  180 bits (457), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 89/165 (53%), Positives = 118/165 (71%), Gaps = 12/165 (7%)

Query: 1   MKVKLREVHSVFAWTWHIPKESQDAHA-ETIDDNDGD-DVCGICRASYNATCPGCKFPGD 58
           MKVK+ EVHSVFAW+WHIP  S +    E  ++ND D DVCGICRASYN TCP CK+PGD
Sbjct: 1   MKVKINEVHSVFAWSWHIPSISDEVIGNEVPNENDEDEDVCGICRASYNGTCPSCKYPGD 60

Query: 59  GCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNK 118
            CPLV+G C+HNFH HCIYRWLDT+ S+GLCPMCRQTFQL+KGLAIND+ I KF ++ ++
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120

Query: 119 QWQTRQQE--------FGD--QQDPETNPLEDQDDPMMDQGLIVR 153
           + +   +E        F +  +Q+ ++     Q D ++D+  ++R
Sbjct: 121 RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165

>SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008W APC11
           Catalytic core subunit of the Anaphase- Promoting
           Complex/Cyclosome (APC/C) which is a ubiquitin- protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 144

 Score =  173 bits (438), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 101/145 (69%), Gaps = 9/145 (6%)

Query: 9   HSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGCPLVVGECN 68
           H+V +W+WHIP++    H E  D  +  DVCGICR SYN TCP CK+PGD CPLVVGECN
Sbjct: 9   HAVCSWSWHIPRDGTHQH-EAADTEE--DVCGICRVSYNGTCPSCKYPGDECPLVVGECN 65

Query: 69  HNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQWQTRQQEFG 128
           HNFHVHCI +WLDTATSRGLCPMCRQ F LK+G+AINDSQ+  F +L NK  +    E  
Sbjct: 66  HNFHVHCIVQWLDTATSRGLCPMCRQLFSLKRGVAINDSQLDHFAKLLNKVNRAGATELA 125

Query: 129 DQQDPETNPLEDQDDPMMDQGLIVR 153
           +        L ++ D MM+Q  +VR
Sbjct: 126 NA------GLAEEQDLMMEQDFLVR 144

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score =  163 bits (412), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 81/154 (52%), Positives = 102/154 (66%), Gaps = 20/154 (12%)

Query: 1   MKVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGD-DVCGICRASYNATCPGCKFPGDG 59
           MK++ ++V+ VF+W+W IP +      +  D   GD D+CGICR SYN TCPGC+FPGD 
Sbjct: 1   MKIEFKKVYPVFSWSWDIPGD------DNADKEIGDEDLCGICRVSYNGTCPGCRFPGDN 54

Query: 60  CPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQ 119
           CPLV+GECNHNFHVHCI +WL+TAT++GLCPMCRQ F LK+G+AIN+ Q+    +L    
Sbjct: 55  CPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKLLL-- 112

Query: 120 WQTRQQEFGDQQDPETNPLEDQDDPMMDQGLIVR 153
                     Q  P     EDQ D MMDQ  IVR
Sbjct: 113 ----------QSQPAALTTEDQ-DMMMDQEFIVR 135

>KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some
           similarities with uniprot|Q12157 Saccharomyces
           cerevisiae YDL008W APC11 Catalytic core subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 135

 Score =  157 bits (398), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 79/153 (51%), Positives = 99/153 (64%), Gaps = 18/153 (11%)

Query: 1   MKVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGC 60
           M+++ ++V+ VF+W+W IP +  DA  E  D+    D+CGICR SYN TCPGCK+PGD C
Sbjct: 1   MQLEFKKVYPVFSWSWDIPGDD-DADREIGDE----DLCGICRVSYNGTCPGCKYPGDNC 55

Query: 61  PLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQW 120
           PLV+GECNHNFHVHCI +WL T T++GLCPMCRQ F LK+G+AIN+ Q+ K   L N   
Sbjct: 56  PLVIGECNHNFHVHCIQQWLATPTAKGLCPMCRQQFSLKRGVAINEGQVEK---LANLLL 112

Query: 121 QTRQQEFGDQQDPETNPLEDQDDPMMDQGLIVR 153
           Q R                D  D MMDQ   VR
Sbjct: 113 QPRPAALA----------ADDQDMMMDQEFAVR 135

>AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL008W
           (APC11)
          Length = 147

 Score =  155 bits (391), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 74/152 (48%), Positives = 102/152 (67%), Gaps = 7/152 (4%)

Query: 1   MKVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGC 60
           M++++  +  V +W W +PKE +   +   +D D +DVCGICR SYN TCP CK PG+ C
Sbjct: 1   MQLQINNIQCVASWYWDVPKELK-RDSPVYEDEDEEDVCGICRGSYNGTCPNCKLPGETC 59

Query: 61  PLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQW 120
           PL+VG C+HNFHVHCIY+WL+T+TS+GLCPMCRQ F L++G+ IN+    KF+++  K  
Sbjct: 60  PLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLREGIRINEPHRDKFEKVLMK-- 117

Query: 121 QTRQQEFGDQQDPETNPL-EDQDDPMMDQGLI 151
             RQQ          NP+  DQDD ++DQ  I
Sbjct: 118 -ARQQSVVSVAG--ANPVGPDQDDVIIDQEFI 146

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score =  154 bits (389), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 93/127 (73%), Gaps = 2/127 (1%)

Query: 1   MKVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGC 60
           M+++L EVH VF W W IPK ++D   E++ D D +DVCGICRASY+A CP C++PG+ C
Sbjct: 1   MRIELTEVHGVFNWVWDIPK-NEDRLDESMADED-EDVCGICRASYHAPCPNCRYPGESC 58

Query: 61  PLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQW 120
            +V+G C HNFHVHCI RW+DT TS+GLCPMCRQ FQL +   IN+  I  F+E+  K++
Sbjct: 59  AIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCRQKFQLLQRTKINEPHIPLFKEIEIKRY 118

Query: 121 QTRQQEF 127
           +  Q+E 
Sbjct: 119 RQLQEEI 125

>TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON}
           Anc_3.190 YDL008W
          Length = 184

 Score =  153 bits (387), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 102/154 (66%), Gaps = 11/154 (7%)

Query: 1   MKVKLREVHSVFAWTWHIPKES---QDAHAET-IDDNDG-------DDVCGICRASYNAT 49
           MK++++ ++ VFAW W IP ++   Q+   E  ID + G       +DVCGICR +YN T
Sbjct: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60

Query: 50  CPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQI 109
           CP CK PG  CPLVVG C HNFHVHCIY+WLDT TS+GLCPMCRQ F+LK+G+A+N SQ 
Sbjct: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120

Query: 110 SKFQELRNKQWQTRQQEFGDQQDPETNPLEDQDD 143
             F+ L  KQ + R   F +  D + +   +++D
Sbjct: 121 DVFKSLELKQARQRFGAFDEDVDVDLSGFINEED 154

>Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON}
           similar to Ashbya gossypii AER016C
          Length = 148

 Score =  151 bits (382), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 100/152 (65%), Gaps = 6/152 (3%)

Query: 1   MKVKLREVHSVFAWTWHIPKE-SQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDG 59
           M+++++ V  V +W W +PKE  +D H     D D +DVCGICRASYN TCP CK PG+ 
Sbjct: 1   MQLQIKNVQCVASWYWDVPKELKRDLHEGE--DEDDEDVCGICRASYNGTCPNCKLPGET 58

Query: 60  CPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQ 119
           CPL+VG C+HNFHVHCIY+WL+T+TS+GLCPMCRQ F L+ G+ IN+    KF+++  K 
Sbjct: 59  CPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMK- 117

Query: 120 WQTRQQEFGDQQDPETNPLEDQDDPMMDQGLI 151
              RQQ              DQ+D M+DQ  I
Sbjct: 118 --ARQQNVVSVSGVNAAGGVDQEDVMIDQEFI 147

>KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.190
           YDL008W
          Length = 173

 Score =  152 bits (383), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 94/145 (64%), Gaps = 5/145 (3%)

Query: 1   MKVKLREVHSVFAWTWHIP--KESQDAHAETIDD---NDGDDVCGICRASYNATCPGCKF 55
           MKV +++++ V+AW+W I   K  Q +   ++ D   ++ DDVCGICRASYN TCP CK 
Sbjct: 1   MKVTVKKIYPVYAWSWDIVTRKGEQKSDVYSVLDKYRSEKDDVCGICRASYNGTCPSCKI 60

Query: 56  PGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQEL 115
           PG  CPL+VG CNHNFH HCI+RWL+T  S+GLCPMCRQ F+L K L IN   + KF+ L
Sbjct: 61  PGTMCPLIVGSCNHNFHYHCIFRWLNTLNSKGLCPMCRQEFKLDKKLVINSDYLQKFEVL 120

Query: 116 RNKQWQTRQQEFGDQQDPETNPLED 140
             K  + R     ++ +   N + D
Sbjct: 121 ARKNRERRALNVDEEDNGIDNMIID 145

>TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.190
           YDL008W
          Length = 180

 Score =  150 bits (378), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 104/181 (57%), Gaps = 29/181 (16%)

Query: 1   MKVKLREVHSVFAWTWHIPKESQ----DAHAETIDDNDGD-------------DVCGICR 43
           MKV+++ V+ VFAW W IPK  Q    D +   +  +D D             D CGICR
Sbjct: 1   MKVQIKNVNGVFAWGWQIPKHDQKVKKDHNNSIVSGSDVDHQEQNSDDEDDEEDFCGICR 60

Query: 44  ASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLA 103
           AS+   CP CKFP DGCP+V+G+C HNFHVHCI+ WL+T  SRGLCPMCRQ F+L+KG+ 
Sbjct: 61  ASFIRACPNCKFPSDGCPIVIGKCKHNFHVHCIFEWLETEASRGLCPMCRQVFELRKGVV 120

Query: 104 INDSQISKFQELRNKQWQTRQQEFGDQQD-----------PETNPLEDQDDPMMDQGLIV 152
           IND     F+EL  K+ Q  Q EF    +            E N  +   D ++DQ ++V
Sbjct: 121 INDLHYVTFKELILKR-QKEQNEFEATAEDDEALARMIAAQEGNNGDVPVDDILDQDMVV 179

Query: 153 R 153
           R
Sbjct: 180 R 180

>NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3.190
           YDL008W
          Length = 206

 Score =  147 bits (370), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 84/129 (65%), Gaps = 14/129 (10%)

Query: 1   MKVKLREVHSVFAWTWHIPKESQDAHAETIDD--------------NDGDDVCGICRASY 46
           MK++++ ++ + AW+W +PK   D  ++  D+              N  DDVCGICRASY
Sbjct: 1   MKIEVQNIYPLVAWSWDMPKNLDDPDSDEPDNANDSYGIRRRAPNKNAVDDVCGICRASY 60

Query: 47  NATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAIND 106
           N TCP CKFPG  CPLV+G CNHNFH HCIY+WL T TS+GLCPMCRQ F+LK    +N 
Sbjct: 61  NGTCPNCKFPGTDCPLVLGRCNHNFHFHCIYQWLKTLTSKGLCPMCRQKFRLKPNATVNT 120

Query: 107 SQISKFQEL 115
             +  F+EL
Sbjct: 121 DHLGAFKEL 129

>KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {ON}
           Anc_3.190 YDL008W
          Length = 202

 Score =  143 bits (361), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 90/151 (59%), Gaps = 24/151 (15%)

Query: 1   MKVKLREVHSVFAWTW------------------HIPKESQDAHAETIDDNDGD---DVC 39
           MK+ ++ V+ VF W+W                  + P + + AH E  +  DGD   DVC
Sbjct: 1   MKLDIKRVNPVFTWSWDTRDPAAAKDRQYPFLYNYYPVDVEKAHLENGNAVDGDEDEDVC 60

Query: 40  GICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLK 99
           GICRASYN TCP CK PGD CPLV G C+H+FH HCI+RWLDT TS+GLCPMCRQ FQL 
Sbjct: 61  GICRASYNGTCPSCKIPGDSCPLVAGLCHHHFHYHCIFRWLDTNTSKGLCPMCRQQFQLN 120

Query: 100 KGLAINDSQISKFQELRNKQWQTRQQEFGDQ 130
             L IN   + KF+ +       R++ F D+
Sbjct: 121 SKLPINRPYLEKFESITKA---IRERVFLDE 148

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score =  125 bits (314), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 71/171 (41%), Positives = 92/171 (53%), Gaps = 30/171 (17%)

Query: 1   MKVKLREVHSVFAWTWHIPKE---------SQDAHAETIDD-----------NDGDDVCG 40
           M++++ +V  V  W W IPK+          Q  H E  +D            +  +VCG
Sbjct: 1   MRIEVTDVSLVSTWAWDIPKDLSKGKHGVADQTVHMEKWEDIQNEDEDAENDEEEYEVCG 60

Query: 41  ICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
           ICR  Y+ATCP C +PG GCP+V+G CNHNFHVHCI +WL T TS+GLCP+CRQ FQL+ 
Sbjct: 61  ICRNRYDATCPSCDYPGSGCPIVLGLCNHNFHVHCIKQWLSTETSKGLCPLCRQGFQLRP 120

Query: 101 GLAINDSQISKFQELRNKQWQTRQQEFGDQQDPETNPLEDQDDPMMDQGLI 151
            + IN     +FQ+L       RQ        P      DQD  +MD G I
Sbjct: 121 NVLINKMHHDEFQKLL---MSVRQHNI-----PMGGGEIDQD--VMDDGFI 161

>NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.190
           YDL008W
          Length = 128

 Score =  114 bits (286), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 73/122 (59%), Gaps = 7/122 (5%)

Query: 1   MKVKLREVHSVFAWTWHIPKESQD-------AHAETIDDNDGDDVCGICRASYNATCPGC 53
           MK+++REV+ VF W+W I  E++           E  DD+D D+VCGICRA YNA CP C
Sbjct: 1   MKLEVREVYPVFEWSWDITSETEQQQNHEPEEQPEDDDDDDDDEVCGICRAGYNAVCPSC 60

Query: 54  KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQ 113
             PG  CP+VVG C H FHVHC+  WL TA +RG CPMCRQ F L     +N        
Sbjct: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVNRGATVTLP 120

Query: 114 EL 115
           +L
Sbjct: 121 QL 122

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 49.7 bits (117), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 45/104 (43%), Gaps = 24/104 (23%)

Query: 2   KVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPG---- 57
           + ++++  +V  W+W I  E+                C ICR      C  C+       
Sbjct: 23  RFEVKKWTAVAFWSWDIAVEN----------------CAICRNHIMEPCIQCQPTAMTDT 66

Query: 58  -DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
            + C    G CNH FH+HCI +WL T   R  CP+  QT+Q  K
Sbjct: 67  DNECVAAWGACNHAFHLHCINKWLQT---RNACPLDNQTWQFAK 107

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 15/78 (19%)

Query: 34  DGDDVCGICRASYNATCPGCKFPGDGCPLVVG--ECNHNFHVHCIYRWLDTATSRGLCPM 91
           + D++C ICR         CKF  D  PL++    C H F + CI  WL   +S   CP+
Sbjct: 110 NKDEICSICR---------CKFFDDDYPLIIELPNCKHYFDLECITLWLQKNSS---CPI 157

Query: 92  CRQTFQLKKGLAINDSQI 109
           CR    L+K   I+DSQ+
Sbjct: 158 CRNDV-LEKKFKIDDSQV 174

>Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to
           Ashbya gossypii ADL181W
          Length = 114

 Score = 48.9 bits (115), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 45/104 (43%), Gaps = 24/104 (23%)

Query: 2   KVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPG---- 57
           K ++++  +V  W+W I  E+                C ICR      C  C+       
Sbjct: 27  KFQIKKWTAVAFWSWDIAVEN----------------CAICRNHIMEPCIQCQPNAMTDT 70

Query: 58  -DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
            + C    G CNH FH+HCI +WL T   R  CP+  +T+Q  K
Sbjct: 71  DNECVAAWGTCNHAFHLHCINKWLLT---RNACPLDNKTWQFAK 111

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 47.0 bits (110), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 44/104 (42%), Gaps = 24/104 (23%)

Query: 2   KVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPG---- 57
           K ++++  +V  W+W I                  D C ICR      C  C+       
Sbjct: 22  KFEIKKWTAVAFWSWDI----------------AVDNCAICRNHIMEPCIECQPKAMTDT 65

Query: 58  -DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
            + C    G CNH FH+HCI +W+ T   R  CP+  Q +QL +
Sbjct: 66  DNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWQLAR 106

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 46.2 bits (108), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 43/104 (41%), Gaps = 24/104 (23%)

Query: 2   KVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPG---- 57
           K ++++  +V  W+W I  E+                C ICR      C  C+       
Sbjct: 24  KFEVKKWTAVAFWSWDIAVEN----------------CAICRNHIMEPCIQCQPTAMTDT 67

Query: 58  -DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
            + C    G CNH FH+HCI +WL T   R  CP+  Q +   K
Sbjct: 68  DNECVAAWGTCNHAFHLHCINKWLQT---RNACPLDNQPWSFAK 108

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 37  DVCGICRASYNATCPGCKF-----PGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPM 91
           D C ICR      C  C+      P + C    G CNH FH+HCI +W+ T   R  CP+
Sbjct: 50  DNCAICRNHIMEPCIECQPKAMTDPDNECVAAWGVCNHAFHLHCINKWIKT---RDACPL 106

Query: 92  CRQTFQLKK 100
             Q +QL +
Sbjct: 107 DNQPWQLAR 115

>ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL133W (HRT1)
          Length = 108

 Score = 46.2 bits (108), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 45/104 (43%), Gaps = 24/104 (23%)

Query: 2   KVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPG---- 57
           K ++++  +V  W+W I  E+                C ICR      C  C+       
Sbjct: 21  KFQIKKWIAVAFWSWDIAVEN----------------CAICRNHIMEPCIQCQPNAMTDT 64

Query: 58  -DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
            + C    G CNH FH+HCI +WL T   R  CP+  +T+Q  K
Sbjct: 65  ENECVAAWGTCNHAFHLHCINKWLLT---RNACPLDNKTWQFAK 105

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 39/96 (40%), Gaps = 24/96 (25%)

Query: 10  SVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPG-----DGCPLVV 64
           +V  W+W I  E+                C ICR      C  C+        + C    
Sbjct: 59  AVAFWSWDIAVEN----------------CAICRNHIMEPCIQCQPTAMTDTDNECVAAW 102

Query: 65  GECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
           G CNH FH+HCI +WL T   R  CP+  Q +Q  K
Sbjct: 103 GTCNHAFHLHCINKWLQT---RNACPLDNQPWQFAK 135

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 44/104 (42%), Gaps = 24/104 (23%)

Query: 2   KVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPG---- 57
           + ++++  +V  W+W I                  D C ICR      C  C+       
Sbjct: 36  RFEIKKWTAVAFWSWDI----------------AVDNCAICRNHIMEPCIECQPKAMTDT 79

Query: 58  -DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
            + C    G CNH FH+HCI +W+ T   R  CP+  Q +QL +
Sbjct: 80  DNECVAAWGVCNHAFHLHCINKWIQT---RDACPLDNQPWQLAR 120

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 44/104 (42%), Gaps = 24/104 (23%)

Query: 2   KVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPG---- 57
           + ++++  +V  W+W I                  D C ICR      C  C+       
Sbjct: 34  RFEIKKWTAVAFWSWDI----------------AVDNCAICRNHIMEPCIECQPKAMTDT 77

Query: 58  -DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
            + C    G CNH FH+HCI +W+ T   R  CP+  Q +QL +
Sbjct: 78  DNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQLAR 118

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 44/104 (42%), Gaps = 24/104 (23%)

Query: 2   KVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPG---- 57
           + ++++  +V  W+W I                  D C ICR      C  C+       
Sbjct: 35  RFEIKKWTAVAFWSWDI----------------AVDNCAICRNHIMEPCIECQPKAMTDT 78

Query: 58  -DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
            + C    G CNH FH+HCI +W+ T   R  CP+  Q +QL +
Sbjct: 79  DNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQLAR 119

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 33/69 (47%), Gaps = 8/69 (11%)

Query: 37  DVCGICRASYNATCPGCKFPG-----DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPM 91
           D C ICR      C  C+        + C    G CNH FH+HCI +W+ T   R  CP+
Sbjct: 53  DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPL 109

Query: 92  CRQTFQLKK 100
             Q +QL +
Sbjct: 110 DNQPWQLAR 118

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 45.4 bits (106), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 44/104 (42%), Gaps = 24/104 (23%)

Query: 2   KVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPG---- 57
           + ++++  +V  W+W I                  D C ICR      C  C+       
Sbjct: 34  RFEIKKWTAVAFWSWDI----------------AVDNCAICRNHIMEPCIECQPKAMTDT 77

Query: 58  -DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
            + C    G CNH FH+HCI +W+ T   R  CP+  Q +QL +
Sbjct: 78  DNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQLAR 118

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 45.4 bits (106), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 44/104 (42%), Gaps = 24/104 (23%)

Query: 2   KVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPG---- 57
           K ++++  +V  W+W I                  D C ICR      C  C+       
Sbjct: 29  KFEIKKWTAVAFWSWDI----------------AVDNCAICRNHIMEPCIECQPMAMTDT 72

Query: 58  -DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
            + C    G CNH FH+HCI +W+ T   R  CP+  Q +QL +
Sbjct: 73  DNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDNQPWQLAR 113

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 45.1 bits (105), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 33/69 (47%), Gaps = 8/69 (11%)

Query: 37  DVCGICRASYNATCPGCKFPG-----DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPM 91
           D C ICR      C  C+        + C    G CNH FH+HCI +W+ T   R  CP+
Sbjct: 39  DNCAICRNHIMEPCIECQPNAMTETDNECVAAWGTCNHAFHLHCINKWIKT---RDACPL 95

Query: 92  CRQTFQLKK 100
             Q +QL +
Sbjct: 96  DNQPWQLAR 104

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 45.1 bits (105), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 36/69 (52%), Gaps = 8/69 (11%)

Query: 37  DVCGICRASYNATCPGCK----FPGDG-CPLVVGECNHNFHVHCIYRWLDTATSRGLCPM 91
           D C ICR      C  C+    F  +  C    GECNH FH+HCI +W+    SR +CP+
Sbjct: 42  DNCAICRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIK---SRNVCPL 98

Query: 92  CRQTFQLKK 100
             + ++L +
Sbjct: 99  DNKPWKLAR 107

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 43.9 bits (102), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 43/104 (41%), Gaps = 24/104 (23%)

Query: 2   KVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPG---- 57
           K ++++  +V  W+W I                  D C ICR      C  C+       
Sbjct: 15  KFQIKKWTAVAFWSWDI----------------AVDNCAICRNHIMEPCIECQPKAMTDT 58

Query: 58  -DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
            + C    G CNH FH+HCI +W+ T   R  CP+  Q + L +
Sbjct: 59  DNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDNQPWHLAR 99

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC ++ +A     K P   CP     CN+ FH  C+Y+W   +++   CP+CR 
Sbjct: 1533 GFEECAICYSTLHAV--DRKLPTKVCP----TCNNKFHGSCLYKWF-RSSNNNTCPLCRS 1585

Query: 95   TFQLKK 100
               L++
Sbjct: 1586 EIALRR 1591

>KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1518

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC    +A     K P   CP     CN+ FH  C+Y+W  + +    CP+CR 
Sbjct: 1460 GFEECAICYYVLHAI--DRKLPTKVCP----TCNNRFHGACLYKWFKS-SGNNTCPLCRG 1512

Query: 95   TFQLKK 100
             F L+K
Sbjct: 1513 EFNLRK 1518

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 43/104 (41%), Gaps = 24/104 (23%)

Query: 2   KVKLREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPG---- 57
           K ++++  +V  W+W I                  D C ICR      C  C+       
Sbjct: 27  KFQIKKWTAVAFWSWDI----------------AVDNCAICRNHIMEPCIECQPKAMTDT 70

Query: 58  -DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
            + C    G C H FH+HCI +W+ T   R  CP+  Q +QL +
Sbjct: 71  DNECVAAWGACGHAFHLHCINKWIKT---RDACPLDNQPWQLAR 111

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 37  DVCGICRASYNATCPGCKFPG-----DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPM 91
           D C ICR      C  C+          C    G CNH FH+HCI +W+ T   R  CP+
Sbjct: 54  DNCAICRNHIMEPCIECQPKAMTDTDTDCVAAWGTCNHAFHLHCINKWIKT---REACPL 110

Query: 92  CRQTFQLKK 100
             Q +QL +
Sbjct: 111 DNQPWQLAR 119

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 37  DVCGICRASYNATCPGCKFPG-----DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPM 91
           D C ICR      C  C+        + C    G CNH FH+HCI +W+ T   R  CP+
Sbjct: 50  DNCAICRNHIMEPCIECQPLAMTDTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPL 106

Query: 92  CRQTFQLKK 100
             Q + L +
Sbjct: 107 DNQPWHLAR 115

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 33/69 (47%), Gaps = 8/69 (11%)

Query: 37  DVCGICRASYNATCPGCKFPG-----DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPM 91
           D C ICR      C  C+        + C +    CNH FH+HCI +W+ T   R  CP+
Sbjct: 43  DNCAICRNHIMEPCIECQPMAMTETDNECVVAWAACNHAFHLHCINKWIKT---RDACPL 99

Query: 92  CRQTFQLKK 100
             Q +QL +
Sbjct: 100 DNQPWQLAR 108

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 36/76 (47%), Gaps = 15/76 (19%)

Query: 35  GDDVCGICRASYNATCPGCKFPGDGCPLV--VGECNHNFHVHCIYRWLDTATSRGLCPMC 92
            +D C IC+         C F  D  PLV  V  CNH F + C+  WL    +   CPMC
Sbjct: 67  AEDTCAICQ---------CNFLDDPYPLVAKVPRCNHKFDLECLSIWLQNNHT---CPMC 114

Query: 93  RQTFQLKKGLAINDSQ 108
           R   + KK + I+ SQ
Sbjct: 115 RDDLRSKK-VEIDTSQ 129

>TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8.799
            YMR247C
          Length = 1559

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   CP     CN+ FH  C+Y+W   ++    CP+CR 
Sbjct: 1501 GFEECAICYSILHAV--DRKLPTKTCP----TCNNKFHGACLYKWF-RSSGNNTCPLCRS 1553

Query: 95   TFQLKK 100
                +K
Sbjct: 1554 EIPFRK 1559

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 42.4 bits (98), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 9/72 (12%)

Query: 47  NATCP--GCKFPGDGCPLVVG--ECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           N  CP   CKF  D  PL+V    CNH F + CI  WL  + +   CP+CR    L+  L
Sbjct: 46  NDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVT---CPLCRDNV-LEHKL 101

Query: 103 AINDSQISKFQE 114
            I+ S+ ++F+E
Sbjct: 102 NIDTSK-TEFEE 112

>TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8.799
            YMR247C
          Length = 1568

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   CP     CN+ +H  C+Y+W   ++    CPMCR 
Sbjct: 1510 GFEECAICYSILHAV--DRKLPSKTCP----TCNNKYHGACLYKWF-RSSGNNTCPMCRS 1562

Query: 95   TFQLKK 100
                ++
Sbjct: 1563 EIPFRR 1568

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 14/60 (23%)

Query: 36  DDVCGICRASYNATCPGCKFPGDGCPLVVG--ECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           DD C IC          C +  D  PLVV    CNH F + CI  WL  +++   CPMCR
Sbjct: 87  DDTCAIC---------CCVYLEDSYPLVVKLPNCNHKFDLQCITLWLSKSST---CPMCR 134

>SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1557

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 7/59 (11%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
            G + C IC +  +A     K P   CP     CN+ FH  C+Y+W   ++    CPMCR
Sbjct: 1499 GFEECAICYSILHAV--DRKLPTKTCP----TCNNKFHGACLYKWF-RSSGNNTCPMCR 1550

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 43.1 bits (100), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 46/117 (39%), Gaps = 31/117 (26%)

Query: 29   TIDDNDGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGL 88
            TI D+ G +    C    +A   GC            +C H F   CIY WL T   R +
Sbjct: 1254 TIKDSIGQNKEFQCTICLDAITKGCML----------KCGHFFCEDCIYDWLQT---RTI 1300

Query: 89   CPMCRQ--------TFQLKKGLAINDSQISKFQELRNKQWQTRQQEFGDQQDPETNP 137
            CP+C+          F  K G    D+         NKQ   ++ E   +Q PET+P
Sbjct: 1301 CPICKHKASLDGNYNFTFKNGPLKTDA---------NKQMNEKENETKKEQ-PETSP 1347

>NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   CP     C + FH  C+Y+W  + +    CP+CR 
Sbjct: 1533 GFEECAICYSVLHAV--DRKLPTKTCP----TCKNKFHGACLYKWFKS-SGNNTCPLCRS 1585

Query: 95   TFQLKK 100
               L++
Sbjct: 1586 EIALRR 1591

>KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1550

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   CP     CN+ FH  C+Y+W   ++    CP+CR 
Sbjct: 1492 GFEECAICYSILHAV--DRKLPSKVCP----TCNNRFHGACLYKWF-RSSGNNTCPLCRS 1544

Query: 95   TFQLKK 100
                ++
Sbjct: 1545 EIPFRR 1550

>Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR247C
            - Hypothetical ORF [contig 20] FULL
          Length = 1574

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   CP     CN+ FH  C+Y+W   ++    CP+CR 
Sbjct: 1516 GFEECAICYSILHAV--DRKLPSKVCP----TCNNRFHGACLYKWF-RSSGNNTCPLCRS 1568

Query: 95   TFQLKK 100
                ++
Sbjct: 1569 EIPFRR 1574

>ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa]
            {ON} similar to uniprot|Q04781 Saccharomyces cerevisiae
            YMR247C Hypothetical ORF
          Length = 1555

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   CP     CN+ FH  C+Y+W   ++    CP+CR 
Sbjct: 1497 GFEECAICYSILHAV--DRKLPTKTCP----TCNNKFHGSCLYKWF-RSSGNNTCPLCRG 1549

Query: 95   TFQLKK 100
                ++
Sbjct: 1550 EIPFRR 1555

>Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON}
            (57636..62351) [4716 nt, 1572 aa]
          Length = 1571

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   CP     C + FH  C+Y+W   ++    CPMCR 
Sbjct: 1513 GFEECAICYSILHAV--DRKLPTKTCP----TCRNKFHGACLYKWF-RSSGNNTCPMCRS 1565

Query: 95   TFQLKK 100
               +++
Sbjct: 1566 EIAIRR 1571

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 32/70 (45%), Gaps = 7/70 (10%)

Query: 49  TCPGC--KFPGDGCPLVVG--ECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAI 104
           TCP C   F  D  PLVV    C H F   C+  WL   T+   CPMCR     KK L  
Sbjct: 103 TCPICCSNFIADEYPLVVELPHCGHKFDFECVSMWLTKNTT---CPMCRDDVTHKKELPE 159

Query: 105 NDSQISKFQE 114
            D+   + +E
Sbjct: 160 LDTSKVELEE 169

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 35/76 (46%), Gaps = 15/76 (19%)

Query: 36  DDVCGICRASYNATCPGCKFPGDGCPLV--VGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           DD C IC          C +  D  PLV  +  CNH F + CI  WL  +TS   CP+CR
Sbjct: 100 DDSCPIC---------CCTYKEDDHPLVAELPHCNHKFDLECISVWLSKSTS---CPLCR 147

Query: 94  QTFQLKKGLAINDSQI 109
                 K   I+ SQ+
Sbjct: 148 DDVMSHKP-GIDTSQV 162

>KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {ON}
            Anc_8.799 YMR247C
          Length = 1560

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   CP     C + FH  C+Y+W   ++    CP+CR 
Sbjct: 1502 GFEECAICYSILHAI--DRKLPSKTCP----TCKNRFHGACLYKWF-RSSGNNTCPLCRS 1554

Query: 95   TFQLKK 100
                +K
Sbjct: 1555 EIPFRK 1560

>Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] {ON}
            YMR247C (REAL)
          Length = 1559

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   CP     C + FH  C+Y+W   ++    CP+CR 
Sbjct: 1501 GFEECAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRS 1553

Query: 95   TFQLKK 100
                ++
Sbjct: 1554 EIPFRR 1559

>YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}
            RKR1RING domain E3 ubiquitin ligase; involved in the
            ubiquitin-mediated degradation of non-stop proteins;
            functional connections to chromatin modification; nuclear
            protein that also co-localizes with ribosomes; homolog of
            mouse Listerin, whose mutation has been reported to cause
            neurodegeneration in mice
          Length = 1562

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   CP     C + FH  C+Y+W   ++    CP+CR 
Sbjct: 1504 GFEECAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRS 1556

Query: 95   TFQLKK 100
                ++
Sbjct: 1557 EIPFRR 1562

>Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] {ON}
            YMR247C (REAL)
          Length = 1564

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   CP     C + FH  C+Y+W   ++    CP+CR 
Sbjct: 1506 GFEECAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRS 1558

Query: 95   TFQLKK 100
                ++
Sbjct: 1559 EIPFRR 1564

>Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] {ON}
            YMR247C (REAL)
          Length = 1566

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   CP     C + FH  C+Y+W   ++    CP+CR 
Sbjct: 1508 GFEECAICYSILHAV--DRKLPSKTCP----TCKNRFHGACLYKWF-RSSGNNTCPLCRS 1560

Query: 95   TFQLKK 100
                ++
Sbjct: 1561 EIPFRR 1566

>KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.799
            YMR247C
          Length = 1561

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   CP     C + FH  C+Y+W   ++    CP+CR 
Sbjct: 1503 GFEECAICYSILHAV--DRKLPNKTCP----TCKNRFHGACLYKWF-RSSGNNTCPLCRN 1555

Query: 95   TFQLKK 100
                ++
Sbjct: 1556 EIPFRR 1561

>NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8.799
            YMR247C
          Length = 1564

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   CP     C + FH  C+Y+W   ++    CP+CR 
Sbjct: 1506 GFEECAICYSILHAV--DRKLPTKTCP----TCKNKFHGACLYKWF-RSSGNNTCPLCRS 1558

Query: 95   TFQLKK 100
               L +
Sbjct: 1559 EIPLHR 1564

>Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar to
            Ashbya gossypii ABL058C
          Length = 1547

 Score = 40.4 bits (93), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 9/63 (14%)

Query: 39   CGICRASYNATCP-GCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQ 97
            C IC   Y+   P   K P   CP     CN+ FH  C+Y+W  ++ +   CP+CR    
Sbjct: 1493 CAIC---YSILHPVDRKLPTKVCP----TCNNRFHGACLYKWFRSSGNNS-CPLCRSEIP 1544

Query: 98   LKK 100
             ++
Sbjct: 1545 FRR 1547

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 39.7 bits (91), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR-QTFQLKKGLAIN 105
           +CP C  +       L+   C H FH  C+ +W ++      CP+CR  T ++ + L IN
Sbjct: 282 SCPVCLERMDSSITGLITIPCQHTFHCQCLNKWKNSK-----CPICRFSTLRISRDLVIN 336

Query: 106 DSQIS 110
             Q++
Sbjct: 337 KKQVN 341

>TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON}
           Anc_7.416 YER116C
          Length = 208

 Score = 38.5 bits (88), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 11/80 (13%)

Query: 43  RASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTA---TSRGLCPMCRQTFQLK 99
           +A  +  CP C  P +    V+  C H F V C+++ L+++      GLC +CR      
Sbjct: 132 KAVRDYQCPICFDPPENS--VITPCGHTFCVSCLFQMLNSSRGPKKNGLCALCR------ 183

Query: 100 KGLAINDSQISKFQELRNKQ 119
           K +AI D ++ K ++ R ++
Sbjct: 184 KSVAIRDIKMIKLKKKRVRK 203

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 33/71 (46%), Gaps = 16/71 (22%)

Query: 27  AETIDDNDGDDVCGICRASYNATCPGCKFPGDGCPLV--VGECNHNFHVHCIYRWLDTAT 84
           A +I D + +  C IC          CKF  D  PLV  +  C H F + CI  WL  + 
Sbjct: 94  ANSIKDKNAE--CAIC---------FCKFLEDKYPLVAELPHCGHRFDLECISVWLSKSD 142

Query: 85  SRGLCPMCRQT 95
           +   CP+CR +
Sbjct: 143 T---CPLCRDS 150

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 5/50 (10%)

Query: 53  CKFPGDGCPLVV--GECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKK 100
           C +  D  PLVV    C H F + C+  WL  +T+   CPMCR    ++K
Sbjct: 95  CGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT---CPMCRSDVLVRK 141

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 37.7 bits (86), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 12/69 (17%)

Query: 33  NDGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMC 92
           +D ++ C IC+  +N          +   + V  C+H FH HCI RW+    +   CP+C
Sbjct: 104 SDEEESCVICQEQFN----------ELNNIRVLGCSHIFHSHCIDRWI--CRNSACCPLC 151

Query: 93  RQTFQLKKG 101
           ++++ L  G
Sbjct: 152 KRSYSLPVG 160

>AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL010C
          Length = 506

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQT 95
           TCP C  +   D   L+   C H FH  C+ +W D     G CP+CR +
Sbjct: 211 TCPVCLERMDSDTTGLITTACQHTFHCQCLDKWKD-----GRCPVCRYS 254

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 12/67 (17%)

Query: 34  DGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           D    C IC+  +N     C         ++G CNH FH +CI +W+    +   CP+C+
Sbjct: 115 DSRTTCAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNSACCPLCK 162

Query: 94  QTFQLKK 100
           +++ L +
Sbjct: 163 RSYSLPR 169

>ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR247C
          Length = 1546

 Score = 38.1 bits (87), Expect = 0.005,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 39   CGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQL 98
            C IC +  +      K P   CP     C++ FH  C+Y+W  + +    CP+CR     
Sbjct: 1492 CAICYSILHVV--DRKLPSKVCP----TCSNRFHGACLYKWFKS-SGNNTCPLCRGEIPF 1544

Query: 99   KK 100
            ++
Sbjct: 1545 RR 1546

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 14/87 (16%)

Query: 24  DAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGCPLVV--GECNHNFHVHCIYRWLD 81
           D+      D   +D+C IC  +         F  D  PLV+    C+H F + CI  WL 
Sbjct: 72  DSLPRVPKDKIPNDLCSICFEN---------FREDEYPLVIELPHCSHKFDLQCISVWL- 121

Query: 82  TATSRGLCPMCRQTFQLKKGLAINDSQ 108
             +S   CP+CR        L I+ ++
Sbjct: 122 --SSNSTCPVCRDKVNHNAKLDIDTTE 146

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score = 37.7 bits (86), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 12/84 (14%)

Query: 16  WHIPKESQDAHAETIDDND-----GD-DVCGICRASYNATCPGCKFPGDGCPLVVGECNH 69
           W   K S+   A  +D  D     G+ D+C +C   +    P  +   DG  + +  C H
Sbjct: 324 WKNWKSSKSLDASLMDATDIQIESGEIDICIVCMEDF---LPSHQRKSDGKKVKILPCTH 380

Query: 70  NFHVHCIYRWLDTATSRGLCPMCR 93
             H+ C+  W+  + +   CP+CR
Sbjct: 381 ALHLSCLKNWIARSPT---CPICR 401

>CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247c
          Length = 1544

 Score = 38.1 bits (87), Expect = 0.006,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 7/66 (10%)

Query: 35   GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
            G + C IC +  +A     K P   C      C + FH  C+Y+W   ++    CP+CR 
Sbjct: 1486 GFEECAICYSILHAV--DRKLPTKTC----STCKNKFHGACLYKWF-RSSGNNTCPLCRS 1538

Query: 95   TFQLKK 100
                ++
Sbjct: 1539 EINFRR 1544

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 37.0 bits (84), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 14/59 (23%)

Query: 37  DVCGICRASYNATCPGCKFPGDGCPLVVG--ECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           D C IC  +Y           D  PLVV    CNH F + C+  WL  +T+   CP+CR
Sbjct: 105 DNCSICYTNYLE---------DEYPLVVELPHCNHRFDLECLSVWLSRSTT---CPLCR 151

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 36.2 bits (82), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 5/41 (12%)

Query: 55  FPGDGCPLVV--GECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           +  DG PLVV    C H+F + C+  W   +TS   CP+CR
Sbjct: 82  YLNDGYPLVVRLPHCGHDFDLECLSVWFSKSTS---CPLCR 119

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 37.0 bits (84), Expect = 0.013,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 31/73 (42%), Gaps = 4/73 (5%)

Query: 21   ESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWL 80
            E+Q A+ + I D  G   C  C+   N+ C  C+ P     +V+  C H  H  CI  W 
Sbjct: 1260 EAQQANNKKIMDKFGYWYCDSCKKR-NSLCVLCERPLKKLTMVLLPCGHEGHFQCIQEWF 1318

Query: 81   DTATSR---GLCP 90
                 R   G CP
Sbjct: 1319 LNEKERECPGGCP 1331

>TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.157
           YHR115C
          Length = 885

 Score = 36.6 bits (83), Expect = 0.016,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 11/62 (17%)

Query: 34  DGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           +GDD C IC +        C+       + +  C+H++H HCI R +     + +CP CR
Sbjct: 765 EGDD-CSICLSKIKP----CQ------AIFISPCSHSWHFHCIRRLVMLQYPQFVCPNCR 813

Query: 94  QT 95
            T
Sbjct: 814 ST 815

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score = 36.2 bits (82), Expect = 0.017,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 54/134 (40%), Gaps = 26/134 (19%)

Query: 15  TWHIPKESQDAHAETIDD--NDGDDVCGIC-------RASYNATCPGCKFPGDGCPLVVG 65
           TW   K+  +   +  ++  N G+++C +C         + NA     K P         
Sbjct: 286 TWKNAKKLDEKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLKPKKLP--------- 336

Query: 66  ECNHNFHVHCIYRWLDTATSRGLCPMCR-QTFQLKKGLAINDSQISKFQELRNKQWQTRQ 124
            C H  H+ C+  W++ + +   CP+CR   F  +  +   DS   + Q   N Q   RQ
Sbjct: 337 -CGHILHLSCLKSWMERSQT---CPICRLPVFDERGNVTRMDSSSQEQQLPHNLQ---RQ 389

Query: 125 QEFGDQQDPETNPL 138
           +  G+     T+P 
Sbjct: 390 EAEGEVVQMTTSPF 403

>Kpol_1023.32 s1023 complement(68737..72273) [3537 bp, 1178 aa] {ON}
           complement(68737..72273) [3537 nt, 1179 aa]
          Length = 1178

 Score = 36.2 bits (82), Expect = 0.021,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 4/64 (6%)

Query: 50  CPGCKF-PGDGCPLVVGECNHNFHVHCIYRWLDTATSRGL---CPMCRQTFQLKKGLAIN 105
           CP C   P D   ++  EC H F   C+  + D    + L   CP CRQ     + L +N
Sbjct: 925 CPICTTEPIDANNIIFTECGHCFCESCLQEYFDFQVQKKLETKCPNCRQIISTNRVLKLN 984

Query: 106 DSQI 109
              +
Sbjct: 985 HDTV 988

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 35.4 bits (80), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 14/64 (21%)

Query: 32  DNDGDDVCGICRASYNATCPGCKFPGDGCPLVVG--ECNHNFHVHCIYRWLDTATSRGLC 89
           D  G D C IC          C +  D  PLVV    C+H F + C+  WL  + +   C
Sbjct: 76  DLKGADACSIC---------CCGYLDDTHPLVVKLPHCSHRFDLECVAVWLSKSRT---C 123

Query: 90  PMCR 93
           P+CR
Sbjct: 124 PLCR 127

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON}
          similar to uniprot|Q06834 Saccharomyces cerevisiae
          YPR093C ASR1 Protein involved in a putative alcohol-
          responsive signaling pathway accumulates in the nucleus
          under alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 35.8 bits (81), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 11/58 (18%)

Query: 37 DVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
          ++CGIC  S N T  G   P          C H +HV CI +W    ++   CP CR+
Sbjct: 3  EICGICLESMNETDQGELLP----------CEHRYHVSCIRKW-HLYSNDFKCPTCRK 49

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa]
          {ON} Anc_3.405 YPR093C
          Length = 102

 Score = 34.3 bits (77), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 67 CNHNFHVHCIYRWLDTATS---RGLCPMCRQ 94
          C+H FH  CI +W  T T    R LCP CR+
Sbjct: 29 CHHKFHSDCIRKWHTTTTGEIRRPLCPFCRE 59

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa]
          {ON} YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 34.3 bits (77), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 5/43 (11%)

Query: 53 CKFPGDGCPLVVG--ECNHNFHVHCIYRWLDTATSRGLCPMCR 93
          C +  D  PLVV    CNH F + C+  WL  + +   CP+CR
Sbjct: 40 CNYRDDKYPLVVELPHCNHRFDLECVAVWLSKSRT---CPLCR 79

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 8/62 (12%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR-QTFQLKKGLAIN 105
           TCP C  +   D   L+   C H FH  C+ +W ++      CP+CR  + +L +   + 
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSK-----CPVCRYSSLRLSRDSLLR 287

Query: 106 DS 107
           D+
Sbjct: 288 DA 289

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 35.8 bits (81), Expect = 0.027,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 6/72 (8%)

Query: 60  CPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL--AINDSQISKFQELRN 117
           CP  +  C H F   CI++W     S   CP+CR      +GL  AINDS +   +  R 
Sbjct: 275 CPTEL-PCGHIFGRDCIFKWTKEHNS---CPICRSRIVEDEGLNHAINDSPVVMDEFDRQ 330

Query: 118 KQWQTRQQEFGD 129
              + RQ  +G+
Sbjct: 331 SFERIRQLIYGE 342

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 35.0 bits (79), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 14/59 (23%)

Query: 37  DVCGICRASYNATCPGCKFPGDGCPLVVG--ECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           D C IC  +Y           D  PLVV    C+H F + C+  WL  +T+   CP+CR
Sbjct: 107 DNCSICYTNYLE---------DEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 153

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 35.0 bits (79), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 14/59 (23%)

Query: 37  DVCGICRASYNATCPGCKFPGDGCPLVVG--ECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           D C IC  +Y           D  PLVV    C+H F + C+  WL  +T+   CP+CR
Sbjct: 112 DNCSICYTNYLE---------DEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 158

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 35.8 bits (81), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 8/59 (13%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR-QTFQLKKGLAI 104
           TCP C  +   D   L+   C H FH  C+ +W ++      CP+CR  + +L +  A+
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSR-----CPVCRYSSIRLSRNSAV 286

>SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032W RAD5
           Single-stranded DNA-dependent ATPase involved in
           postreplication repair contains RING finger domain
          Length = 1127

 Score = 35.8 bits (81), Expect = 0.031,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGL---CPMCRQTFQLKKGLAIND 106
           ++  EC H F  HC+  ++D  T + L   CP CR++   K+ L + +
Sbjct: 888 VIFTECAHAFCEHCLLEYIDFQTQKKLELKCPNCRESIDPKRLLTLKE 935

>TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {ON}
           Anc_2.157 YHR115C
          Length = 521

 Score = 35.8 bits (81), Expect = 0.031,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 24/41 (58%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           + +  C+H++H HCI R +  +  + +CP CR +  L+  L
Sbjct: 426 IFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRSSCDLEASL 466

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 35.8 bits (81), Expect = 0.031,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 49  TCPGCKFPGDG--CPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQT 95
           TCP C    D     L+   C+H FH  C+ +W ++      CP+CR T
Sbjct: 240 TCPVCLEKMDSLVTGLITIPCSHTFHCQCLDKWKNSK-----CPVCRHT 283

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 34.7 bits (78), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 28/59 (47%), Gaps = 14/59 (23%)

Query: 37  DVCGICRASYNATCPGCKFPGDGCPLVVG--ECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           D C IC  +Y           D  PLVV    C+H F + C+  WL  +T+   CP+CR
Sbjct: 77  DNCSICYTNYLE---------DKYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 123

>CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116w
          Length = 603

 Score = 35.4 bits (80), Expect = 0.034,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 25/47 (53%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQ 108
           + +  C H +H  C+ R +  A  + +CP CR T  L+  L  +DS+
Sbjct: 528 IFISPCAHTWHFRCVRRLVMLAYPQFVCPNCRSTCDLEASLDNSDSE 574

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 35.8 bits (81), Expect = 0.034,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 3/30 (10%)

Query: 66   ECNHNFHVHCIYRWLDTATSRGLCPMCRQT 95
            +C H F  HCI+ WL    ++ +CP+C++T
Sbjct: 1165 KCGHFFCKHCIFSWL---KNKSVCPICKKT 1191

>Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AGL079C
          Length = 532

 Score = 35.4 bits (80), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 7/49 (14%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQT 95
           TCP C  +   D   L+   C H FH  C+ +W       G CP+CR +
Sbjct: 234 TCPVCLERMDSDTTGLITTACQHTFHCQCLDQW-----KGGRCPVCRYS 277

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 35.0 bits (79), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 5/62 (8%)

Query: 41  ICRASYNATCPGCKFPGDGCPLV--VGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQL 98
           I  A  N +   CK+  D  PL+  +  C H+F   CI  WL   +    CP+CR     
Sbjct: 99  IKAAHLNCSICYCKYTDDDYPLIAQLPHCGHHFDFECISIWL---SKNETCPICRDNLTS 155

Query: 99  KK 100
            K
Sbjct: 156 HK 157

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 35.0 bits (79), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 22/66 (33%)

Query: 34  DGDDVCGICRASYN------ATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRG 87
           +  D C ICR +Y+       TC             +  C+H+FH  CI  WL       
Sbjct: 205 NSSDECPICRIAYSDDFETEITC-------------LPNCSHHFHFECIKLWLQ---KNS 248

Query: 88  LCPMCR 93
           LCP+CR
Sbjct: 249 LCPLCR 254

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 35.4 bits (80), Expect = 0.037,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 34/84 (40%), Gaps = 8/84 (9%)

Query: 13  AWTWHIPKESQDAHAETIDDNDGDDVCGICRAS---YNATCPGCKFPGDGCPLVVGECNH 69
            +++H P  SQ+       +N   D C IC +    Y    P      D    +V  CNH
Sbjct: 673 GYSYHKPVLSQELLEHGASENHTVD-CAICMSEVPVYVKDIPETH-AVDQQSYMVTPCNH 730

Query: 70  NFHVHCIYRWLDTATSRGLCPMCR 93
            FH  C+  W+        CP+CR
Sbjct: 731 IFHTACLENWMGYKLQ---CPVCR 751

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 12/65 (18%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAIND 106
           TCP C  +   +   L    C H FH  C+ +W D+      CP+CR +     GL +  
Sbjct: 246 TCPVCLERLDSEVTGLATIPCQHTFHCQCLNKWKDSR-----CPVCRYS-----GLKVTK 295

Query: 107 SQISK 111
           S + +
Sbjct: 296 SSLLR 300

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQT 95
           TCP C  +   +   LV   C H FH  C+ +W ++      CP+CR +
Sbjct: 239 TCPVCLERMDSETSGLVTIPCQHTFHCQCLNKWKNSR-----CPVCRHS 282

>KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.157
           YHR115C
          Length = 510

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQ 108
           + +  C+H++H HCI R +  +  + +CP CR +  L+  L   D +
Sbjct: 416 IFISPCSHSWHFHCIRRLVMVSYPQFVCPNCRASCDLEATLESEDGE 462

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQT 95
           TCP C  +   +   LV   C H FH  C+ +W ++      CP+CR +
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCRHS 282

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.0 bits (79), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQT 95
           TCP C  +   +   LV   C H FH  C+ +W ++      CP+CR +
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCRHS 282

>NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa]
           {ON} Anc_2.157 YHR115C
          Length = 521

 Score = 35.0 bits (79), Expect = 0.045,   Method: Composition-based stats.
 Identities = 22/107 (20%), Positives = 43/107 (40%), Gaps = 25/107 (23%)

Query: 1   MKVKLREVHSVFAWTWHIPKESQDAHAE--------TIDDNDGDDVCGICRASYNATCPG 52
           MK++L +       +W +PK     +A         + D+ +  D C +C +        
Sbjct: 306 MKIELND-------SWKLPKTQFSTNAFKNVKKVLFSGDEPNATDNCSLCLSKIT----- 353

Query: 53  CKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLK 99
                +G P+ +  C+H++H  C+   +        CP C+  F L+
Sbjct: 354 -----EGKPIFISPCSHHWHYKCVKDLITVEYPFFFCPTCKNQFDLE 395

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.0 bits (79), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQT 95
           TCP C  +   +   LV   C H FH  C+ +W ++      CP+CR +
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCRHS 282

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 8/55 (14%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR-QTFQLKK 100
           TCP C  +   +   L+   C H FH  C+ +W ++      CP+CR  +F+L +
Sbjct: 246 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSK-----CPVCRLSSFRLSR 295

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 8/56 (14%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQT-FQLKKG 101
           +CP C  +   D   L+   C H FH  C+ +W D+      CP+CR +  +L +G
Sbjct: 236 SCPVCLERMDSDITGLITIPCQHTFHCQCLDKWKDSR-----CPVCRYSNLKLTRG 286

>KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some
           similarities with uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 279

 Score = 34.7 bits (78), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 6/61 (9%)

Query: 43  RASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATS----RGLCPMCRQTFQL 98
           + + +  CP C  P +    +V +C H F   C+Y  ++++       GLC +CR+  +L
Sbjct: 205 KKAADYVCPICMEPPEAA--LVTKCGHVFCTTCLYGMVNSSKGNGRRNGLCALCRENVKL 262

Query: 99  K 99
           +
Sbjct: 263 Q 263

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 35.0 bits (79), Expect = 0.054,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 8/55 (14%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR-QTFQLKK 100
           TCP C  +   +   L+   C H FH  C+ +W ++      CP+CR  +F++ +
Sbjct: 240 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSQ-----CPVCRYSSFRISR 289

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 34.7 bits (78), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 8/63 (12%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR-QTFQLKKGLAIN 105
            CP C  +   +   L+   C H FH  C+ RW ++      CP+CR  +F+L +   + 
Sbjct: 170 ACPVCLERMDSETTGLITIPCQHTFHCQCLNRWKNSK-----CPVCRYSSFRLSRDTLMR 224

Query: 106 DSQ 108
            S+
Sbjct: 225 TSR 227

>Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}
           complement(48530..50287) [1758 nt, 586 aa]
          Length = 585

 Score = 34.7 bits (78), Expect = 0.063,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 22/37 (59%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQL 98
           + +  C+H++H HCI R +  +  + +CP CR +  L
Sbjct: 515 IFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRSSCDL 551

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 33.9 bits (76), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 26/59 (44%), Gaps = 14/59 (23%)

Query: 37  DVCGICRASYNATCPGCKFPGDGCPLVVG--ECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           D C IC + YN          D  PLVV    C+H F + C+  WL        CP+CR
Sbjct: 84  DECSICCSKYNE---------DDYPLVVELPHCSHRFDLECLTPWL---LKNSTCPLCR 130

>Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR231W
           (REAL)
          Length = 1028

 Score = 34.7 bits (78), Expect = 0.067,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 47  NATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATS-RGL--CPMC 92
           N TC  C    D  P+V  +C H +H HC+    DT  S R L  CP C
Sbjct: 923 NQTCFMCNLTLD-IPVVFFKCGHTYHQHCLNEEEDTLESERKLFKCPKC 970

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 33.9 bits (76), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 30/77 (38%), Gaps = 17/77 (22%)

Query: 37  DVCGICRASYNATCPGCKFPGDGCPLV--VGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
           D C IC           +F  D  PL+  +  C H F + CI  WL    +   CPMCR 
Sbjct: 90  DTCSICFE---------RFGNDNYPLLAQLPHCGHIFDLQCISMWLSNQVT---CPMCRD 137

Query: 95  TFQLKKGLAINDSQISK 111
                 G  + D   SK
Sbjct: 138 VV---NGHKVQDLDTSK 151

>NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.157
           YHR115C
          Length = 518

 Score = 34.7 bits (78), Expect = 0.072,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           + +  C H++H HCI R +  +  + +CP CR    L+  L
Sbjct: 442 IFISPCAHSWHFHCIRRLVMLSYPQFVCPNCRSACDLEAAL 482

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa]
          {ON} Anc_3.405 YPR093C
          Length = 555

 Score = 34.7 bits (78), Expect = 0.074,   Method: Composition-based stats.
 Identities = 15/29 (51%), Positives = 20/29 (68%), Gaps = 3/29 (10%)

Query: 67 CNHNFHVHCIYRWLDTATSRGL-CPMCRQ 94
          C HNFH +CI +W    TS+ L CP+CR+
Sbjct: 22 CQHNFHFNCIRQW--HLTSKSLECPVCRR 48

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 33.1 bits (74), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 27/67 (40%), Gaps = 14/67 (20%)

Query: 36  DDVCGICRASYNATCPGCKFPGDGCPLV--VGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           +D C IC          C +  D  PL+  +  C HNF   C+  WL   +    CPMCR
Sbjct: 31  NDSCSIC---------CCTYADDKYPLISKLPHCGHNFDYECLSIWL---SKNKTCPMCR 78

Query: 94  QTFQLKK 100
                 K
Sbjct: 79  DDITSHK 85

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 34.7 bits (78), Expect = 0.077,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 31/80 (38%), Gaps = 14/80 (17%)

Query: 17  HIPKESQDAHAETIDDNDGDDVCGICRAS---YNATCPGCKFPGDGCPLVVGECNHNFHV 73
           H+ +  Q +   T+D       C IC +    Y    P      D    +V  CNH FH 
Sbjct: 687 HLMEHGQTSEVNTVD-------CSICMSEIPVYVEELPETH-KVDQHSYMVTPCNHIFHT 738

Query: 74  HCIYRWLDTATSRGLCPMCR 93
            C+  W+        CP+CR
Sbjct: 739 SCLENWMSYKLQ---CPVCR 755

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQT 95
           TCP C  +   +   L+   C H FH  C+ +W D+      CP+CR +
Sbjct: 267 TCPVCLERMDSETTGLITIPCQHTFHCSCLDKWNDSR-----CPVCRYS 310

>KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {ON}
           Anc_2.157 YHR115C
          Length = 551

 Score = 34.7 bits (78), Expect = 0.077,   Method: Composition-based stats.
 Identities = 12/41 (29%), Positives = 23/41 (56%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           + +  C+H++H HC+ R +  +  + +CP CR    L+  L
Sbjct: 464 IFISPCSHSWHFHCVRRLVMLSYPQFVCPNCRSACDLEATL 504

>YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}
           PEP5Component of CORVET tethering complex; peripheral
           vacuolar membrane protein required for protein
           trafficking and vacuole biogenesis; interacts with Pep7p
          Length = 1029

 Score = 34.3 bits (77), Expect = 0.089,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 4/49 (8%)

Query: 47  NATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATS-RGL--CPMC 92
           N TC  C+   D  P+V  +C H +H HC+    DT  S R L  CP C
Sbjct: 925 NQTCFMCRLTLD-IPVVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKC 972

>KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {ON}
           some similarities with uniprot|P53924 Saccharomyces
           cerevisiae YNL116W DMA2 Protein involved in regulating
           spindle position and orientation functionally redundant
           with Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 479

 Score = 34.3 bits (77), Expect = 0.094,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAIN-DSQISKFQEL 115
           + +  C+H++H  C+ R + T   + +CP CR +  L+  L  + DS  + F+ L
Sbjct: 411 IFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLEASLDSDMDSDENDFEVL 465

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 34.3 bits (77), Expect = 0.098,   Method: Composition-based stats.
 Identities = 21/90 (23%), Positives = 35/90 (38%), Gaps = 25/90 (27%)

Query: 60   CPLVVGE--------CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISK 111
            CP+ +G+        C H F   CI+ WL    S   CPMC+ +              + 
Sbjct: 1154 CPICLGKITMGAIIKCGHFFCRSCIHSWLKNHNS---CPMCKTS--------------TS 1196

Query: 112  FQELRNKQWQTRQQEFGDQQDPETNPLEDQ 141
              E+ N ++Q    E  + Q+  +   E +
Sbjct: 1197 IMEVYNFKFQNDDAEVNEPQNESSQDFEKK 1226

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 34.3 bits (77), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 12/65 (18%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAIND 106
           TCP C  +   +   L    C H FH  C+ +W D       CP+CR +     GL +  
Sbjct: 226 TCPVCLERLDSEVTGLATIPCQHTFHCVCLNKWGDNR-----CPVCRYS-----GLKLTK 275

Query: 107 SQISK 111
           S +++
Sbjct: 276 SSLAR 280

>AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL054W (PSH1)
          Length = 414

 Score = 33.9 bits (76), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 60  CPLVVGECNHNFHVHCIYRWLDTATSRGL-CPMCRQTFQLKKGLAI 104
            P++ G C HN+   CI  WL+  +S  L CP CR +      L +
Sbjct: 47  VPVMTG-CGHNYCYFCISNWLNNTSSTELNCPQCRSSITSMPSLNV 91

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
          {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 9/60 (15%)

Query: 34 DGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
          +GD++C IC    N T        D     +  CNH +H  CI RW   + +   CP+CR
Sbjct: 7  EGDNICPICFDDLNDT--------DILQGKLKPCNHKYHYDCIRRWHGYSDNSD-CPLCR 57

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 33.9 bits (76), Expect = 0.12,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 29/73 (39%), Gaps = 4/73 (5%)

Query: 21   ESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWL 80
            E+Q    + I D  G   C  C+   N +C  C+ P     +V+  C H  H  CI  W 
Sbjct: 1265 EAQQTGNKKIMDKFGYWYCDSCKKK-NTSCVLCERPLKKLTMVILPCGHEGHFQCIQEWF 1323

Query: 81   ---DTATSRGLCP 90
               +     G CP
Sbjct: 1324 LDENEQECPGGCP 1336

>Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {ON}
           YNL116W - Hypothetical ORF [contig 204] FULL
          Length = 470

 Score = 33.9 bits (76), Expect = 0.12,   Method: Composition-based stats.
 Identities = 12/41 (29%), Positives = 23/41 (56%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           + +  C+H++H  C+ R + T   + +CP CR +  L+  L
Sbjct: 402 IFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLEASL 442

>SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q75BK4 Ashbya gossypii ACR267C
           ACR267Cp and some similarites with YNL116W
           uniprot|P53924 Saccharomyces cerevisiae YNL116W DMA2
           Protein involved in regulating spindle position and
           orientation functionally redundant with Dma1p homolog of
           S. pombe Dma1 and H. sapiens Chfr
          Length = 475

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 24/41 (58%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           + +  C+H++H  C+ R + T+  + +CP CR +  L+  L
Sbjct: 402 IFISPCSHSWHYQCVRRLVMTSYPQFVCPNCRSSCDLEASL 442

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score = 33.9 bits (76), Expect = 0.14,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 3/35 (8%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKG 101
           CNH  H+ C+  W++ + +   CP+CR     KKG
Sbjct: 341 CNHCLHLGCLKSWMERSQT---CPICRVPVFDKKG 372

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 8/52 (15%)

Query: 50  CPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLK 99
           CP C  K   +   LV   C H FH  C+ +W       G CP+CR + QLK
Sbjct: 215 CPVCLEKLDSEVTGLVTTPCQHTFHCKCLDQW-----KNGNCPVCRYS-QLK 260

>NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1393

 Score = 33.9 bits (76), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 23/60 (38%), Gaps = 1/60 (1%)

Query: 21   ESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWL 80
            E+Q  H +T+    G   C  CR   N+ C  C+ P     L    C H  H  C   W 
Sbjct: 1318 EAQQTHDKTVLGKFGYWYCDSCRKP-NSLCVICECPMKKLTLTALRCGHEAHFQCFKNWF 1376

>Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {ON}
           similar to Ashbya gossypii AGL217W
          Length = 386

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGL-CPMCRQTFQLKKGLAIN 105
           V+  C HN+  +CI  WL+   +  L CP CR T      L ++
Sbjct: 5   VMTSCGHNYCYYCISNWLNNNNATELNCPQCRTTIGAMPALNVS 48

>KNAG0C03410 Chr3 (669679..670338) [660 bp, 219 aa] {ON} Anc_7.416
           YER116C
          Length = 219

 Score = 33.1 bits (74), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 7/67 (10%)

Query: 50  CPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSR---GLCPMCRQTFQLK--KGLAI 104
           CP C  P D    +   C H F   C++  ++ + +R   GLC +CR     K  K + +
Sbjct: 153 CPICFDPPDVA--MAAPCGHVFCCECLFNMVNNSRNRGNFGLCALCRSKVDFKRCKMIIV 210

Query: 105 NDSQISK 111
             +++SK
Sbjct: 211 RKNKVSK 217

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 33.5 bits (75), Expect = 0.16,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 3/31 (9%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           +V  CNH FH  C+  W++       CP+CR
Sbjct: 725 MVTPCNHVFHTSCLENWMNYKLQ---CPVCR 752

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
           similar to uniprot|Q06834 Saccharomyces cerevisiae
           YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 291

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 11/69 (15%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGL-CPMCRQTFQ----LKKG 101
           +CP C        C LV  EC H +H +CI RW     S+ L CP CR   +    +++ 
Sbjct: 3   SCPICFESLSKGACRLV--ECGHKYHFNCIRRW--HYHSKNLQCPTCRIKSRHLEDIERK 58

Query: 102 LAINDSQIS 110
           + IN ++ S
Sbjct: 59  VTINLAEFS 67

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 33.1 bits (74), Expect = 0.20,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 3/34 (8%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTF 96
           +V  CNH FH  C+  W+        CP+CR + 
Sbjct: 729 MVTPCNHIFHTECLENWMGYKLQ---CPVCRSSL 759

>TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.157
           YHR115C
          Length = 524

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAIND 106
           + +  C+H +H  CI R + T+  + +CP CR T  L+  L  +D
Sbjct: 449 MFISPCSHCWHFQCIRRLVMTSYPQFVCPNCRLTCDLEASLENSD 493

>NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {ON}
           Anc_2.157 YHR115C
          Length = 554

 Score = 33.1 bits (74), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 10/63 (15%)

Query: 31  DDNDGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCP 90
           D  + D+ C IC +   A    C+       + +  C H++H HCI R +     + +CP
Sbjct: 463 DHANEDEDCSICLSKIKA----CQ------AIFISPCAHSWHFHCIRRLVMLTYPQFVCP 512

Query: 91  MCR 93
            CR
Sbjct: 513 NCR 515

>ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116W DMA2 Protein involved in regulating spindle
           position and orientation functionally redundant with
           Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 579

 Score = 33.1 bits (74), Expect = 0.22,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           + +  C+H++H  CI R + T+  + +CP CR
Sbjct: 506 MFISPCSHSWHFQCIRRLVMTSYPQFVCPNCR 537

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score = 33.1 bits (74), Expect = 0.22,   Method: Composition-based stats.
 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 4/63 (6%)

Query: 31  DDNDGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCP 90
           +D + D+VC +C     +  P      DG       C H  H+ C+  W++ + +   CP
Sbjct: 342 NDPNFDNVCIVCMDELVSENPH-HHQSDGKKPKKLPCGHVLHLSCLKNWMERSQT---CP 397

Query: 91  MCR 93
           +CR
Sbjct: 398 ICR 400

>Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON}
           YHR115C (REAL)
          Length = 413

 Score = 32.7 bits (73), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 22/41 (53%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           + +  C H++H HC+ R +  +  + +CP CR    L+  L
Sbjct: 335 IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCRSNCDLETTL 375

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
          similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 32.7 bits (73), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 67 CNHNFHVHCIYRWLDTATSRGLCPMCR 93
          C H FH+ CI +W  +  S   CP CR
Sbjct: 26 CQHEFHLSCIRKWYHSRISDRTCPNCR 52

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 33.1 bits (74), Expect = 0.26,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 21   ESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWL 80
            E+Q    + I D  G   C  C+   N  C  C+ P     +V+  C H  H  CI  W 
Sbjct: 1250 EAQQTGNKKIMDKFGYWYCDSCKKK-NTLCVLCERPLKKLTMVILPCGHEGHFQCIQEWF 1308

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 32.7 bits (73), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 46/124 (37%), Gaps = 29/124 (23%)

Query: 13  AWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFH 72
           A T   P  ++     T++DND +        +YN +    K P          C H F 
Sbjct: 198 ATTASTPTSNEPEPTTTVEDNDEE-----AHPTYNHSP--TKLP----------CGHIFG 240

Query: 73  VHCIYRWLDTATSRGLCPMCRQ------TFQLKKGLAINDSQISKFQELRNKQWQTRQQE 126
             C+YRW         CP+CR       T Q +   A +D     F+ +RN  + T    
Sbjct: 241 RECLYRWCKL---ENTCPLCRHVIAEVDTTQHQAQDAASD---QAFERIRNLVYNTNPTS 294

Query: 127 FGDQ 130
             DQ
Sbjct: 295 NDDQ 298

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 33.1 bits (74), Expect = 0.27,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 3/31 (9%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           +V  CNH FH  C+  W+        CP+CR
Sbjct: 725 MVTPCNHVFHTSCLENWMSYKLQ---CPVCR 752

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 32.7 bits (73), Expect = 0.27,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 3/31 (9%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           +V  CNH FH  C+  W+        CP+CR
Sbjct: 729 MVTPCNHIFHTECLENWMSYKLQ---CPVCR 756

>ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL116W and
           YHR115C
          Length = 467

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 23/41 (56%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           + +  C+H++H  CI R + T   + +CP CR +  L+  L
Sbjct: 381 IFISPCSHSWHYQCIRRLVMTQYPQFICPNCRSSCDLEASL 421

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score = 32.7 bits (73), Expect = 0.29,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 3/35 (8%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKG 101
           C H  H++C+  W++ + +   CPMCR     +KG
Sbjct: 352 CGHILHMNCLKNWMERSQT---CPMCRLPVFNEKG 383

>ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]
          {ON} some similarities with uniprot|Q12161
          Saccharomyces cerevisiae YOL054W PSH1 Nuclear protein
          putative RNA polymerase II elongation factor isolated
          as Pob3p/Spt16p- binding protein
          Length = 445

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 19/35 (54%)

Query: 63 VVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQ 97
          V+ +C HN+   C+  W D+ ++   CP CR +  
Sbjct: 41 VMTQCGHNYCYDCLSSWFDSNSNELSCPQCRASIS 75

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 32.7 bits (73), Expect = 0.32,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 16/32 (50%), Gaps = 3/32 (9%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
            ++  CNH FH  C+  W+        CP+CR
Sbjct: 720 FMITPCNHVFHTQCLENWMGYKLQ---CPVCR 748

>CAGL0G03553g Chr7 complement(345057..345689) [633 bp, 210 aa] {ON}
           weakly similar to uniprot|P40072 Saccharomyces
           cerevisiae YER116c YEU6
          Length = 210

 Score = 32.3 bits (72), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 50  CPGCKFPGDGCPLVVGECNHNFHVHCIYRWLD---TATSRGLCPMCRQTFQLKK 100
           CP C  P D    ++  C H F   C+++ ++   T    G+C +CR+T  +K+
Sbjct: 146 CPICFEPPDVA--IMTPCGHVFCCECLFQMVNNSRTPRKGGVCALCRKTINMKQ 197

>Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {ON}
           YHR115C (REAL)
          Length = 269

 Score = 32.3 bits (72), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 22/41 (53%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           + +  C H++H HC+ R +  +  + +CP CR    L+  L
Sbjct: 193 IFISPCAHSWHFHCVRRLVILSYPQFMCPNCRSNCDLEATL 233

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 7/49 (14%)

Query: 49  TCPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQT 95
           TCP C  +       L+   C H FH  C+ +W ++      CP+CR +
Sbjct: 234 TCPVCLERLDDGTTGLITIPCQHTFHCQCLDKWKNSK-----CPVCRYS 277

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score = 32.3 bits (72), Expect = 0.35,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 3/35 (8%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKG 101
           CNH  H+ C+  W++ + +   CP+CR +    KG
Sbjct: 339 CNHCLHLGCLKSWMERSQT---CPICRVSVFDSKG 370

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score = 32.3 bits (72), Expect = 0.37,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 8/70 (11%)

Query: 24  DAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTA 83
           D   E +DD D   +C IC      T    K       L    C H  H  C+  W++ +
Sbjct: 307 DVSEEQLDDTD--SMCIICMDDMLPTTETTKMNRRAKML---PCGHMLHFGCLKSWMERS 361

Query: 84  TSRGLCPMCR 93
            +   CP+CR
Sbjct: 362 QT---CPICR 368

>Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR231W
           (REAL)
          Length = 1030

 Score = 32.7 bits (73), Expect = 0.37,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 47  NATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDT-ATSRGL--CPMC 92
           N TC  C    D  P+V  +C H +H HC+    DT    R L  CP C
Sbjct: 926 NQTCFMCNLTLD-VPVVFFKCGHIYHQHCLNEEEDTLKNERKLFKCPKC 973

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 32.7 bits (73), Expect = 0.38,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 38/85 (44%), Gaps = 22/85 (25%)

Query: 60   CPLVVG--------ECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISK 111
            CP+ +G         C H F  +CI+ WL   ++   CP+C++            SQ+  
Sbjct: 1271 CPICLGLIHTGSMISCGHFFCNNCIFSWLKLNSN---CPLCKRD--------TTQSQLYN 1319

Query: 112  FQELRNK--QWQTRQQEFGDQQDPE 134
            F+  +N+  +  T  +E  D + P+
Sbjct: 1320 FK-FKNEITEESTNNEELSDIRAPQ 1343

>SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly
           similar to uniprot|Q12161 Saccharomyces cerevisiae
           YOL054W PSH1 Nuclear protein putative RNA polymerase II
           elongation factor isolated as Pob3p/Spt16p- binding
           protein
          Length = 331

 Score = 32.3 bits (72), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGL-CPMCRQTFQLKKGLAINDSQI 109
           V+  C HN+   CI  WL+   +  L CP CR +  +   L ++  Q+
Sbjct: 5   VMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSVSVPPVLNVSLQQL 52

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 14/98 (14%)

Query: 3   VKLREVHSVFAWTWHIPKESQD-----AHAETIDDNDGDDVCGICRASYNATCPGC--KF 55
           V ++EV  VF  T     +SQD         TI+ N+ + +          TCP C  + 
Sbjct: 188 VSIKEV--VFRTTLFQGNQSQDIPYLLTDPFTIEQNEQNKMKVKKNPVELPTCPVCLEQL 245

Query: 56  PGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
             +   L+   C H FH  C+ +W ++      CP+CR
Sbjct: 246 DCETTGLITIPCQHTFHCQCLDKWKNSR-----CPVCR 278

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 32.3 bits (72), Expect = 0.41,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 3/31 (9%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           +V  CNH FH  C+  W+        CP+CR
Sbjct: 726 MVTPCNHVFHTPCLENWMSYKLQ---CPVCR 753

>CAGL0A03432g Chr1 (349884..353339) [3456 bp, 1151 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032w RAD5
          Length = 1151

 Score = 32.3 bits (72), Expect = 0.42,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 34/85 (40%), Gaps = 14/85 (16%)

Query: 23  QDAHAETIDDNDGDDV-CGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLD 81
           +   A+ ID N    V C IC A           P +    VV EC H F   C+  + +
Sbjct: 880 ESVEAKFIDSNQLIPVECSICTAE----------PIESSSAVVTECEHVFCKECLEEYGN 929

Query: 82  TATSRGL---CPMCRQTFQLKKGLA 103
               + L   CP CR+   L + LA
Sbjct: 930 FQKEKSLQQKCPNCRRDINLNRCLA 954

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 32.3 bits (72), Expect = 0.46,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 19/88 (21%)

Query: 60   CPLVVGE--------CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISK 111
            C + +GE        C H F   CI+ WL    S   CP+C+    + +  +       K
Sbjct: 1223 CTICLGEIYMGSVIKCGHFFCQSCIFSWLKNHAS---CPLCKMQTSMSEVYSF------K 1273

Query: 112  FQELRNKQWQTRQQEFGDQQDPETNPLE 139
            FQ+ + +     +Q+   QQD +   +E
Sbjct: 1274 FQDAQPE--ADSEQDSAAQQDGDNKKIE 1299

>Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 29/59 (49%), Gaps = 12/59 (20%)

Query: 50  CPGCKFPGD------GCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR-QTFQLKKG 101
           CP C F GD      GC  V   C H FH++CI  W   +     CP+CR ++  LK G
Sbjct: 4   CPIC-FEGDQDGEQFGCLEV---CRHEFHLNCIREWHKYSIDLK-CPICRTESSHLKVG 57

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 32.3 bits (72), Expect = 0.50,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 38/89 (42%), Gaps = 19/89 (21%)

Query: 66   ECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQWQTRQQ 125
            +C H F   CI  WL    S   CP+C+            ++ +S+    + K+  T   
Sbjct: 1240 KCGHFFCKKCIQSWLKNKNS---CPLCK-----------TETGLSEIYNFKFKEEDTEYS 1285

Query: 126  EFGDQQDPETNPLED---QDDPMMDQGLI 151
             +G Q  P++  + D   ++D + D  ++
Sbjct: 1286 SYGSQ--PKSKEISDECYENDRITDDEMV 1312

>Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON}
           YHR115C (REAL)
          Length = 416

 Score = 32.0 bits (71), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 19/33 (57%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
           + +  C H++H HC+ R +  +  + +CP CR 
Sbjct: 340 IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCRS 372

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 32.0 bits (71), Expect = 0.58,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 3/31 (9%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           ++  CNH FH  C+  W+        CP+CR
Sbjct: 717 MITPCNHIFHTTCLENWMSYKLQ---CPVCR 744

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 31.6 bits (70), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 5/49 (10%)

Query: 50 CPG--CKFPGDGCPLVVGE---CNHNFHVHCIYRWLDTATSRGLCPMCR 93
          CP   C    +  P  VG    C H +H+ CI +W    +    CP+CR
Sbjct: 13 CPQDECSICWESMPSGVGRLMPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 32.0 bits (71), Expect = 0.64,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 3/37 (8%)

Query: 66  ECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           +C H F   CIY+W     S   CP+CR     ++GL
Sbjct: 246 KCGHRFGRMCIYQWTKEHNS---CPICRAEIVGREGL 279

>KLTH0E09174g Chr5 (830858..834304) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032W RAD5
           Single-stranded DNA-dependent ATPase involved in
           postreplication repair contains RING finger domain
          Length = 1148

 Score = 32.0 bits (71), Expect = 0.67,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 4/50 (8%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGL---CPMCRQTFQLKKGLAI-NDS 107
           +V  EC H F   CI  ++   + R     CP CRQ    KK L + NDS
Sbjct: 909 VVFTECGHTFCELCILEYIRFQSERKQEVKCPNCRQAIDSKKLLTLENDS 958

>YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}
           PEX10Peroxisomal membrane E3 ubiquitin ligase, required
           for for Ubc4p-dependent Pex5p ubiquitination and
           peroxisomal matrix protein import; contains zinc-binding
           RING domain; mutations in human homolog cause various
           peroxisomal disorders
          Length = 337

 Score = 31.6 bits (70), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 30/83 (36%), Gaps = 22/83 (26%)

Query: 18  IPKESQDAHAETIDDN------DGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNF 71
           IPKESQ  H    D N      +    C +C    N + P C             C H F
Sbjct: 259 IPKESQLTHINLSDKNQLPFIPEASRKCILCLM--NMSDPSC-----------APCGHLF 305

Query: 72  HVHCIYRWLDTATSRGLCPMCRQ 94
              C+  W      R  CP+CRQ
Sbjct: 306 CWSCLMSW---CKERPECPLCRQ 325

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score = 31.6 bits (70), Expect = 0.75,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 17/27 (62%), Gaps = 3/27 (11%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCR 93
           C H  H++C+  W++ + +   CP+CR
Sbjct: 347 CGHVLHLYCLKNWMERSQT---CPICR 370

>Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032W
           (REAL)
          Length = 1171

 Score = 31.6 bits (70), Expect = 0.76,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 17/82 (20%)

Query: 39  CGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGL---CPMCRQT 95
           C IC A           P D    +  EC H+F   C++ ++D    + L   CP CR +
Sbjct: 916 CSICTAE----------PIDLNKALFTECGHSFCEKCLFEYIDFQNGKKLCLKCPNCRDS 965

Query: 96  FQLKKGLAI----NDSQISKFQ 113
               + LA+    +DS+  +F+
Sbjct: 966 IDGGRLLALGRQRSDSERLEFK 987

>NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808
           YOL054W
          Length = 416

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query: 67  CNHNFHVHCIYRWLDTATSRGL-CPMCRQTFQL--KKGLAINDSQISKFQELRNKQWQTR 123
           C HNF   C+  W+ T  S+ L CP CR T     +  L + ++  S  + L  K+  +R
Sbjct: 45  CGHNFCYGCLNNWI-TGGSKDLNCPQCRSTINEAPRLNLILRETLDSIIEFLNEKKKVSR 103

Query: 124 QQEF 127
             +F
Sbjct: 104 DAQF 107

>YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}
           DMA1Ubiquitin-protein ligase (E3); controls septin
           dynamics and the spindle position checkpoint (SPOC)
           along with functionally redundant ligase Dma2p by
           regulating the recruitment of Elm1p to the bud neck;
           regulates levels of the translation initiation factor
           eIF2 subunit Gcd11p, as well as abundance, localization,
           and ubiquitination of Cdk inhibitory kinase Swe1p;
           ortholog of human RNF8 protein, with sequence similarity
           to human Chfr; contains FHA and RING finger domains
          Length = 416

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 21/41 (51%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           + +  C H++H HC+ R +     + +CP CR    L+  L
Sbjct: 340 IFISPCAHSWHFHCVRRLVIMNYPQFMCPNCRTNCDLETTL 380

>KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8.761
            YMR231W
          Length = 1036

 Score = 31.6 bits (70), Expect = 0.79,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 3/71 (4%)

Query: 47   NATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGL--CPMCRQTFQLKKGLAI 104
            N TC  CK P    P+V  +C H +H +C+     T  +  +  CP C    +    L+ 
Sbjct: 933  NQTCFMCKLPMH-LPMVYFKCGHIYHQNCMDEEYSTEENELIFKCPKCIVELETSNRLSE 991

Query: 105  NDSQISKFQEL 115
               +++   EL
Sbjct: 992  AQKEVATKTEL 1002

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 31.6 bits (70), Expect = 0.81,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 13/45 (28%)

Query: 67   CNHNFHVHCIYRWLDTATSRGLCPMCRQ----------TFQLKKG 101
            C H F   CI+ WL    +R  CP+C+           TF+L+ G
Sbjct: 1179 CGHLFCTSCIFSWL---KNRKTCPLCKHPTSNCEVYNFTFKLESG 1220

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 31.2 bits (69), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 2/56 (3%)

Query: 48  ATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR-QTFQLKKGL 102
           + C  C    D     +  CNH +H+ CI  W + +     CP CR +T QL   +
Sbjct: 17  SICAICLDAIDKSIAKLEPCNHKYHIDCIRTWHNYSNDLN-CPTCRIETNQLSVNI 71

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1333

 Score = 31.6 bits (70), Expect = 0.85,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 18/42 (42%), Gaps = 1/42 (2%)

Query: 39   CGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWL 80
            C  CR   N  C  C+ P     + + EC H FH  C  +W 
Sbjct: 1275 CDSCRKP-NTLCVICEQPMKKLAICLLECGHEFHFECGQQWF 1315

>Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ACR267C
          Length = 474

 Score = 31.2 bits (69), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 22/38 (57%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLK 99
           + +  C+H++H  CI R + T   + +CP CR +  L+
Sbjct: 390 IFISPCSHSWHYQCIRRLVMTQYPQFVCPNCRSSCDLE 427

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 31.6 bits (70), Expect = 0.86,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 33/86 (38%), Gaps = 12/86 (13%)

Query: 13  AWTWHIPKESQD--AHAETIDDNDGDDVCGICRAS---YNATCPGCKFPGDGCPLVVGEC 67
            +++H P  +Q+   H  ++D       C IC +    Y    P      D    +   C
Sbjct: 678 GYSYHKPMSAQELMEHGSSVDHTVD---CAICMSEVPVYVEDVPETH-KVDLQTYMTTPC 733

Query: 68  NHNFHVHCIYRWLDTATSRGLCPMCR 93
            H FH  C+  W+        CP+CR
Sbjct: 734 GHVFHTQCLENWMSYKLQ---CPVCR 756

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score = 31.2 bits (69), Expect = 0.93,   Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 3/35 (8%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKG 101
           C H  H+ C+  W++ + +   CP+CR +   +KG
Sbjct: 372 CGHILHLSCLKNWMERSQT---CPICRLSVFDEKG 403

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 31.2 bits (69), Expect = 0.95,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 3/36 (8%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           C H F   CIY+W     S   CP+CRQ      G+
Sbjct: 257 CGHIFGRECIYKWSRLENS---CPLCRQKISESVGV 289

>KAFR0D01670 Chr4 complement(332442..333515) [1074 bp, 357 aa]
          {ON} Anc_8.808 YOL054W
          Length = 357

 Score = 31.2 bits (69), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 59 GCPLVVGECNHNFHVHCIYRWLDTATSRGL-CPMCRQTFQLK 99
            P++V  C H +   C+  W     +R L CP CR + +++
Sbjct: 41 SIPMMVTPCGHTYCYECLLTWFKNNENRELNCPDCRVSIEVE 82

>Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)
           [1008 nt, 336 aa]
          Length = 335

 Score = 31.2 bits (69), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 35/91 (38%), Gaps = 6/91 (6%)

Query: 50  CPGC--KFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR-QTFQLKKGLAIND 106
           C  C  +F  D C L    C+H FH+ CI  W   A     CP CR ++  +  G     
Sbjct: 6   CAICFEEFKEDRCAL--NPCHHTFHLECIRIWHSYADDLK-CPTCRTESETITLGFEGVS 62

Query: 107 SQISKFQELRNKQWQTRQQEFGDQQDPETNP 137
                   LR+  +  + QEF +       P
Sbjct: 63  DGYGVIINLRDGFYVRKLQEFSEMTSVGQTP 93

>Kpol_478.8 s478 complement(33393..38306,38308..39462) [6069 bp, 2022
            aa] {ON} complement(33393..38306,38308..39462) [6069 nt,
            2023 aa]
          Length = 2022

 Score = 31.2 bits (69), Expect = 1.0,   Method: Composition-based stats.
 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 4/33 (12%)

Query: 67   CNHNFHVHCIYRWL---DTATSRGLCPMCRQTF 96
            CNH FH+ C+ R+L       +  +CP+C QT+
Sbjct: 1337 CNHKFHLKCVDRYLAKKKFKFAAFICPLC-QTY 1368

>AEL104W Chr5 (431236..434493) [3258 bp, 1085 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL157C (FAR1)
          Length = 1085

 Score = 31.2 bits (69), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 27/64 (42%), Gaps = 7/64 (10%)

Query: 37  DVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTF 96
           + C IC  + NA   G +       +V   C+H  H HC +  L+ +      P C+   
Sbjct: 215 NACSICGENLNALLAGER-------IVELTCDHQSHYHCYFTLLEVSVQNDKYPRCQLCG 267

Query: 97  QLKK 100
           Q +K
Sbjct: 268 QERK 271

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 31.2 bits (69), Expect = 1.1,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 3/31 (9%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           +V  C+H FH  C+  W+        CP+CR
Sbjct: 725 MVTPCDHVFHTSCLENWMSYKLQ---CPVCR 752

>KAFR0B04600 Chr2 complement(956458..957684) [1227 bp, 408 aa] {ON}
           Anc_2.157 YHR115C
          Length = 408

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 39/94 (41%), Gaps = 12/94 (12%)

Query: 15  TWHIPKESQDAHAETIDDNDGDD--VCGICRASYNATCPGCKFPGDGCPLVVGECNHNFH 72
           +W +  +  +    TI   +  D  +C IC    +        P  G  + V  C H +H
Sbjct: 320 SWKLKTKPLEGIINTISLENSQDKELCSICLEKMS--------PYQG--VFVSPCCHLWH 369

Query: 73  VHCIYRWLDTATSRGLCPMCRQTFQLKKGLAIND 106
            +CI R +     + +CP CR T  L+  + + D
Sbjct: 370 YNCIRRVITQHYPQFVCPNCRYTSDLESPIGLPD 403

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 30.8 bits (68), Expect = 1.2,   Method: Composition-based stats.
 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 3/32 (9%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
           VV  CNH F   C+++W     S   CP+CR 
Sbjct: 214 VVLPCNHVFGRECLFKWSQLENS---CPLCRH 242

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 30.8 bits (68), Expect = 1.2,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 3/36 (8%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           C H F   CIY+W     S   CP+CR       G+
Sbjct: 256 CGHIFGRECIYKWSKLENS---CPLCRHKISESAGI 288

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score = 30.8 bits (68), Expect = 1.2,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 17/67 (25%)

Query: 31  DDNDGDDVCGICR----ASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSR 86
           D  D D+VC +C     +  +      + P          C H  H+ C+  W++ + + 
Sbjct: 345 DLQDSDNVCIVCMDDLLSEEHKKKKAKRLP----------CGHFLHLSCLKNWMERSQT- 393

Query: 87  GLCPMCR 93
             CP+CR
Sbjct: 394 --CPICR 398

>TBLA0D00440 Chr4 (107763..108644) [882 bp, 293 aa] {ON} Anc_7.416
           YER116C
          Length = 293

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 5/64 (7%)

Query: 40  GICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSR---GLCPMCRQTF 96
            I R      CP C  P +    VV  C H F   C ++ L+ + +R   G C +CR   
Sbjct: 216 AISRPCTEYKCPICLEPPETS--VVTPCGHVFCAGCAFQMLNQSRARTRHGHCALCRNNV 273

Query: 97  QLKK 100
            L+ 
Sbjct: 274 NLQS 277

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 31.2 bits (69), Expect = 1.2,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%)

Query: 66   ECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNK 118
            +C H +   CI+ WL+ +  +  CP+C      K    IND+   KF    N+
Sbjct: 1151 KCGHYYCQDCIWNWLEKSKKKN-CPIC------KIETNINDTYNFKFDSTNNE 1196

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score = 30.8 bits (68), Expect = 1.2,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 17/27 (62%), Gaps = 3/27 (11%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCR 93
           C H  H++C+  W++ + +   CP+CR
Sbjct: 371 CGHILHLNCLKNWMERSQT---CPICR 394

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 30.8 bits (68), Expect = 1.3,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 24/59 (40%), Gaps = 9/59 (15%)

Query: 39  CGICRASYNATCPGCKFPG----DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           C IC A +       + P     D    ++  C+H FH  C+  W+        CP+CR
Sbjct: 698 CAICMAEFPVYVE--ELPETHQVDKDSYMITPCDHMFHTSCLESWMSYKLQ---CPVCR 751

>KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some
           similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 306

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGL-CPMCRQTFQLKKGLAI 104
           V+  C HN+   CI  WL +  +  L CP CR   +    L +
Sbjct: 5   VMTSCGHNYCYECISNWLVSNNANELTCPQCRSPLKEPPALNV 47

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score = 30.8 bits (68), Expect = 1.4,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCR 93
           C H  H+ C+  W++ + +   CP+CR
Sbjct: 392 CGHMLHLSCLKNWMERSQT---CPICR 415

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 30.8 bits (68), Expect = 1.4,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 3/37 (8%)

Query: 66  ECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           +C H F   CIY+W     S   CP+CR     ++GL
Sbjct: 230 KCGHVFGRVCIYQWTKENNS---CPICRANIVGREGL 263

>TBLA0B03370 Chr2 complement(784352..787546) [3195 bp, 1064 aa] {ON}
            Anc_8.761 YMR231W
          Length = 1064

 Score = 30.8 bits (68), Expect = 1.5,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 27/66 (40%), Gaps = 3/66 (4%)

Query: 47   NATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGL--CPMCRQTFQLKKGLAI 104
            N TC  C    D  P+V   CNH +H  C+    +      L  CP C    Q  + L  
Sbjct: 961  NETCRMCHSSLD-LPIVFFRCNHIYHQKCLNEETNFKDGEKLFRCPKCVIDLQTSQKLVS 1019

Query: 105  NDSQIS 110
              ++I+
Sbjct: 1020 TQNEIA 1025

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 12/60 (20%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRG-----LCPMCR------QTFQLKKGLAINDSQIS 110
           +V+  C H FH  C+  W  +   RG     +CP+CR      + F ++ GL +++ +++
Sbjct: 180 IVMIPCQHYFHAGCLKEWF-SPQRRGKRRPLVCPLCRMDIVKCKAFCMRLGLLMSELKVT 238

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 30.8 bits (68), Expect = 1.6,   Method: Composition-based stats.
 Identities = 18/82 (21%), Positives = 35/82 (42%), Gaps = 14/82 (17%)

Query: 64   VGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQWQTR 123
            V +C H F   CI+ WL    +   CP+C+          +  S++  F   R K+ +  
Sbjct: 1176 VVKCGHFFCYSCIHTWLKEHNT---CPLCKTN--------VTPSEVYNF---RYKEGEEL 1221

Query: 124  QQEFGDQQDPETNPLEDQDDPM 145
             ++  ++   E+ P   +  P+
Sbjct: 1222 PEDGAEEAAQESGPFSQKPKPV 1243

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 30.8 bits (68), Expect = 1.6,   Method: Composition-based stats.
 Identities = 18/82 (21%), Positives = 35/82 (42%), Gaps = 14/82 (17%)

Query: 64   VGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNKQWQTR 123
            V +C H F   CI+ WL    +   CP+C+          +  S++  F   R K+ +  
Sbjct: 1176 VVKCGHFFCYSCIHTWLKEHNT---CPLCKTN--------VTPSEVYNF---RYKEGEEL 1221

Query: 124  QQEFGDQQDPETNPLEDQDDPM 145
             ++  ++   E+ P   +  P+
Sbjct: 1222 PEDGAEEAAQESGPFSQKPKPV 1243

>Kpol_1030.29 s1030 complement(56650..59700) [3051 bp, 1016 aa] {ON}
           complement(56650..59700) [3051 nt, 1017 aa]
          Length = 1016

 Score = 30.8 bits (68), Expect = 1.6,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 5/66 (7%)

Query: 47  NATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGL---CPMCRQTFQLKKGLA 103
           N  C  C+  G   P+VV +C HN+H  C+    D  T   +   CP C    +  + LA
Sbjct: 914 NVNCCMCE-AGLELPIVVFKCTHNYHQRCLNE-EDKKTDGSIVYKCPKCIVDLESSERLA 971

Query: 104 INDSQI 109
            +  ++
Sbjct: 972 KSQQEV 977

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 30.4 bits (67), Expect = 1.7,   Method: Composition-based stats.
 Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 3/31 (9%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           ++  C+H FH  C+  W+        CP+CR
Sbjct: 714 MITPCSHIFHTQCLESWMSYKLQ---CPVCR 741

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 30.4 bits (67), Expect = 1.8,   Method: Composition-based stats.
 Identities = 11/36 (30%), Positives = 17/36 (47%), Gaps = 3/36 (8%)

Query: 58  DGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           D    ++  C+H FH  C+  W+        CP+CR
Sbjct: 719 DAQSYMITPCSHIFHTECLENWMSYKLQ---CPVCR 751

>Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W -
           Hypothetical ORF [contig 36] FULL
          Length = 300

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 1/41 (2%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGL-CPMCRQTFQLKKGL 102
           V+  C HN+   CI  WL +  +  L CP CR   + +  L
Sbjct: 5   VMTTCGHNYCYDCISNWLVSNNANELTCPQCRSPLKEQPSL 45

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 30.4 bits (67), Expect = 1.8,   Method: Composition-based stats.
 Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 3/31 (9%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           ++  C+H FH  C+  W+        CP+CR
Sbjct: 717 MITPCSHIFHTQCLESWMSYKLQ---CPVCR 744

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 30.4 bits (67), Expect = 1.9,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 3/31 (9%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           +V  C+H FH  C+  W+        CP+CR
Sbjct: 728 MVTPCDHIFHTDCLENWMGYKLQ---CPVCR 755

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score = 30.4 bits (67), Expect = 2.0,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCR 93
           C H  H+ C+  W++ + +   CP+CR
Sbjct: 367 CGHVLHLFCLKNWMERSQT---CPICR 390

>YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA
           helicase proposed to promote replication fork regression
           during postreplication repair by template switching;
           RING finger containing ubiquitin ligase; stimulates the
           synthesis of free and PCNA-bound polyubiquitin chains by
           Ubc13p-Mms2p
          Length = 1169

 Score = 30.4 bits (67), Expect = 2.0,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 66  ECNHNFHVHCIYRWLDTATSRGL---CPMCRQTFQLKKGLAI 104
           EC H+F   C++ +++   S+ L   CP CR      + LA+
Sbjct: 931 ECGHSFCEKCLFEYIEFQNSKNLGLKCPNCRNQIDACRLLAL 972

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 30.4 bits (67), Expect = 2.0,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 37/87 (42%), Gaps = 16/87 (18%)

Query: 66   ECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKF----QELRNKQWQ 121
            +C H F   C+  W    TS   CPMC+          ++ S++  F    +EL+ +   
Sbjct: 1222 KCGHFFCKDCVTHWFKKNTS---CPMCKNR--------MSSSEVYHFKFREEELKEED-D 1269

Query: 122  TRQQEFGDQQDPETNPLEDQDDPMMDQ 148
            T   E   + D +TN   D +D   ++
Sbjct: 1270 TDNPEQVTKDDDQTNSSSDGNDTTHEE 1296

>Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116W
           (REAL)
          Length = 580

 Score = 30.4 bits (67), Expect = 2.0,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 21/38 (55%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLK 99
           + +  C H++H  C+ R +  +  + +CP CR +  L+
Sbjct: 504 IFISPCAHSWHFRCVRRLVMLSYPQFICPNCRSSCDLE 541

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score = 30.4 bits (67), Expect = 2.0,   Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 3/35 (8%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKG 101
           C H  H+ C+  W++ + +   CP+CR     +KG
Sbjct: 377 CGHILHLSCLKNWMERSQT---CPICRLPVFDEKG 408

>KNAG0A06030 Chr1 complement(909762..913214) [3453 bp, 1150 aa] {ON}
           Anc_2.411 YLR032W
          Length = 1150

 Score = 30.4 bits (67), Expect = 2.1,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 4/60 (6%)

Query: 47  NATCPGCKF-PGDGCPLVVGECNHNFHVHCIYRWLDTATSRGL---CPMCRQTFQLKKGL 102
           N  C  C   P D   L++ +C H F   CI  ++     + L   CP+CR+      G+
Sbjct: 891 NLECSICTTEPIDPHKLILTDCGHPFCDKCILEYITYQKEKKLDVKCPICREMLDDTSGM 950

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 30.0 bits (66), Expect = 2.2,   Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 3/35 (8%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKG 101
           C H  H+ C+  W++ + +   CP+CR     +KG
Sbjct: 375 CGHILHLSCLKNWMERSQT---CPICRLPVFDEKG 406

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 30.0 bits (66), Expect = 2.3,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 3/31 (9%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           +V  C H FH  C+  W+        CP+CR
Sbjct: 718 MVTPCGHIFHTQCLESWMSYKLQ---CPVCR 745

>Skud_14.216 Chr14 (398407..399999) [1593 bp, 530 aa] {ON} YNL116W
           (REAL)
          Length = 530

 Score = 30.0 bits (66), Expect = 2.3,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 21/38 (55%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLK 99
           + +  C H++H  C+ R +  +  + +CP CR +  L+
Sbjct: 454 IFISPCAHSWHFRCVRRLVMLSYPQFVCPNCRSSCDLE 491

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
          {ON} weakly similar to uniprot|Q06834 Saccharomyces
          cerevisiae YPR093C ASR1 Protein involved in a putative
          alcohol-responsive signaling pathway accumulates in the
          nucleus under alcohol stress contains a Ring/PHD finger
          domain
          Length = 273

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 67 CNHNFHVHCIYRWLDTATSRGLCPMCR 93
          CNH FH  C+ RW   A    +CP+CR
Sbjct: 25 CNHKFHRDCLRRWHLYAHD-LVCPICR 50

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 30.0 bits (66), Expect = 2.4,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 3/31 (9%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           +V  C H FH  C+  W+        CP+CR
Sbjct: 732 MVTPCAHIFHTQCLENWMSYKLQ---CPVCR 759

>Suva_10.112 Chr10 (211443..214946) [3504 bp, 1167 aa] {ON} YLR032W
           (REAL)
          Length = 1167

 Score = 30.0 bits (66), Expect = 2.4,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 13/69 (18%)

Query: 39  CGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGL---CPMCRQT 95
           C IC A           P D    V  EC H+F   C++ +++    + L   CP CR+ 
Sbjct: 914 CSICTAE----------PIDLDNAVFTECGHSFCEKCLFEYIEFQNGKQLSLKCPNCREP 963

Query: 96  FQLKKGLAI 104
               + LA+
Sbjct: 964 IDGGRLLAL 972

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score = 30.0 bits (66), Expect = 2.4,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCR 93
           C H  H+ C+  W++ + +   CP+CR
Sbjct: 376 CGHILHLSCLKNWMERSQT---CPICR 399

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 30.0 bits (66), Expect = 2.4,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 3/38 (7%)

Query: 56  PGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           P  G    V  C H F   C+Y+W    T    CP+CR
Sbjct: 208 PTYGHSATVLPCGHVFGRECLYKW---TTEHNSCPICR 242

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 30.0 bits (66), Expect = 2.5,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 3/31 (9%)

Query: 63  VVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           +V  C H FH  C+  W+        CP+CR
Sbjct: 725 MVTPCAHVFHTECLENWMSYKLQ---CPVCR 752

>ZYRO0A13398g Chr1 complement(1057353..1064966) [7614 bp, 2537 aa]
           {ON} some similarities with uniprot|P48415 Saccharomyces
           cerevisiae YPL085W SEC16 COPII vesicle coat protein
           required for ER transport vesicle budding and
           autophagosome formation Sec16p is bound to the periphery
           of ER membranes and may act to stabilize initial COPII
           complexes interacts with Sec23p Sec24p and Sec31p
          Length = 2537

 Score = 30.0 bits (66), Expect = 2.5,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 6   REVHSVFAWTWHIPKESQDAHAETIDDNDGDD 37
           +E+ +  A   H+P+ES+  H +T+ D+ GDD
Sbjct: 607 QEMQTRTAKNAHVPEESKQEHVDTLFDDPGDD 638

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score = 30.0 bits (66), Expect = 2.5,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCR 93
           C H  H  C+  W++ + +   CP+CR
Sbjct: 400 CGHMLHFSCLKNWMERSQT---CPICR 423

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 30.0 bits (66), Expect = 2.5,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 3/36 (8%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGL 102
           C H F   CIY+W     S   CP+CR       G+
Sbjct: 267 CGHIFGRECIYKWSRLENS---CPLCRHKISENAGV 299

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 30.0 bits (66), Expect = 2.6,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 3/28 (10%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCRQ 94
           C+H F   C+Y+W     S   CP+CR 
Sbjct: 246 CDHIFGRECLYKWSKLENS---CPLCRH 270

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
            IRC20Putative helicase; localizes to the mitochondrion
            and the nucleus; YLR247C is not an essential gene; null
            mutant displays increased levels of spontaneous Rad52p
            foci
          Length = 1556

 Score = 30.0 bits (66), Expect = 2.7,   Method: Composition-based stats.
 Identities = 20/85 (23%), Positives = 34/85 (40%), Gaps = 14/85 (16%)

Query: 60   CPLVVGE--------CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISK 111
            C + +GE        C H F   CI  WL   +    CP+C+    + +   + + +   
Sbjct: 1239 CSICLGEVEIGAIIKCGHYFCKSCILTWLRAHSK---CPICKGFCSISE---VYNFKFKN 1292

Query: 112  FQELRNKQWQTRQQEFGDQQDPETN 136
              E R K+ Q  ++E  D     +N
Sbjct: 1293 STEKREKEIQEPRREGADSSQDNSN 1317

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 30.0 bits (66), Expect = 2.7,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 22/53 (41%), Gaps = 4/53 (7%)

Query: 39   CGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRW-LDTATSRGLCP 90
            C  CR   N+ C  C+ P     L    C H  H  C+ +W LD   S   CP
Sbjct: 1304 CDSCRKP-NSLCVYCEQPMKKLALSFLNCGHGGHFECLQQWFLDEGMSE--CP 1353

>YNL116W Chr14 (408341..409909) [1569 bp, 522 aa] {ON}
           DMA2Ubiquitin-protein ligase (E3); controls septin
           dynamics and the spindle position checkpoint (SPOC)
           along with functionally redundant ligase Dma1p by
           regulating the recruitment of Elm1p to the bud neck;
           regulates levels of the translation initiation factor
           eIF2 subunit Gcd11p, as well as abundance, localization,
           and ubiquitination of Cdk inhibitory kinase Swe1p;
           ortholog of human RNF8 protein, with sequence similarity
           to human Chfr; contains FHA and RING finger domains
          Length = 522

 Score = 29.6 bits (65), Expect = 2.8,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 21/38 (55%)

Query: 62  LVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLK 99
           + +  C H++H  C+ R +  +  + +CP CR +  L+
Sbjct: 446 IFISPCAHSWHFRCVRRLVMLSYPQFVCPNCRSSCDLE 483

>SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa] {ON}
            similar to uniprot|P40340 Saccharomyces cerevisiae
            YGR270W YTA7 Protein of unknown function member of
            CDC48/PAS1/SEC18 family of ATPases potentially
            phosphorylated by Cdc28p
          Length = 1337

 Score = 30.0 bits (66), Expect = 2.9,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 89   CPMCRQTFQLKKGLAINDSQ--ISKFQELRNKQWQTRQQEFGDQQ 131
            C + RQ   L++ L + D +  I K QEL+NK+ Q  +QE   Q+
Sbjct: 1083 CKITRQRDILRQELFLKDEKERILKEQELQNKRLQEEKQELESQE 1127

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 29.6 bits (65), Expect = 3.0,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 17/38 (44%), Gaps = 3/38 (7%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAI 104
           C H F   C+Y+W     S   CP+CR       G+ +
Sbjct: 275 CGHVFGRECLYKWSRLENS---CPLCRHKISESAGVPV 309

>TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] {ON}
            Anc_8.288 YDR128W
          Length = 1178

 Score = 30.0 bits (66), Expect = 3.0,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 19/52 (36%), Gaps = 2/52 (3%)

Query: 50   CPGCKFPGDGCPLVVGECNHNFHVHCIYRW--LDTATSRGLCPMCRQTFQLK 99
            C  C  P D    + G C H  H  C   W  +D+    G    C   F L+
Sbjct: 1127 CVYCNHPADRSVFICGNCQHIMHPKCAQVWWKVDSECPSGCGCHCPDVFDLE 1178

>Smik_5.88 Chr5 complement(126509..127312) [804 bp, 267 aa] {ON}
           YEL019C (REAL)
          Length = 267

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 46/104 (44%), Gaps = 13/104 (12%)

Query: 35  GDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCP--MC 92
           G+D   I       TCP    P +  P++  +CNH F  + I  +L   T+R  CP   C
Sbjct: 169 GEDDLQIEGGKIELTCPITCKPYE-TPMISKKCNHVFDKNGIQNYLQGYTTRD-CPQAAC 226

Query: 93  RQTFQLKKGLAINDSQISKFQELRNKQWQTRQQEFGDQQDPETN 136
            Q   ++  ++          ELR K  + ++ +   +QD E+N
Sbjct: 227 SQVVSMRDFVS------DPIMELRCKIARIKKSQ---EQDKESN 261

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score = 29.6 bits (65), Expect = 3.2,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 14/27 (51%), Gaps = 3/27 (11%)

Query: 67  CNHNFHVHCIYRWLDTATSRGLCPMCR 93
           C H  H  C+  W+  A +   CP+CR
Sbjct: 363 CGHMLHFGCLKSWMQRAQT---CPICR 386

>SAKL0D10890g Chr4 (904673..905470) [798 bp, 265 aa] {ON} similar to
           uniprot|P38632 Saccharomyces cerevisiae YEL019C MMS21
           Protein involved in DNA repair mutants are sensitive to
           the alkylating agent methyl methanesulfonate and show
           increased spontaneous mutation and mitotic recombination
          Length = 265

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 37/97 (38%), Gaps = 9/97 (9%)

Query: 5   LREVHSVFAWTWHIPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGCPLVV 64
           + +V     + W      QD      DDN  +D   I   S   TCP    P +  P++ 
Sbjct: 143 ISKVLKALPYIW------QDPTCVIPDDNMDEDDLQIAGGSIELTCPITCKPYEK-PMIS 195

Query: 65  GECNHNFHVHCIYRWLDTATSRGLCP--MCRQTFQLK 99
            +C H F +  I  +L        CP   C Q  +++
Sbjct: 196 KKCGHVFDLSGIQEYLKDHRGPKKCPQGACGQEVEMR 232

>ZYRO0E03498g Chr5 complement(274104..274835) [732 bp, 243 aa] {ON}
           similar to uniprot|P38632 Saccharomyces cerevisiae
           YEL019C MMS21 Protein involved in DNA repair mutants are
           sensitive to the alkylating agent methyl
           methanesulfonate and show increased spontaneous mutation
           and mitotic recombination
          Length = 243

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 7/99 (7%)

Query: 18  IPKESQDAHAETIDDNDGDDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIY 77
           +P   QD      DD DGDD+  I        CP    P +  P++  +C H F    + 
Sbjct: 134 LPHIWQDPQCLLPDDTDGDDL-QIRGGRIELICPITCKPFEN-PMISKKCGHVFDNSGLN 191

Query: 78  RWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELR 116
            + ++  SR     C Q   L+K L + D ++ +  +LR
Sbjct: 192 NYFESYPSRD----CPQGACLQK-LTLRDFKVDELMKLR 225

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
            YOL138C (REAL)
          Length = 1332

 Score = 29.6 bits (65), Expect = 3.5,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 4/55 (7%)

Query: 39   CGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRW-LDTATSR--GLCP 90
            C  C+   N  C  C+ P     +V+  C H  H  CI  W LD       G CP
Sbjct: 1274 CDSCKKK-NTPCILCERPLKKLTMVILPCGHEGHFQCIQEWFLDEKEHECPGGCP 1327

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL138C
            - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 29.6 bits (65), Expect = 3.6,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 4/53 (7%)

Query: 39   CGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRW-LDTATSRGLCP 90
            C +C +  N  C  C+ P     + +  C H  H  C  RW +D   S   CP
Sbjct: 1228 CDLC-SRMNTLCALCERPLKKLTMCILSCGHEGHPECFQRWFMDEEMSE--CP 1277

>CAGL0I09988g Chr9 complement(951638..952801) [1164 bp, 387 aa]
          {ON} similar to uniprot|Q12161 Saccharomyces cerevisiae
          YOL054w
          Length = 387

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 63 VVGECNHNFHVHCIYRWLDTATSRG--LCPMCR 93
          +  EC H++   C+  W  + T+RG   CP CR
Sbjct: 41 MTTECGHSYCYTCLKTWFSSDTNRGGLSCPECR 73

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 30/85 (35%), Gaps = 33/85 (38%)

Query: 36  DDVCGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR-- 93
           +D+CG    SY                 +  C H +H  CI +W   A     CPMCR  
Sbjct: 11  EDICGKSSTSY-----------------LKPCGHEYHSDCIRKWHGHAEDLK-CPMCRID 52

Query: 94  -------------QTFQLKKGLAIN 105
                        +   L+KG A+N
Sbjct: 53  AEELVVKLYGCAEKIIDLQKGFAVN 77

>TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON}
           Anc_8.761 YMR231W
          Length = 1018

 Score = 29.6 bits (65), Expect = 3.9,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 47  NATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRG--LCPMC 92
           N  C  CK   +  P++  +C H +H  C+ + LD  +     +CP C
Sbjct: 915 NEKCDYCKANLE-IPIIYFQCGHTYHERCLNKELDQNSGDEVYVCPKC 961

>Smik_12.94 Chr12 (191768..195304) [3537 bp, 1178 aa] {ON} YLR032W
           (REAL)
          Length = 1178

 Score = 29.6 bits (65), Expect = 3.9,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 26/59 (44%), Gaps = 13/59 (22%)

Query: 39  CGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGL---CPMCRQ 94
           C IC A           P D   ++  EC H+F   C++ +++    + L   CP CR+
Sbjct: 923 CSICTAE----------PIDIDKVLFTECGHSFCEKCLFEYIEFQKGKNLCLKCPNCRK 971

>Skud_10.59 Chr10 complement(99006..101504) [2499 bp, 832 aa] {ON}
           YJL157C (REAL)
          Length = 832

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 7/55 (12%)

Query: 39  CGICRASYNATCPGCKFPGDGCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCR 93
           C IC  S ++T  G K       +V   C+H  H +C     +T   +G  P C+
Sbjct: 202 CLICEESISSTFTGEK-------VVESTCSHTSHYNCYLMLFETLYFQGKFPECK 249

>TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}
          Anc_3.405 YPR093C
          Length = 93

 Score = 28.1 bits (61), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%)

Query: 67 CNHNFHVHCIYRWLDTATSRGLCPMCR 93
          C H FH  CI RW   A     CP CR
Sbjct: 26 CRHKFHKECIRRWHTGAIDLK-CPTCR 51

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa]
          {ON} Anc_8.808 YOL054W
          Length = 392

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 63 VVGECNHNFHVHCIYRWLDTATSRGL-CPMCR 93
          ++  C HN+   C+  W+ T + + L CP CR
Sbjct: 41 MMTSCGHNYCYGCLKSWISTNSKKELACPQCR 72

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,187,105
Number of extensions: 751126
Number of successful extensions: 3163
Number of sequences better than 10.0: 314
Number of HSP's gapped: 3117
Number of HSP's successfully gapped: 314
Length of query: 153
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 53
Effective length of database: 42,014,799
Effective search space: 2226784347
Effective search space used: 2226784347
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)